mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-11-02 06:59:36 +01:00
13230 lines
310 KiB
Plaintext
13230 lines
310 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: Lazarus 0.9.19\n"
|
|
"Report-Msgid-Bugs-To: \n"
|
|
"POT-Creation-Date: 2006-09-21 10:58+0200\n"
|
|
"PO-Revision-Date: 2006-09-22 16:53+0200\n"
|
|
"Last-Translator: Graeme Geldenhuys <graemeg@gmail.com>\n"
|
|
"Language-Team: English <en@li.org>\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"Plural-Forms: \n"
|
|
|
|
#: lazarusidestrconsts.dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgadditionalsrcpath
|
|
msgid "Additional Source search path for all projects (.pp;.pas)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgallfiles
|
|
msgid "All files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaltsetclmode
|
|
msgid "Alt-Key sets column mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
|
msgid "Always visible cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgapplicationsettings
|
|
msgid "Application Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgassemblerdefault
|
|
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
|
|
msgid "Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgassertcode
|
|
msgid "Include Assertion Code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreatenewforms
|
|
msgid "When creating new forms, add them to auto-created forms"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoform
|
|
msgid "Auto create form when opening unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoindent
|
|
msgid "Auto indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
|
msgid "Auto remove empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautosave
|
|
msgid "Auto save"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbackcolor
|
|
msgid "Background"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbaknosubdirectory
|
|
msgid "(no subdirectory)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindent
|
|
msgid "Block indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttype
|
|
msgid "Indent method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypecopy
|
|
msgid "Space/tab as prev Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypepos
|
|
msgid "Position only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypespace
|
|
msgid "Spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbp7cptb
|
|
msgid "TP/BP 7.0 Compatible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbrackethighlight
|
|
msgid "Bracket highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbrowsemsgfilter
|
|
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbutapply
|
|
msgid "Apply"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcancel
|
|
msgctxt "lazarusidestrconsts.dlgcancel"
|
|
msgid "Cancel"
|
|
msgstr "Kanselleer"
|
|
|
|
#: lazarusidestrconsts.dlgcasesensitive
|
|
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccoresults
|
|
msgid "Results"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotest
|
|
msgctxt "lazarusidestrconsts.dlgccotest"
|
|
msgid "Test"
|
|
msgstr "Toets"
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
|
|
msgid "Test: Checking fpc configs ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestmissingppu
|
|
msgid "Test: Checking missing fpc ppu ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Laaste"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtpreview
|
|
msgid "Preview (Max line length = 1)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcentercursorline
|
|
msgid "Center Cursor Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcharcasefileact
|
|
msgid "Save As - auto rename pascal files lower case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcheckconsistency
|
|
msgid "Check consistency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgclassinsertpolicy
|
|
msgid "Class part insert policy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Kleurskema"
|
|
|
|
#: lazarusidestrconsts.dlgcmacro
|
|
msgid "C Style Macros (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoansistr
|
|
msgid "Use Ansi Strings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoasis
|
|
msgid "As-Is"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoasmstyle
|
|
msgid "Assembler style:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
|
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
|
msgid "Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcochecks
|
|
msgid "Checks:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocompilation
|
|
msgid "Compilation"
|
|
msgstr "Vertaleering"
|
|
|
|
#: lazarusidestrconsts.dlgcoconditionals
|
|
msgid "Conditionals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocops
|
|
msgid "C Style Operators (*=, +=, /= and -=)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocreatechildnode
|
|
msgid "Create child node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocreatemakefile
|
|
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocreatenodeabove
|
|
msgid "Create node above"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocreatenodebelow
|
|
msgid "Create node below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodbx
|
|
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodebugging
|
|
msgid "Debugging:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldingmouse
|
|
msgid "Mouse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodegeneration
|
|
msgid "Code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodetoolsopts
|
|
msgid "CodeTools Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcofast
|
|
msgid "Faster Code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcogdb
|
|
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcogenerate
|
|
msgid "Generate:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoheaptrc
|
|
msgid "Use Heaptrc Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoincfiles
|
|
msgid "Include Files (-Fi):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoinherited
|
|
msgctxt "lazarusidestrconsts.dlgcoinherited"
|
|
msgid "Inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcokeepvarsreg
|
|
msgid "Keep certain variables in registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolinking
|
|
msgid "Linking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoloadsave
|
|
msgid "Load/Save"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolor
|
|
msgid "Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparameters
|
|
msgid "Command line parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcomovedown
|
|
msgid "Move down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcomoveleveldown
|
|
msgid "Move level down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcomovelevelup
|
|
msgid "Move level up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcomoveup
|
|
msgid "Move up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessage
|
|
msgid "Compiler Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompileroptions
|
|
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
|
msgid "Compiler Options"
|
|
msgstr "Vertaler Opsies"
|
|
|
|
#: lazarusidestrconsts.dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigfiles
|
|
msgid "Config Files:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconormal
|
|
msgid "Normal Code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoopts
|
|
msgid "Options: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoother
|
|
msgctxt "lazarusidestrconsts.dlgcoother"
|
|
msgid "Other"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
|
msgid "Copy word on copy none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcorange
|
|
msgid "Range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoshowerr
|
|
msgid "Show Errors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoshowoptions
|
|
msgid "Show Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosmaller
|
|
msgid "Smaller Code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosmartlinkable
|
|
msgid "Smart Linkable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosources
|
|
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcostack
|
|
msgid "Stack"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcostrip
|
|
msgid "Strip Symbols From Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcounitstyle
|
|
msgid "Unit Style:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoverbosity
|
|
msgid "Verbosity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcppinline
|
|
msgid "C++ Styled INLINE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorgroupoptions
|
|
msgid "Cursor:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipsselection
|
|
msgid "Cursor skips selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdefvaluecolor
|
|
msgid "Default Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdelphi2ext
|
|
msgid "Delphi 2 Extensions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdeplhicomp
|
|
msgid "Delphi Compatible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktop
|
|
msgid "Desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopbuttonglyphs
|
|
msgid "Glyphs for Buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopfiles
|
|
msgid "Desktop files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktophints
|
|
msgid "Hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopmisc
|
|
msgid "Misc Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdirection
|
|
msgid "Direction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdirectorydoesnotexist
|
|
msgid "Directory does not exist"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdisableantialiasing
|
|
msgid "Disable anti-aliasing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividerdrawdepth
|
|
msgid "Draw divider level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolor
|
|
msgid "Nested line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolordefault
|
|
msgctxt "lazarusidestrconsts.dlgdividernestcolordefault"
|
|
msgid "Use Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivideronoff
|
|
msgid "Draw divider"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolor
|
|
msgid "Line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolordefault
|
|
msgctxt "lazarusidestrconsts.dlgdividertopcolordefault"
|
|
msgid "Use Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasbeginendname
|
|
msgid "Begin/End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasprocedurename
|
|
msgid "Procedure/Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
|
msgid "Class/Struct"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
|
msgid "Class/Struct (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpastryname
|
|
msgid "Try/Except"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
|
msgid "Unit sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasusesname
|
|
msgid "Uses clause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
|
msgid "Var/Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
|
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
|
msgid "Var/Type (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdoesnotexist
|
|
msgid "\" does not exist."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdoubleclickline
|
|
msgid "Double click line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdownword
|
|
msgctxt "lazarusidestrconsts.dlgdownword"
|
|
msgid "Down"
|
|
msgstr "Af"
|
|
|
|
#: lazarusidestrconsts.dlgdragdroped
|
|
msgid "Drag Drop editing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdropfiles
|
|
msgid "Drop files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedadd
|
|
msgid "Add..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedback
|
|
msgid "Back"
|
|
msgstr "Terug"
|
|
|
|
#: lazarusidestrconsts.dlgedbold
|
|
msgid "Bold"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedcodeparams
|
|
msgid "Code parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedcodetempl
|
|
msgid "Code templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedcolor
|
|
#, fuzzy
|
|
#| msgid "Syntax highlight"
|
|
msgctxt "lazarusidestrconsts.dlgedcolor"
|
|
msgid "Colors"
|
|
msgstr "Kleur"
|
|
|
|
#: lazarusidestrconsts.dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeddelay
|
|
msgid "Delay"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeddelete
|
|
msgid "Delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeddisplay
|
|
msgid "Display"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgededit
|
|
msgid "Edit..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedfiles
|
|
msgid "Editor files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedhintcommand
|
|
msgid "Hint: click on the command you want to edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedidcomlet
|
|
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
|
msgid "Identifier completion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedinvert
|
|
msgid "Invert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedital
|
|
msgid "Italic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditorfont
|
|
msgid "Editor font"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditorfontheight
|
|
msgid "Editor font height"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedmisc
|
|
msgid "Misc"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgednoerr
|
|
msgid "No errors in key mapping found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedoff
|
|
msgid "Off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedon
|
|
msgid "On"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedunder
|
|
msgid "Underline"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedusedefcolor
|
|
msgid "Use default color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgelementattributes
|
|
msgid "Element Attributes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
|
msgid "End key jumps to nearest end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgentirescope
|
|
msgid "&Entire Scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Vra"
|
|
|
|
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvcolors
|
|
msgctxt "lazarusidestrconsts.dlgenvcolors"
|
|
msgid "Colors"
|
|
msgstr "Kleure"
|
|
|
|
#: lazarusidestrconsts.dlgenvfiles
|
|
msgid "Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguage
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
|
msgid "Language"
|
|
msgstr "Taal"
|
|
|
|
#: lazarusidestrconsts.dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvmisc
|
|
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvnone
|
|
msgctxt "lazarusidestrconsts.dlgenvnone"
|
|
msgid "None"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvotherfiles
|
|
msgid "Other files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvproject
|
|
msgid "Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvtype
|
|
msgctxt "lazarusidestrconsts.dlgenvtype"
|
|
msgid "Type"
|
|
msgstr "Tipe"
|
|
|
|
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
|
|
msgid "Focus messages after compilation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgextracharspacing
|
|
msgid "Extra char spacing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgextralinespacing
|
|
msgid "Extra line spacing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgextsymb
|
|
msgid "Use external gdb debug symbols file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
|
msgid "Var/Type (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasasm
|
|
msgid "Asm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasbeginend
|
|
msgid "Begin/End (nested)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpascase
|
|
msgid "Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclass
|
|
msgid "Class/Object"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclasssection
|
|
msgid "public/private"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasexcept
|
|
msgid "Except/Finally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifdef
|
|
msgid "{$IfDef}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
|
msgid "Nested Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
|
msgid "Begin/End (procedure)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocedure
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
|
msgid "Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprogram
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
|
msgid "Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecord
|
|
msgid "Record"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrepeat
|
|
msgid "Repeat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpastry
|
|
msgid "Try"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunit
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
|
msgid "Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunitsection
|
|
msgid "Unit section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuserregion
|
|
msgid "{%Region}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuses
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasvartype
|
|
msgid "Var/Type (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforecolor
|
|
msgid "Foreground"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfpcpath
|
|
msgid "Compiler path (e.g. %s)"
|
|
msgstr "Vertaler pad (%s)"
|
|
|
|
#: lazarusidestrconsts.dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgframecolor
|
|
msgid "Frame color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfromcursor
|
|
msgid "&From Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfropts
|
|
msgctxt "lazarusidestrconsts.dlgfropts"
|
|
msgid "Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggeneratedwarf
|
|
msgid "Generate dwarf debug information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggetposition
|
|
msgid "Get position"
|
|
msgstr "Kry posisie"
|
|
|
|
#: lazarusidestrconsts.dlgglobal
|
|
msgid "&Global"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgglyphshowalways
|
|
msgid "Show Always"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgglyphshownever
|
|
msgid "Show Never"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgglyphshowsystem
|
|
msgid "Use System Defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggpccomp
|
|
msgid "GPC (GNU Pascal Compiler) Compatible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridx
|
|
msgid "Grid size X"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupcodeexplorer
|
|
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupcodetools
|
|
msgid "Codetools"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupdebugger
|
|
msgid "Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupeditor
|
|
msgid "Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupenvironment
|
|
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
|
msgid "Environment"
|
|
msgstr "Omgewing"
|
|
|
|
#: lazarusidestrconsts.dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutter
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguttercolor
|
|
msgid "Gutter Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutteredgecolor
|
|
msgid "Gutter Edge Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutterseparatorindex
|
|
msgid "Gutter separator index"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutterwidth
|
|
msgid "Gutter width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgheapsize
|
|
msgid "Heap Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Hoogte:"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrun
|
|
msgid "Hide IDE windows on run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghidemessagesicons
|
|
msgid "Hide Messages Icons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightcolor
|
|
msgid "Highlight Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightfontcolor
|
|
msgid "Highlight Font Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightleftofcursor
|
|
msgid "Left Of Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightrightofcursor
|
|
msgid "Right Of Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghintsparametersendernotused
|
|
msgid "Show Hints for parameter \"Sender\" not used"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghintsunused
|
|
msgid "Show Hints for unused units in main source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghostapplication
|
|
msgid "Host application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgidentifiercompletion
|
|
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
|
msgid "Identifier completion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgignoreverb
|
|
msgid "Ignore"
|
|
msgstr "Verwerp"
|
|
|
|
#: lazarusidestrconsts.dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentcodeto
|
|
msgid "Indent code to"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
|
msgid "Indent and Tabs:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeepcursorx
|
|
msgid "Keep cursor X position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingscheme
|
|
msgid "Key Mapping Scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglang
|
|
msgctxt "lazarusidestrconsts.dlglang"
|
|
msgid "Language"
|
|
msgstr "Taal"
|
|
|
|
#: lazarusidestrconsts.dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgleftpos
|
|
msgid "Left:"
|
|
msgstr "Links:"
|
|
|
|
#: lazarusidestrconsts.dlglefttopclr
|
|
msgid "color for left, top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevel1opt
|
|
msgid "Level 1 (quick and debugger friendly)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevel2opt
|
|
msgid "Level 2 (Level 1 + quick optimizations)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevel3opt
|
|
msgid "Level 3 (Level 2 + slow optimizations)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevelnoneopt
|
|
msgid "Level 0 (no extra Optimizations)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglinklibraries
|
|
msgid "Link Style:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglinksmart
|
|
msgid "Link Smart"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglnumsbct
|
|
msgid "Display Line Numbers in Run-time Error Backtraces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgloaddfile
|
|
msgid "Load desktop settings from file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmainmenu
|
|
msgid "Main Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmainviewforms
|
|
msgid "View project forms"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmainviewframes
|
|
msgid "View project frames"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmainviewunits
|
|
msgid "View project units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmakepath
|
|
msgid "Make path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfull
|
|
msgid "Current Word match word boundaries"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
|
msgid "Only if shorter than"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
|
msgid "Ignore Keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
|
msgid "Disable Timer for Markup Current Word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordtrim
|
|
msgid "Trim Spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmethodinspolicy
|
|
msgid "Method insert policy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgminimizeallonminimizemain
|
|
msgid "Minimize all on minimize main"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldbutton
|
|
msgid "Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldbuttonleft
|
|
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
|
|
msgid "Middle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldbuttonright
|
|
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
|
|
msgid "Right"
|
|
msgstr "Regs"
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldcolfoldall
|
|
msgid "Fold All (Some Colapsed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldcolfoldone
|
|
msgid "Fold One (Some Colapsed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldcolunfoldall
|
|
msgid "Unfold All (Some Colapsed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldcolunfoldone
|
|
msgid "Unfold One (Some Colapsed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldenabled
|
|
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
|
|
msgid "Enabled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldexpfoldall
|
|
msgid "Fold All (All Expanded)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldexpfoldone
|
|
msgid "Fold One (All Expanded)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldgroup1
|
|
msgid "Setting 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldgroup2
|
|
msgid "setting 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldmodifieralt
|
|
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldmodifierctrl
|
|
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmousefoldmodifiershift
|
|
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
|
|
msgid "Shift"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmousegroupoptions
|
|
msgid "Mouse:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouselinks
|
|
msgid "Mouse links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgs
|
|
msgctxt "lazarusidestrconsts.dlgmsgs"
|
|
msgid "Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnaming
|
|
msgid "Naming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
|
msgid "no automatic renaming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnobrackethighlight
|
|
msgid "No Highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlineafter
|
|
msgid "Do not split line after:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlinefront
|
|
msgid "Do not split line In front of:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgobjinsp
|
|
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
|
msgid "Object Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoiitemheight
|
|
msgid "Item height"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoimiscellaneous
|
|
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoioptions
|
|
msgctxt "lazarusidestrconsts.dlgoioptions"
|
|
msgid "Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoispeedsettings
|
|
msgid "Speed settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
|
msgid "Use default Delphi settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
|
msgid "Use default Lazarus settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptimiz
|
|
msgid "Optimizations:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgotherunitfiles
|
|
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasext
|
|
msgid "Default pascal extension"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpassoptslinker
|
|
msgid "Pass Options To The Linker (Delimiter is space)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursor
|
|
msgid "Persistent cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpldpackagegroup
|
|
msgid "Package group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoapplication
|
|
msgid "Application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoclearicon
|
|
msgid "Clear Icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpofroms
|
|
msgid "Forms"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoicon
|
|
msgid "Icon:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoicondesc
|
|
msgid "(size: %d:%d, bpp: %d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoicondescnone
|
|
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
|
msgid "(none)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoloadicon
|
|
msgid "Load Icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpomisc
|
|
msgctxt "lazarusidestrconsts.dlgpomisc"
|
|
msgid "Miscellaneous"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpooutputsettings
|
|
msgid "Output Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgposaveicon
|
|
msgid "Save Icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgposavesession
|
|
msgid "Session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpotargetfilename
|
|
msgid "Target file name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpotitle
|
|
msgid "Title:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpouseappbundle
|
|
msgid "Use Application Bundle for running and debugging (darwin only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpousemanifest
|
|
msgid "Use manifest file to enable themes (windows only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptions
|
|
msgid "Project Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojfiles
|
|
msgid "Project files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpromptonreplace
|
|
msgid "&Prompt On Replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpropnamecolor
|
|
msgid "Property Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgqopenlastprj
|
|
msgid "Open last project at start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgqshowborderspacing
|
|
msgid "Show border spacing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgqshowcompiledialog
|
|
msgid "Show compile dialog"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgregularexpressions
|
|
msgid "&Regular Expressions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "Vervang Alles"
|
|
|
|
#: lazarusidestrconsts.dlgreplacewith
|
|
msgid "&Replace With"
|
|
msgstr "&Vervang met"
|
|
|
|
#: lazarusidestrconsts.dlgreport
|
|
msgid "Report"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrightbottomclr
|
|
msgid "color for right, bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrightclickselects
|
|
msgid "Right Click selects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrightmousemovescursor
|
|
msgid "Right mouse moves cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandgroup
|
|
msgid "Rubber band"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandselectsgrandchilds
|
|
msgid "Select grand childs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
|
msgid "Creation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
|
msgid "Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunoenvironment
|
|
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
|
msgid "Environment"
|
|
msgstr "Omgewing"
|
|
|
|
#: lazarusidestrconsts.dlgrunolocal
|
|
msgid "Local"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunovalue
|
|
msgctxt "lazarusidestrconsts.dlgrunovalue"
|
|
msgid "Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunovariable
|
|
msgid "Variable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunparameters
|
|
msgid "Run parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavedfile
|
|
msgid "Save desktop settings to file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavedlinecolor
|
|
msgid "Saved line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscope
|
|
msgid "Scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollgroupoptions
|
|
msgid "Scrolling:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendline
|
|
msgid "Caret past end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
|
msgid "Search directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsearchcaption
|
|
msgid "Searching..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectedtext
|
|
msgid "&Selected Text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcaps
|
|
msgid "Show component captions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcompileroptions
|
|
msgid "Show compiler options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowdefinedmacros
|
|
msgid "Show defined macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowedrhints
|
|
msgid "Show editor hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowhint
|
|
msgid "Show Hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowlinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshownotes
|
|
msgid "Show Notes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshownothing
|
|
msgid "Show nothing (only errors)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowprocserror
|
|
msgid "Show all procs on error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowscrollhint
|
|
msgid "Show scroll hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowsummary
|
|
msgid "Show summary"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowwarnings
|
|
msgid "Show Warnings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgspacenotcosmos
|
|
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
|
msgid "Space"
|
|
msgstr "Spasie"
|
|
|
|
#: lazarusidestrconsts.dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsrcedit
|
|
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
|
msgid "Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstatickeyword
|
|
msgid "Static Keyword in Objects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsubpropcolor
|
|
msgid "SubProperties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Sintaks opsies"
|
|
|
|
#: lazarusidestrconsts.dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Kepe na spasies"
|
|
|
|
#: lazarusidestrconsts.dlgtabwidths
|
|
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
|
msgid "Tab widths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtargetcpufamily
|
|
msgid "Target CPU family"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtargetos
|
|
msgctxt "lazarusidestrconsts.dlgtargetos"
|
|
msgid "Target OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtargetplatform
|
|
msgid "Target Platform:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtexttofing
|
|
msgid "&Text to Find"
|
|
msgstr "&Teks of te vind"
|
|
|
|
#: lazarusidestrconsts.dlgthedirectory
|
|
msgid "The directory \""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtimesecondunit
|
|
msgid "sec"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtooltipeval
|
|
msgid "Tooltip expression evaluation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtooltiptools
|
|
msgid "Tooltip symbol Tools"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtoppos
|
|
msgid "Top:"
|
|
msgstr "Bo-kant:"
|
|
|
|
#: lazarusidestrconsts.dlgtplfname
|
|
msgid "Template file name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
|
msgid "Trim Spaces Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
|
msgid "Caret or Edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
|
msgid "Line Edited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
|
msgid "Leave line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
|
msgid "Position Only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguncertopt
|
|
msgid "Uncertain Optimizations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Ontdoen na stoor"
|
|
|
|
#: lazarusidestrconsts.dlgundogroupoptions
|
|
msgid "Undo / Redo:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Ontdoen limiet"
|
|
|
|
#: lazarusidestrconsts.dlgunitdepbrowse
|
|
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
|
|
msgid "Open"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgunitdepcaption
|
|
msgid "Unit dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgunitdeprefresh
|
|
msgid "Refresh"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgunsavedlinecolor
|
|
msgid "Unsaved line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgupword
|
|
msgctxt "lazarusidestrconsts.dlgupword"
|
|
msgid "Up"
|
|
msgstr "Op"
|
|
|
|
#: lazarusidestrconsts.dlgusecodefolding
|
|
msgid "Code folding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusecustomconfig
|
|
msgid "Use additional Compiler Config File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusedividerdraw
|
|
msgid "Divider drawing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusefpccfg
|
|
msgid "Use standard Compiler Config File (fpc.cfg)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusemsgfile
|
|
msgid "Use messages file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgvaluecolor
|
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
|
msgid "Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwholewordsonly
|
|
msgid "&Whole Words Only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Weite:"
|
|
|
|
#: lazarusidestrconsts.dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwindow
|
|
msgctxt "lazarusidestrconsts.dlgwindow"
|
|
msgid "Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwinpos
|
|
msgid "Window Positions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwordspolicies
|
|
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
|
msgid "Words"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwrdpreview
|
|
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
|
msgid "Preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwritefpclogo
|
|
msgid "Write an FPC logo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmalignword
|
|
msgid "Align"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmdeleteselection
|
|
msgid "Delete Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmmirrorhorizontal
|
|
msgid "Mirror horizontal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmmirrorvertical
|
|
msgid "Mirror vertical"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmorder
|
|
msgid "Order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmorderbackone
|
|
msgid "Back one"
|
|
msgstr "Terug een"
|
|
|
|
#: lazarusidestrconsts.fdmorderforwardone
|
|
msgid "Forward one"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmordermovetoback
|
|
msgid "Move to back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmordermovetofront
|
|
msgid "Move to front"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsaveformasxml
|
|
msgid "Save form as xml"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Skaal"
|
|
|
|
#: lazarusidestrconsts.fdmselectall
|
|
msgctxt "lazarusidestrconsts.fdmselectall"
|
|
msgid "Select All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmshowoptions
|
|
msgctxt "lazarusidestrconsts.fdmshowoptions"
|
|
msgid "Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsizeword
|
|
msgid "Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmtaborder
|
|
msgid "Tab order..."
|
|
msgstr "Keep orde..."
|
|
|
|
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
|
msgid "On Both Sides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2paddfile
|
|
msgid "Add File"
|
|
msgstr "Voeg 'n Lêer"
|
|
|
|
#: lazarusidestrconsts.lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Voeg Lêers"
|
|
|
|
#: lazarusidestrconsts.lisa2paddfilestopackage
|
|
msgid "Add files to package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
|
|
msgid "Add LFM, LRS files, if they exist"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2paddtopackage
|
|
msgid "Add to package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2paddunit
|
|
msgid "Add Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pancestortype
|
|
msgid "Ancestor Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
|
msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pchooseanexistingfile
|
|
msgid "<choose an existing file>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewfile
|
|
msgid "Create new file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pexistingfile
|
|
msgid "%sExisting file: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
|
|
msgid "File %s%s%s already exists in the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
|
|
msgid "File already in package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename
|
|
msgid "File name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename2
|
|
msgid "Filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidcircle
|
|
msgid "Invalid Circle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
|
msgid "%s%s%s is not a valid unit name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pnewcomponent
|
|
msgid "New Component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ppalettepage
|
|
msgid "Palette Page:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
|
msgid "Pascal units must have the extension .pp or .pas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2psavefiledialog
|
|
msgid "Save file dialog"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pshowall
|
|
msgid "Show all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pswitchpaths
|
|
msgid "Switch Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
|
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
|
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
|
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
|
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
|
msgid "The class name %s%s%s is not a valid pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
|
|
msgid "The file %s%s%s is already in the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
|
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
|
msgid "The package has already a dependency for the package %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
|
|
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
|
msgid "The page name %s%s%s is too long (max 100 chars)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
|
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
|
msgid "The unitname %s%s%s already exists in this package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
|
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
|
msgid "The unit name %s%s%s does not correspond to the filename."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2punitfilename
|
|
msgid "Unit file name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2punitfilename2
|
|
msgid "Unit File Name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2punitname
|
|
msgid "Unit Name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2punitnameinvalid
|
|
msgid "Unit Name Invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
|
|
msgid "Scan Unit for Unit Name and Register procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabcreationfailed
|
|
msgid "Error occured during Application Bundle creation: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabortall
|
|
msgid "Abort all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabortwholeloading
|
|
msgid "Abort whole loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutdocumentation
|
|
msgid "Documentation:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "Aangaande Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarusmsg
|
|
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutofficial
|
|
msgid "Official:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaction
|
|
msgid "Action:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivefilter
|
|
msgid "Active Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadddirectory
|
|
msgid "Add directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfilesofdirectory
|
|
msgid "Add files of directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
|
|
msgid "Additional compiler options inherited from packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditionalinformation
|
|
msgid "Additional Information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewset
|
|
msgid "Add new set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoproject
|
|
msgid "Add %s to project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddvalue
|
|
msgid "Add value:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
|
msgid "Add file to a package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
|
msgid "Destination Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2pfiletype
|
|
msgid "File Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2phasregisterprocedure
|
|
msgid "Has Register procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
|
msgid "Invalid package ID: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2pisvirtualunit
|
|
msgid "Virtual unit (source is not in package)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
|
msgid "Package %s%s%s not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2pshowall
|
|
msgid "Show All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
|
|
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
|
|
msgid "The file %s%s%s%sis already in the package %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
|
msgid "The package %s is read only."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2punitname
|
|
msgid "Unit Name: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
|
msgid "A file %s%s%s already exists.%sReplace it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalignment
|
|
msgid "Alignment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallblockslooksok
|
|
msgid "All blocks looks ok."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallfiles
|
|
msgid "All Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallowfunctio
|
|
msgid "Allow Function Calls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
|
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalways
|
|
msgid "Always"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilesfound
|
|
msgid "Ambiguous files found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisambiguousunitfound
|
|
msgid "Ambiguous Unit found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisambiguousunitfound2
|
|
msgid "Ambiguous unit found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorenabledhint
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
|
|
msgid "Anchor to bottom side of sibling, keep border space"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
|
|
msgid "Anchor to left side of sibling, keep border space"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
|
|
msgid "Anchor to right side of sibling, keep border space"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
|
|
msgid "Anchor to top side of sibling, keep border space"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
|
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
|
|
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplicationclassname
|
|
msgid "&Application class name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
|
msgid "apply build flags (-B) to dependencies too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
|
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocontinue
|
|
msgid "Auto Continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticfeatures
|
|
msgid "Automatic features"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoshowobjectinspector
|
|
msgid "Auto show"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisavailablepackages
|
|
msgid "Available packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbegins
|
|
msgid "begins"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbehindrelated
|
|
msgid "Behind related"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
|
msgid "Always Build before Run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
|
msgid "When this file is active in source editor ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
|
msgid "Working directory (Leave empty for file path)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
|
|
msgid "Working Directory (Leave empty for file path)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
|
msgid "Bold non default values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisborderspace
|
|
msgid "BorderSpace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottom
|
|
msgid "Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbreak
|
|
msgctxt "lazarusidestrconsts.lisbreak"
|
|
msgid "Break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbrowseforcompiler
|
|
msgid "Browse for Compiler (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnbreak
|
|
msgctxt "lazarusidestrconsts.lisbtnbreak"
|
|
msgid "Break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtncontinue
|
|
msgctxt "lazarusidestrconsts.lisbtncontinue"
|
|
msgid "Continue"
|
|
msgstr "Gaan aan"
|
|
|
|
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
|
msgid "build all files of project/package/IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildidewithpackages
|
|
msgid "build IDE with packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Bou nuwe projek"
|
|
|
|
#: lazarusidestrconsts.lisbuildnumber
|
|
msgid "Build Number"
|
|
msgstr "Bou Nommer"
|
|
|
|
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
|
msgid "Calling %s to create Makefile from %s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
|
msgid "Can not copy top level component."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotcreatefile
|
|
msgid "Can not create file %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
|
msgid "Cannot find lazarus starter:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccdchangeclassof
|
|
msgid "Change Class of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccdnoclass
|
|
msgid "no class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccochecktestdir
|
|
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocompilernotanexe
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocontains
|
|
msgid "contains "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccodatesdiffer
|
|
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
|
|
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoerrorcaption
|
|
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
|
msgid "Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomsgppunotfound
|
|
msgid "compiled FPC unit not found: %s.ppu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppuexiststwice
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
|
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
|
|
msgid "relative unit path found in fpc cfg: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoseveralcompilers
|
|
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoskip
|
|
msgid "Skip"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccospaces
|
|
msgid "spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
|
msgid "Unable to create Test pascal file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounabletogetfiledate
|
|
msgid "Unable to get file date of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccowarningcaption
|
|
msgid "Warning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscecategories
|
|
msgid "Categories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscecomplexitygroup
|
|
msgid "Complexity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceconstants
|
|
msgid "Constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyblocks
|
|
msgid "Empty blocks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyclasssections
|
|
msgid "Empty class sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptygroup
|
|
msgid "Empty constructs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyprocedures
|
|
msgid "Empty procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscefilter
|
|
msgid "(Filter)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscein
|
|
msgid "%s in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceisarootcontrol
|
|
msgid "Is a root control"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongparamlistcount
|
|
msgid "Parameters count treating as \"many\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongprocedures
|
|
msgid "Long procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongproclinecount
|
|
msgid "Line count of procedure treated as \"long\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemanynestedprocedures
|
|
msgid "Many nested procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemanyparameters
|
|
msgid "Many parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenestedproccount
|
|
msgid "Nested procedures count treating as \"many\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
|
msgid "Center control horizontally relative to the given sibling"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
|
msgid "Center control vertically relative to the given sibling"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenters
|
|
msgid "Centers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceomode
|
|
msgid "Preferred Exhibition Mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceomodecategory
|
|
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
|
msgid "Category"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceomodesource
|
|
msgid "Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceoonidle
|
|
msgid "On idle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceothergroup
|
|
msgctxt "lazarusidestrconsts.lisceothergroup"
|
|
msgid "Other"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceoupdate
|
|
msgid "Update"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceproperties
|
|
msgctxt "lazarusidestrconsts.lisceproperties"
|
|
msgid "Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
|
msgid "Published properties without default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceshowcodeobserver
|
|
msgid "Show observerations about"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscestylegroup
|
|
msgctxt "lazarusidestrconsts.liscestylegroup"
|
|
msgid "Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscetodos
|
|
msgid "ToDos"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscetypes
|
|
msgid "Types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunnamedconstants
|
|
msgid "Unnamed constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunsortedmembers
|
|
msgid "Unsorted members"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunsortedvisibility
|
|
msgid "Unsorted visibility"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceuses
|
|
msgctxt "lazarusidestrconsts.lisceuses"
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscevariables
|
|
msgid "Variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscewrongindentation
|
|
msgid "Wrong indentation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeclass
|
|
msgid "Change Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangefile
|
|
msgid "Change file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeparent
|
|
msgid "Change parent ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischaracter
|
|
msgid "Character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischaractermap
|
|
msgid "Character Map"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckchangesondiskwithloading
|
|
msgid "Check changes on disk with loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckoptions
|
|
msgid "Check options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname
|
|
msgid "Choose a different name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosecompilerpath
|
|
msgid "Choose compiler filename (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedebuggerpath
|
|
msgid "Choose debugger filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Kies 'n vouer"
|
|
|
|
#: lazarusidestrconsts.lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosemakepath
|
|
msgid "Choose make path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclasscompletion
|
|
msgid "Class Completion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
|
|
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
|
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassofmethodnotfound
|
|
msgid "Class %s%s%s of method %s%s%s not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclose
|
|
msgid "&Close"
|
|
msgstr "Sluit"
|
|
|
|
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmparameter
|
|
msgid "Parameter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstcomponents
|
|
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
|
msgid "Components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstlist
|
|
msgid "List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscocallon
|
|
msgid "Call on:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscocallonbuild
|
|
msgctxt "lazarusidestrconsts.liscocallonbuild"
|
|
msgid "Build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscocalloncompile
|
|
msgctxt "lazarusidestrconsts.liscocalloncompile"
|
|
msgid "Compile"
|
|
msgstr "Vertaleer"
|
|
|
|
#: lazarusidestrconsts.liscocallonrun
|
|
msgctxt "lazarusidestrconsts.liscocallonrun"
|
|
msgid "Run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
|
msgid "%s%sClick OK if you are sure to do that."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscocommand
|
|
msgctxt "lazarusidestrconsts.liscocommand"
|
|
msgid "Command:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodebrowser
|
|
msgid "Code browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodefault
|
|
msgid "default (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodegenerationoptions
|
|
msgid "Code generation options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddlinkbutton
|
|
msgid "Add link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
|
msgid "Browse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
|
|
msgid "Delete link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpdescrtag
|
|
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
|
msgid "Description"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelperrorstag
|
|
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
|
msgid "Errors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpinherited
|
|
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
|
msgid "Inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpmainformcaption
|
|
msgid "FPDoc editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpnodocumentation
|
|
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
|
|
msgid "(none)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
|
msgid "(no inherited description found)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<GEEN>"
|
|
|
|
#: lazarusidestrconsts.liscodehelppathsgroupbox
|
|
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
|
|
msgid "FPDoc files path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpreplacebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
|
|
msgid "Replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpsavebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
|
|
msgid "Save"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpshowemptymethods
|
|
msgid "Show empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpshowunusedunits
|
|
msgid "Show unused units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
|
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
|
msgid "Ignore constants in next functions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobscharconst
|
|
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
|
msgid "Search for unnamed char constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobserver
|
|
msgid "Code Observer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
|
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
|
msgid "Ignore next unnamed constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetempladd
|
|
msgid "Add"
|
|
msgstr "Voeg by"
|
|
|
|
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
|
msgid " A token %s%s%s already exists! "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplautocompleteon
|
|
msgid "Auto complete on ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplchange
|
|
msgid "Change"
|
|
msgstr "Verander"
|
|
|
|
#: lazarusidestrconsts.liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplerror
|
|
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
|
msgid "Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetools
|
|
msgid "CodeTools"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsaction
|
|
msgid "Action: %s"
|
|
msgstr "Aksie: %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
|
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
|
msgid "%s, auto generated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
|
msgid "Auto generated nodes can not be edited."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
|
|
msgid "CodeTools Defines Preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
|
msgid "compiler path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
|
|
msgid "Create Defines for Lazarus Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
|
msgid "Create Defines for %s Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
|
msgid "%s directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsedit
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
|
|
msgid "Edit"
|
|
msgstr "Redigeer"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefserrorreading
|
|
msgid "Error reading %s%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
|
|
msgid "Error reading project info file %s%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
|
|
msgid "Error while writing %s%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
|
|
msgid "Error while writing project info file %s%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsexit
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
|
|
msgid "Exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
|
msgid "Exit without Save"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
|
msgid "FPC SVN source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
|
msgid "IfDef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
|
msgid "Insert Free Pascal SVN Source Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
|
|
msgid "Insert Lazarus Directory Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
|
|
msgid "Lazarus Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsname
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
|
msgid "Name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
|
|
msgid "Node and its children are only valid for this project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
|
msgid "Parent node can not contain child nodes."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
|
msgid "%s project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
|
|
msgid "%s, project specific"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
|
msgid "Read error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
|
msgid "Save and Exit"
|
|
msgstr "Stoor en verlaat"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
|
msgid "The Free Pascal SVN source directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
|
|
msgid "The Lazarus main directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "Ongespesifieseer"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
|
msgid "Write error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
|
msgid "Bracket"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
|
msgid "Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
|
msgid "Keyword"
|
|
msgstr "Sleutelwoord"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnone
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
|
msgid "None"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsok
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
|
|
msgid "Ok"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsspace
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
|
msgid "Space"
|
|
msgstr "Spasie"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Simbool"
|
|
|
|
#: lazarusidestrconsts.liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandafter
|
|
msgid "Command after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandafterinvalid
|
|
msgid "Command after invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
|
msgid "Command after publishing module"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomments
|
|
msgid "Comments:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompany
|
|
msgid "Company:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompileidewithoutlinking
|
|
msgid "Compile IDE (without linking)"
|
|
msgstr "Vertaleer IDE (sonder inskakeling)"
|
|
|
|
#: lazarusidestrconsts.liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Vertaler"
|
|
|
|
#: lazarusidestrconsts.liscompilererror
|
|
msgid "Compiler error"
|
|
msgstr "Vertaler fout"
|
|
|
|
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Vertaler lêer"
|
|
|
|
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
|
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompileroptionsforproject
|
|
msgid "Compiler Options for Project: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompiling
|
|
msgid "%s (compiling ...)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponent
|
|
msgid "Component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponentnameiskeyword
|
|
msgid "Component name %s%s%s is keyword"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
|
msgid "Component name %s%s%s is not a valid identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomppalfindcomponent
|
|
msgid "Find component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomptest
|
|
msgctxt "lazarusidestrconsts.liscomptest"
|
|
msgid "Test"
|
|
msgstr "Toets"
|
|
|
|
#: lazarusidestrconsts.liscondition
|
|
msgid "Condition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuild
|
|
msgid "Configure Build %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
|
msgid "Configure %sBuild Lazarus%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmdelete
|
|
msgid "Confirm delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
|
msgid "Do you want to rebuild Lazarus?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconstructorcode
|
|
msgid "Constructor code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontains
|
|
msgid "contains"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinue
|
|
msgctxt "lazarusidestrconsts.liscontinue"
|
|
msgid "Continue"
|
|
msgstr "Gaan aan"
|
|
|
|
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Bydraers"
|
|
|
|
#: lazarusidestrconsts.liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvert
|
|
msgid "Convert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertencoding
|
|
msgid "Convert encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
|
msgid "Convert encoding of projects/packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertprojectorpackage
|
|
msgid "Convert project or package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyall
|
|
msgid "Copy All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard
|
|
msgid "Copy all and hidden messages to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyallmessagestoclipboard
|
|
msgid "Copy all messages to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyerror
|
|
msgid "Copy Error"
|
|
msgstr "Kopieer vout"
|
|
|
|
#: lazarusidestrconsts.liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Kopieer vout"
|
|
|
|
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
|
msgid "Copy selected messages to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoshowallmessages
|
|
msgid "Show all messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoskipcallingcompiler
|
|
msgid "Skip calling Compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscotargetosspecificoptions
|
|
msgid "Target OS specific options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscovarious
|
|
msgid "%s (various)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscpopenpackage
|
|
msgid "Open Package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscpopenunit
|
|
msgid "Open Unit %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefunction
|
|
msgid "Create function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatehelpnode
|
|
msgid "Create Help node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateit
|
|
msgid "Create it"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewproject
|
|
msgid "Create new project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Nutsgoed"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariable
|
|
msgid "Variable: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctinsertmacro
|
|
msgid "Insert Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscurrent
|
|
msgid "Current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomoptions
|
|
msgid "custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
|
|
msgid "Custom Program%sA freepascal program."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdate
|
|
msgid "Date"
|
|
msgstr "Datum"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggererror
|
|
msgid "Debugger error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugging
|
|
msgid "%s (debugging ...)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
|
msgid "Add Exception"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
|
msgid "Duplicate Exception name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
|
msgid "Enter the name of the exception"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
|
msgid "Event Log"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmid
|
|
msgid "ID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrminterface
|
|
msgid "Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
|
msgid "Limit linecount to"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
|
msgid "Module"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmname
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
|
|
msgid "Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
|
msgid "Notify on Lazarus Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
|
msgid "Resume"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
|
msgid "Resume Handled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
|
msgid "Resume Unhandled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmwindow
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
|
|
msgid "Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
|
msgid "Unable to load file %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdecimal
|
|
msgid "Decimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultvalue
|
|
msgid "Default value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
|
msgid "Delete all breakpoints?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
|
msgid "Delete all breakpoints in file %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallinsamesource
|
|
msgid "Delete All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
|
msgid "Delete all selected breakpoints?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointatline
|
|
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletebuildmode
|
|
msgid "Delete build mode %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletefilefailed
|
|
msgid "Delete file failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile
|
|
msgid "Delete old file %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile2
|
|
msgid "Delete old file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedfiles
|
|
msgid "Delete selected files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue
|
|
msgid "Delete value %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletingoffilefailed
|
|
msgid "Deleting of file %s%s%s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelphi
|
|
msgid "Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelphiproject
|
|
msgid "Delphi project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
|
|
msgid "There is already another component with the name %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
|
|
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdestructorcode
|
|
msgid "Destructor code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
|
msgid "Open Diff in editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgtext1
|
|
msgid "Text1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgtext2
|
|
msgid "Text2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdigits
|
|
msgid "Digits:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectives
|
|
msgid "Directives"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableallinsamesource
|
|
msgid "Disable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisabled
|
|
msgid "Disabled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablegroup
|
|
msgid "Disable Group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffchangedfiles
|
|
msgid "Changed files:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
|
msgid "Error reading file: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
|
|
msgid "Ignore disk changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffrevertall
|
|
msgid "Reload from disk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdocumentationeditor
|
|
msgid "Documentation Editor"
|
|
msgstr "Dokumentasie Redigeerder"
|
|
|
|
#: lazarusidestrconsts.lisdoesnotexists
|
|
msgid "%s does not exists: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheide
|
|
msgid "Do not close the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotcompiledependencies
|
|
msgid "do not compile dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
|
msgid "Draw grid lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
|
msgid "Duplicate found of value %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditcontexthelp
|
|
msgid "Edit context help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedoptschoosescheme
|
|
msgid "Choose Scheme"
|
|
msgstr "Kies Skema"
|
|
|
|
#: lazarusidestrconsts.lisedtdefallpackages
|
|
msgid "All packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
|
|
msgid "Current Project Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
|
|
msgid "Global Source Path addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefprojectincpath
|
|
msgid "Project IncPath"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefprojectsrcpath
|
|
msgid "Project SrcPath"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefprojectunitpath
|
|
msgid "Project UnitPath"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsallprojects
|
|
msgid "All projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
|
msgid "set FPC mode to DELPHI"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
|
msgid "set FPC mode to FPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
|
msgid "set FPC mode to GPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
|
msgid "set FPC mode to MacPas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
|
msgid "set FPC mode to TP"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
|
msgid "set IOCHECKS on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
|
msgid "set OVERFLOWCHECKS on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
|
msgid "set RANGECHECKS on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
|
msgid "use HeapTrc unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
|
msgid "use LineInfo unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolalt
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolctrl
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolinsert
|
|
msgid "Insert"
|
|
msgstr "Insit"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolkey
|
|
msgid "Key"
|
|
msgstr "Sleutel"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolmacros
|
|
msgid "Macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
msgid "Scan output for Free Pascal Compiler messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
|
msgid "Scan output for make messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolshift
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
|
|
msgid "Shift"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdall
|
|
msgid "All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdemtpymethods
|
|
msgid "Emtpy Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdpublic
|
|
msgid "Public"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdpublished
|
|
msgid "Published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableall
|
|
msgid "&Enable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableallinsamesource
|
|
msgid "Enable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenabled
|
|
msgctxt "lazarusidestrconsts.lisenabled"
|
|
msgid "Enabled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablegroup
|
|
msgid "Enable Group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenclose
|
|
msgid "Enclose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencloseselection
|
|
msgctxt "lazarusidestrconsts.lisencloseselection"
|
|
msgid "Enclose Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
|
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
|
|
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisentertransla
|
|
msgid "Enter translation language"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
|
msgid "Double click on messages jumps (otherwise: single click)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
|
msgid "Directory not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
|
|
msgid "FPC source directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
|
|
msgid "Invalid compiler filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
|
|
msgid "The compiler file \"%s\" is not an executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
|
|
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
|
|
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
|
|
msgid "Invalid make filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
|
|
msgid "The make file \"%s\" is not an executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
|
|
msgid "Lazarus directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
|
|
msgid "NOTE: only absolute paths are supported now"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseotabwidths
|
|
msgctxt "lazarusidestrconsts.liseotabwidths"
|
|
msgid "Tab widths"
|
|
msgstr "Keep weite"
|
|
|
|
#: lazarusidestrconsts.liserrinvalidoption
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrnooptionallowed
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserroptionneeded
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserror
|
|
msgid "Error: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorcreatinglrs
|
|
msgid "Error creating lrs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorin
|
|
msgid "Error in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinitializingprogramserrors
|
|
msgid "Error initializing program%s%s%s%s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfrom
|
|
msgid "Error loading %s from%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent2
|
|
msgid "Error moving component %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxmlfile
|
|
msgid "Error reading xml file %s%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrors
|
|
msgctxt "lazarusidestrconsts.liserrors"
|
|
msgid "Errors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorsavingto
|
|
msgid "Error saving %s to%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseteditcustomscanners
|
|
msgid "Edit custom scanners (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseverynthlinenumber
|
|
msgid "Every n-th line number:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamples
|
|
msgid "Examples"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexceptiondialog
|
|
msgid "Debugger Exception Notification"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludefilter
|
|
msgid "Exclude Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludefilter2
|
|
msgid "Exclude filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandafter
|
|
msgid "Executing command after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandbefore
|
|
msgid "Executing command before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutionpaused
|
|
msgid "Execution paused"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutionpausedadress
|
|
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutionstoppedon
|
|
msgid "Execution stopped%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexeprograms
|
|
msgid "Programs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexport
|
|
msgid "Export ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportlist
|
|
msgid "Export list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpression
|
|
msgid "Expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitpath
|
|
msgid "Extend unit path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextract
|
|
msgid "Extract"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextractprocedure
|
|
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
|
msgid "Extract Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolexternaltools
|
|
msgid "External tools"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolfailedtoruntool
|
|
msgid "Failed to run tool"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolmovedown
|
|
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
|
|
msgid "Down"
|
|
msgstr "Af"
|
|
|
|
#: lazarusidestrconsts.lisexttoolmoveup
|
|
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
|
|
msgid "Up"
|
|
msgstr "Op"
|
|
|
|
#: lazarusidestrconsts.lisexttoolremove
|
|
msgid "Remove"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttooltitlecompleted
|
|
msgid "\"%s\" completed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolunabletorunthetool
|
|
msgid "Unable to run the tool %s%s%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
|
msgid "Reduce designer painting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
|
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
|
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
|
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
|
|
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
|
|
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilter
|
|
msgid "File filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilehaschangedsave
|
|
msgid "File %s%s%s has changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisnotwritable
|
|
msgid "File is not writable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileissymlink
|
|
msgid "File is symlink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisvirtual
|
|
msgid "File %s%s%s is virtual."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilelinkerror
|
|
msgid "File link error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenameaddress
|
|
msgid "Filename/Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound2
|
|
msgid "File %s%s%s not found.%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
|
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenottext
|
|
msgid "File not text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesettings
|
|
msgid "File Settings ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
|
msgid "Files in ASCII or UTF-8 encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
|
msgid "Files not in ASCII nor UTF-8 encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
|
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilter
|
|
msgid "Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilter2
|
|
msgid "(filter)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiltersets
|
|
msgid "Filter Sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilecasesensitive
|
|
msgid "&Case sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfiledirectoryoptions
|
|
msgid "Directory options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilefilemaskbak
|
|
msgid "File mask (*;*.*;*.bak?)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
|
msgid "Include sub directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
|
msgid "Only text files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfileregularexpressions
|
|
msgid "&Regular expressions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
|
msgid "search all files in &project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
|
msgid "search all &open files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
|
msgid "search in &directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfiletexttofind
|
|
msgid "Text to find:"
|
|
msgstr "Teks om te vind:"
|
|
|
|
#: lazarusidestrconsts.lisfindfilewhere
|
|
msgid "Where"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilewholewordsonly
|
|
msgid "&Whole words only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfirst
|
|
msgid "First"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfloatingpoin
|
|
msgid "Floating Point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisformaterror
|
|
msgid "Format error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisformloaderror
|
|
msgid "Form load error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmakefailed
|
|
msgid "fpcmake failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcomponents
|
|
msgctxt "lazarusidestrconsts.lisfpcomponents"
|
|
msgid "Components"
|
|
msgstr "Komponente"
|
|
|
|
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
|
|
msgid "FPC Source Directory error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdoceditor
|
|
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpfindpalettecomponent
|
|
msgid "Find palette component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascal
|
|
msgid "Free Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalcompilernotfound
|
|
msgid "Free Pascal Compiler not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
|
|
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
|
msgid "Freepascal source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcefile
|
|
msgid "FreePascal source file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
|
|
msgid "Free Pascal Sources not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriidentifier
|
|
msgid "Identifier: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "in hoof projek"
|
|
|
|
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrirename
|
|
msgid "Rename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrirenameto
|
|
msgid "Rename to"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrisearchwhere
|
|
msgid "Search where"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfunction
|
|
msgid "Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroup
|
|
msgid "Group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishashelp
|
|
msgid "Has Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishelpentries
|
|
msgid "Help entries"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishexadecimal
|
|
msgid "Hexadecimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
|
msgid "Help for FreePascal Compiler message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintopen
|
|
msgctxt "lazarusidestrconsts.lishintopen"
|
|
msgid "Open"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintpause
|
|
msgctxt "lazarusidestrconsts.lishintpause"
|
|
msgid "Pause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintrun
|
|
msgctxt "lazarusidestrconsts.lishintrun"
|
|
msgid "Run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintsave
|
|
msgctxt "lazarusidestrconsts.lishintsave"
|
|
msgid "Save"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintsaveall
|
|
msgid "Save all"
|
|
msgstr "Stoor alles"
|
|
|
|
#: lazarusidestrconsts.lishintstepinto
|
|
msgid "Step Into"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintstepover
|
|
msgid "Step Over"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishinttoggleformunit
|
|
msgid "Toggle Form/Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintviewunits
|
|
msgid "View Units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Databasis"
|
|
|
|
#: lazarusidestrconsts.lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liside
|
|
msgid "IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideintf
|
|
msgid "IDE Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerroraccessingxml
|
|
msgid "Error accessing xml"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
|
|
msgid "Error accessing xml file %s%s%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerrorloadingxml
|
|
msgid "Error loading xml"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
|
|
msgid "Error loading xml file %s%s%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
|
|
msgid "Open or Load Compiler Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoopenrecent
|
|
msgid "Open recent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecorecentfiles
|
|
msgid "Recent files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Stoor na lêer"
|
|
|
|
#: lazarusidestrconsts.lisiecosavetorecent
|
|
msgid "Save to recent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifdok
|
|
msgctxt "lazarusidestrconsts.lisifdok"
|
|
msgid "OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreandcontinue
|
|
msgid "Ignore and continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignorebinaries
|
|
msgid "Ignore binaries"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreexceptiontype
|
|
msgid "Ignore this exception type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoremissingfile
|
|
msgid "Ignore missing file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreusetformasancestor
|
|
msgid "Ignore, use TForm as ancestor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportlist
|
|
msgid "Import list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludefilter
|
|
msgid "Include Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludepath
|
|
msgid "include path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindex
|
|
msgid "Index"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildabort
|
|
msgid "Aborted..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildbuild
|
|
msgctxt "lazarusidestrconsts.lisinfobuildbuild"
|
|
msgid "Build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildcaption
|
|
msgid "Compile Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildcomplile
|
|
msgid "Compiling..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuilderror
|
|
msgid "Error..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuilderrors
|
|
msgid "Errors:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildhint
|
|
msgid "Hints:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildlines
|
|
msgctxt "lazarusidestrconsts.lisinfobuildlines"
|
|
msgid "Lines:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildmakeabort
|
|
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
|
|
msgid "Abort"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildnote
|
|
msgid "Notes:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildsuccess
|
|
msgid "Success..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfobuildwarning
|
|
msgid "Warnings:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutunit
|
|
msgid "Information about %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfrontofrelated
|
|
msgid "In front of related"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinheriteditem
|
|
msgid "Inherited Item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectdata
|
|
msgid "Data"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectdialog
|
|
msgid "Debug Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectmethods
|
|
msgid "Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectproperties
|
|
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
|
msgid "Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallationfailed
|
|
msgid "Installation failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstalledpackages
|
|
msgid "Installed Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinternalname
|
|
msgid "Internal Name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidbuildmodethebuildmodemustbeapascalidentifie
|
|
msgid "Invalid build mode %s%s%s. The build mode must be a pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidcircle
|
|
msgid "Invalid circle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidcommand
|
|
msgid "Invalid command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidcompilerfilename
|
|
msgid "Invalid Compiler Filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvaliddestinationdirectory
|
|
msgid "Invalid destination directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpression
|
|
msgid "Invalid expression:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
|
|
msgid "Invalid Free Pascal source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidoff
|
|
msgid "Invalid (Off)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidon
|
|
msgid "Invalid (On)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
|
msgid "The name \"%s\" is not a valid pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
|
msgid "Invalid publishing Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
|
msgid "%s is already part of the Project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
|
|
msgid "%s is a %s.%sThis circle dependency is not allowed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjitform
|
|
msgid "JIT Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Hou naam"
|
|
|
|
#: lazarusidestrconsts.liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddactiveunittoproject
|
|
msgid "Add active unit to project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddwatch
|
|
msgid "Add watch"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
|
|
msgid "Build all files of project/program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Klasiek"
|
|
|
|
#: lazarusidestrconsts.liskmcloseall
|
|
msgid "Close All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsoptions
|
|
msgid "CodeTools options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcompileroptions
|
|
msgid "Compiler options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconfigbuildfile
|
|
msgid "Config %sBuild File%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
|
msgid "Configure custom components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconfigurehelp
|
|
msgid "Configure Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconfigureinstalledpackages
|
|
msgid "Configure installed packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
|
msgid "Convert Delphi project to Lazarus project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
|
msgid "Convert Delphi unit to Lazarus unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
|
msgid "Convert DFM file to LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
|
msgid "Copy selected Components to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
|
msgid "Cut selected Components to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmdiffeditorfiles
|
|
msgid "Diff editor files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmeditoroptions
|
|
msgid "Editor options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmencloseselection
|
|
msgid "Enclose selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmfindincremental
|
|
msgid "Find incremental"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker0
|
|
msgid "Go to marker 0"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker1
|
|
msgid "Go to marker 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker2
|
|
msgid "Go to marker 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker3
|
|
msgid "Go to marker 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker4
|
|
msgid "Go to marker 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker5
|
|
msgid "Go to marker 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker6
|
|
msgid "Go to marker 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker7
|
|
msgid "Go to marker 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker8
|
|
msgid "Go to marker 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker9
|
|
msgid "Go to marker 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor1
|
|
msgid "Go to source editor 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor10
|
|
msgid "Go to source editor 10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor2
|
|
msgid "Go to source editor 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor3
|
|
msgid "Go to source editor 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor4
|
|
msgid "Go to source editor 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor5
|
|
msgid "Go to source editor 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor6
|
|
msgid "Go to source editor 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor7
|
|
msgid "Go to source editor 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor8
|
|
msgid "Go to source editor 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor9
|
|
msgid "Go to source editor 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskminsertdateandtime
|
|
msgid "Insert date and time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskminsertifdef
|
|
msgid "Insert $IFDEF"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskminsertusername
|
|
msgid "Insert username"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskminspect
|
|
msgid "Inspect"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmlazarusdefault
|
|
msgid "Lazarus (default)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmmacosxapple
|
|
msgid "Mac OS X (Apple style)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmmacosxlaz
|
|
msgid "Mac OS X (Lazarus style)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnewpackage
|
|
msgid "New package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnewproject
|
|
msgid "New project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnewunit
|
|
msgctxt "lazarusidestrconsts.liskmnewunit"
|
|
msgid "New Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
|
msgid "Note: All keys will be set to the values of the chosen scheme."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpackagegraph
|
|
msgid "Package graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
|
msgid "Paste Components from clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmremoveactiveunitfromproject
|
|
msgid "Remove active unit from project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsaveall
|
|
msgid "SaveAll"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsaveas
|
|
msgid "SaveAs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectlineend
|
|
msgid "Select line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectlinestart
|
|
msgid "Select line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectpagebottom
|
|
msgid "Select page bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectpagetop
|
|
msgid "Select page top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectwordleft
|
|
msgid "Select word left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmselectwordright
|
|
msgid "Select word right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetfreebookmark
|
|
msgid "Set free Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker0
|
|
msgid "Set marker 0"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker1
|
|
msgid "Set marker 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker2
|
|
msgid "Set marker 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker3
|
|
msgid "Set marker 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker4
|
|
msgid "Set marker 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker5
|
|
msgid "Set marker 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker6
|
|
msgid "Set marker 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker7
|
|
msgid "Set marker 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker8
|
|
msgid "Set marker 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker9
|
|
msgid "Set marker 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmstopprogram
|
|
msgid "Stop program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker0
|
|
msgid "Toggle marker 0"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker1
|
|
msgid "Toggle marker 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker2
|
|
msgid "Toggle marker 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker3
|
|
msgid "Toggle marker 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker4
|
|
msgid "Toggle marker 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker5
|
|
msgid "Toggle marker 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker6
|
|
msgid "Toggle marker 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker7
|
|
msgid "Toggle marker 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker8
|
|
msgid "Toggle marker 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker9
|
|
msgid "Toggle marker 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
|
msgid "Toggle view Breakpoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
|
msgid "Toggle view Call Stack"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
|
msgid "Toggle view component palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
|
msgid "Toggle view Debugger Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
|
msgid "Toggle view Local Variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewwatches
|
|
msgid "Toggle view Watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectsource
|
|
msgid "View project source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdesktopsettings
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectorynotfound
|
|
msgid "Lazarus directory not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruseditorv
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusfile
|
|
msgid "Lazarus File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusform
|
|
msgid "Lazarus form"
|
|
msgstr "Lazarus forum"
|
|
|
|
#: lazarusidestrconsts.lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusinclude
|
|
msgid "Lazarus include file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruspackage
|
|
msgid "Lazarus package"
|
|
msgstr "Lazarus paket"
|
|
|
|
#: lazarusidestrconsts.lislazarusproject
|
|
msgid "Lazarus project"
|
|
msgstr "Lazarus projek"
|
|
|
|
#: lazarusidestrconsts.lislazarusprojectinfofile
|
|
msgid "Lazarus Project Info file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusprojectsource
|
|
msgid "Lazarus project source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusunit
|
|
msgid "Lazarus unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusversionstring
|
|
msgid "%s beta"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildaboaction
|
|
msgid "Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildabopart
|
|
msgid "Part"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
|
|
msgid "Advanced Build Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuild
|
|
msgctxt "lazarusidestrconsts.lislazbuildbuild"
|
|
msgid "Build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildcodetools
|
|
msgid "Build CodeTools"
|
|
msgstr "Bou CodeTools"
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
|
|
msgid "Build components (SynEdit, CodeTools)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildexamples
|
|
msgid "Build examples"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildide
|
|
msgid "Build IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildjitform
|
|
msgid "Build JITForm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildoptions
|
|
msgid "Build Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildsynedit
|
|
msgid "Build SynEdit"
|
|
msgstr "Bou SynEdit"
|
|
|
|
#: lazarusidestrconsts.lislazbuildcancel
|
|
msgctxt "lazarusidestrconsts.lislazbuildcancel"
|
|
msgid "Cancel"
|
|
msgstr "Kanselleer"
|
|
|
|
#: lazarusidestrconsts.lislazbuildcleanall
|
|
msgid "Clean all"
|
|
msgstr "Maak alles skoon"
|
|
|
|
#: lazarusidestrconsts.lislazbuildcleanbuild
|
|
msgid "Clean+Build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
|
msgid "Confirm before rebuilding Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
|
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildlclinterface
|
|
msgid "LCL interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnone
|
|
msgctxt "lazarusidestrconsts.lislazbuildnone"
|
|
msgid "None"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildok
|
|
msgctxt "lazarusidestrconsts.lislazbuildok"
|
|
msgid "Ok"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildqboapplcltarget
|
|
msgid "Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildqbobuildall
|
|
msgid "Build All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
|
|
msgid "Build IDE without Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
|
|
msgid "Build IDE with Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildqbobuildlcl
|
|
msgid "Build LCL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildqbobuildother
|
|
msgctxt "lazarusidestrconsts.lislazbuildqbobuildother"
|
|
msgid "Other"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
|
|
msgid "Clean Up + Build all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildquickbuildoptions
|
|
msgid "Quick Build Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
|
msgid "Restart after successful Build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildsavesettings
|
|
msgid "Save settings"
|
|
msgstr "Stoor voorkeure"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildwithstaticpackages
|
|
msgid "With packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislcl
|
|
msgid "LCL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislclunitpathmissing
|
|
msgid "LCL unit path missing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislclwidgettype
|
|
msgid "LCL Widget Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
|
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldnovalidlazdocpath
|
|
msgid "No valid LazDoc path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleaveemptyfo
|
|
msgid "Leave empty for default .po file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleft
|
|
msgctxt "lazarusidestrconsts.lisleft"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleftsides
|
|
msgid "Left sides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislegaltrademarks
|
|
msgid "Legal Trademarks:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislevels
|
|
msgid "Levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislfmfile
|
|
msgid "LFM file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislfmfilenotfound
|
|
msgid "LFM file not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
|
|
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislibrarypath
|
|
msgid "library path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislinelength
|
|
msgid "Line/Length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislink
|
|
msgid "Link:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislinktarget
|
|
msgid "Link target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisloadingfailed
|
|
msgid "Loading %s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocals
|
|
msgid "Locals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgname
|
|
msgctxt "lazarusidestrconsts.lislocalsdlgname"
|
|
msgid "Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgvalue
|
|
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
|
|
msgid "Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogo
|
|
msgid "Logo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacpascal
|
|
msgid "Mac Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
|
msgid "Main Unit has Application.CreateForm statements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
|
|
msgid "Main Unit has Application.Title statements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
|
msgid "Main Unit has Uses Section containing all Units of project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsource
|
|
msgid "Main Unit is Pascal Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
|
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
|
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
|
msgid "Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaxs
|
|
msgid "Max %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismemorydump
|
|
msgid "Memory Dump"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismendebuggeroptions
|
|
msgid "Debugger Options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddbpsource
|
|
msgid "Source breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddbreakpoint
|
|
msgid "Add breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddcurunittopkg
|
|
msgid "Add active unit to a package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
|
msgid "Add jump point to history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddtoproject
|
|
msgid "Add editor file to Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddwatch
|
|
msgid "Add watch ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenubeaklinesinselection
|
|
msgid "Break Lines in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenubuild
|
|
msgctxt "lazarusidestrconsts.lismenubuild"
|
|
msgid "Build"
|
|
msgstr "Bou"
|
|
|
|
#: lazarusidestrconsts.lismenubuildall
|
|
msgid "Build all"
|
|
msgstr "Bou alles"
|
|
|
|
#: lazarusidestrconsts.lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Bou Lêer"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarus
|
|
msgid "Build Lazarus"
|
|
msgstr "Bou Lazarus"
|
|
|
|
#: lazarusidestrconsts.lismenuchecklfm
|
|
msgid "Check LFM file in editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucleandirectory
|
|
msgid "Clean directory ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuclose
|
|
msgctxt "lazarusidestrconsts.lismenuclose"
|
|
msgid "Close"
|
|
msgstr "Sluit"
|
|
|
|
#: lazarusidestrconsts.lismenucloseall
|
|
#, fuzzy
|
|
#| msgid "Close all editor files"
|
|
msgid "Close a&ll editor files"
|
|
msgstr "Sluit alle lêers"
|
|
|
|
#: lazarusidestrconsts.lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
|
msgid "CodeTools defines editor ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsoptions
|
|
msgid "CodeTools Options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucollectpofil
|
|
msgid "Collect .po files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucommentselection
|
|
msgid "Comment selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucompileroptions
|
|
msgid "Compiler Options ..."
|
|
msgstr "Vertaler Opsies ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompletecode
|
|
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Voltooi Bron"
|
|
|
|
#: lazarusidestrconsts.lismenuconditionalselection
|
|
msgid "Insert $IFDEF..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
|
msgid "Configure custom components ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconfigexternaltools
|
|
msgid "Configure external tools ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurehelp
|
|
msgid "Configure Help ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
|
msgid "Convert Delphi package to Lazarus package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
|
msgid "Convert Delphi project to Lazarus project ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
|
msgid "Convert Delphi unit to Lazarus unit ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
|
msgid "Convert DFM file to LFM ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconvertencoding
|
|
msgid "Convert encoding of projects/packages ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucopy
|
|
msgctxt "lazarusidestrconsts.lismenucopy"
|
|
msgid "Copy"
|
|
msgstr "Kopieer"
|
|
|
|
#: lazarusidestrconsts.lismenucreatefpdocfiles
|
|
msgid "Create FPDoc files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucreatepofile
|
|
msgid "Create .po files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucut
|
|
msgctxt "lazarusidestrconsts.lismenucut"
|
|
msgid "Cut"
|
|
msgstr "Sny"
|
|
|
|
#: lazarusidestrconsts.lismenudebugwindows
|
|
msgid "Debug windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenudiff
|
|
msgctxt "lazarusidestrconsts.lismenudiff"
|
|
msgid "Diff"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Redigeer"
|
|
|
|
#: lazarusidestrconsts.lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditinstallpkgs
|
|
msgid "Configure installed packages ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcancel
|
|
msgctxt "lazarusidestrconsts.lismenueditorcancel"
|
|
msgid "Cancel"
|
|
msgstr "Kanselleer"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcreatesubmenu
|
|
msgid "Create Submenu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletefromtemplate
|
|
msgid "Delete From Template..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteitem
|
|
msgid "Delete Item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorhandleonclickevent
|
|
msgid "Handle OnClick Event"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
|
|
msgid "Insert From Template..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
|
|
msgid "Insert New Item (after)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
|
|
msgid "Insert New Item (before)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormovedown
|
|
msgid "Move Down (or right)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveup
|
|
msgid "Move Up (or left)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornewtemplatedescription
|
|
msgid "New Template Description..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoroptions
|
|
msgid "Editor options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsaveastemplate
|
|
msgid "Save As Template..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorselectmenu
|
|
msgid "Select Menu:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorselecttemplate
|
|
msgid "Select Template:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatepreview
|
|
msgid "Template Preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuencloseselection
|
|
msgid "Enclose selection ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuenvironent
|
|
msgid "E&nvironment"
|
|
msgstr "Omgewing"
|
|
|
|
#: lazarusidestrconsts.lismenuevaluate
|
|
msgid "Evaluate/Modify ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuextractproc
|
|
msgid "Extract procedure ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufile
|
|
msgid "&File"
|
|
msgstr "&Lêer"
|
|
|
|
#: lazarusidestrconsts.lismenufind
|
|
msgctxt "lazarusidestrconsts.lismenufind"
|
|
msgid "Find"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
|
msgid "Find other end of code block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
|
msgid "Find code block start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
|
msgid "Find Declaration at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufindinfiles
|
|
msgid "Find &in files ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufpdoceditor
|
|
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenugeneraloptions
|
|
msgid "Options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenugotoincludedirective
|
|
msgid "Goto include directive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenugotoline
|
|
msgid "Goto line ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
|
msgid "Guess misplaced IFDEF/ENDIF"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
|
msgid "Guess unclosed block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "&Hulp"
|
|
|
|
#: lazarusidestrconsts.lismenuideinternals
|
|
msgid "IDE internals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuindentselection
|
|
msgid "Indent selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
|
msgid "ChangeLog entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcharacter
|
|
msgid "Insert from Character Map"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
|
msgid "CVS keyword"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertdatetime
|
|
msgid "Current date and time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgeneral
|
|
msgid "General"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnotice
|
|
msgid "GPL notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
|
msgid "LGPL notice"
|
|
msgstr "LGPL nota"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinserttext
|
|
msgid "Insert text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertusername
|
|
msgid "Current username"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinspect
|
|
msgid "Inspect ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumpback
|
|
msgid "Jump back"
|
|
msgstr "Spring terug"
|
|
|
|
#: lazarusidestrconsts.lismenujumpforward
|
|
msgid "Jump forward"
|
|
msgstr "Spring voorentoe"
|
|
|
|
#: lazarusidestrconsts.lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Spring na"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonextbookmark
|
|
msgid "Jump to next bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptonexterror
|
|
msgid "Jump to next error"
|
|
msgstr "Spring na volgende vout"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
|
msgid "Jump to previous bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptopreverror
|
|
msgid "Jump to previous error"
|
|
msgstr "Spring na vorige vout"
|
|
|
|
#: lazarusidestrconsts.lismenulowercaseselection
|
|
msgid "Lowercase selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewform
|
|
msgid "New Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewother
|
|
msgid "New ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewpackage
|
|
msgid "New package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewprojectfromfile
|
|
msgid "New Project from file ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewunit
|
|
msgctxt "lazarusidestrconsts.lismenunewunit"
|
|
msgid "New Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopen
|
|
msgid "&Open ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
|
msgid "Open filename at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackage
|
|
msgid "Open loaded package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
|
msgid "Open package file (.lpk) ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
|
msgid "Open package of current unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecent
|
|
msgid "Open &Recent ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentpkg
|
|
msgid "Open recent package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentproject
|
|
msgid "Open Recent Project ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupackage
|
|
msgid "&Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupackagegraph
|
|
msgid "Package Graph ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupackagelinks
|
|
msgid "Package links ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupaste
|
|
msgctxt "lazarusidestrconsts.lismenupaste"
|
|
msgid "Paste"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupause
|
|
msgctxt "lazarusidestrconsts.lismenupause"
|
|
msgid "Pause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuproject
|
|
msgid "&Project"
|
|
msgstr "&Projek"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuprojectrun
|
|
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
|
msgid "Run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuquickcompile
|
|
msgid "Quick compile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
|
msgid "Quick syntax check"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
|
msgid "Quick syntax check OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuquit
|
|
#, fuzzy
|
|
#| msgid "Quit"
|
|
msgid "&Quit"
|
|
msgstr "Staak"
|
|
|
|
#: lazarusidestrconsts.lismenuredo
|
|
msgctxt "lazarusidestrconsts.lismenuredo"
|
|
msgid "Redo"
|
|
msgstr "Herdoen"
|
|
|
|
#: lazarusidestrconsts.lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenureplace
|
|
msgctxt "lazarusidestrconsts.lismenureplace"
|
|
msgid "Replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenureplace2
|
|
msgid "&Replace ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenureportingbug
|
|
msgid "Reporting a bug..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
|
msgid "Rescan FPC source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuresetdebugger
|
|
msgid "Reset debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurestart
|
|
msgid "Restart"
|
|
msgstr "Herlaai"
|
|
|
|
#: lazarusidestrconsts.lismenurevert
|
|
msgid "Revert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurun
|
|
msgid "&Run"
|
|
msgstr "&Hardloop"
|
|
|
|
#: lazarusidestrconsts.lismenurunfile
|
|
msgid "Run File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurunparameters
|
|
msgid "Run Parameters ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuruntocursor
|
|
msgid "Run to cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusave
|
|
#, fuzzy
|
|
#| msgid "Save"
|
|
msgctxt "lazarusidestrconsts.lismenusave"
|
|
msgid "&Save"
|
|
msgstr "Stoor"
|
|
|
|
#: lazarusidestrconsts.lismenusaveall
|
|
msgid "Save All"
|
|
msgstr "Stoor Alles"
|
|
|
|
#: lazarusidestrconsts.lismenusaveas
|
|
#, fuzzy
|
|
#| msgid "Save As ..."
|
|
msgid "Save &As ..."
|
|
msgstr "Stoor As ..."
|
|
|
|
#: lazarusidestrconsts.lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Stoor Projek"
|
|
|
|
#: lazarusidestrconsts.lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Stoor Projek as ..."
|
|
|
|
#: lazarusidestrconsts.lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Deursoek"
|
|
|
|
#: lazarusidestrconsts.lismenuselect
|
|
msgid "Select"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuselectall
|
|
msgid "Select all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuselectcodeblock
|
|
msgid "Select code block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuselectline
|
|
msgid "Select line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuselectparagraph
|
|
msgid "Select paragraph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuselecttobrace
|
|
msgid "Select to brace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuselectword
|
|
msgid "Select word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusetfreebookmark
|
|
msgid "Set a free bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusortselection
|
|
msgid "Sort selection ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepinto
|
|
msgid "Step into"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepover
|
|
msgid "Step over"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustop
|
|
msgid "Stop"
|
|
msgstr "Stop"
|
|
|
|
#: lazarusidestrconsts.lismenutabstospacesselection
|
|
msgid "Tabs to spaces in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplateabout
|
|
msgid "About"
|
|
msgstr "Aangaande"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateclose
|
|
msgctxt "lazarusidestrconsts.lismenutemplateclose"
|
|
msgid "Close"
|
|
msgstr "Sluit"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatecontents
|
|
msgid "Contents"
|
|
msgstr "Inhoud"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatecopy
|
|
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
|
|
msgid "Copy"
|
|
msgstr "Kopieer"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatecut
|
|
msgctxt "lazarusidestrconsts.lismenutemplatecut"
|
|
msgid "Cut"
|
|
msgstr "Sny"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
|
msgid "Standard Edit Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
|
msgid "Standard File Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
|
msgid "Standard Help Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplateedit
|
|
msgctxt "lazarusidestrconsts.lismenutemplateedit"
|
|
msgid "Edit"
|
|
msgstr "Redigeer"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateexit
|
|
msgctxt "lazarusidestrconsts.lismenutemplateexit"
|
|
msgid "Exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefile
|
|
msgid "File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefind
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
|
msgid "Find"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefindnext
|
|
msgid "Find Next"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplatehelp
|
|
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
|
|
msgid "Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplatenew
|
|
msgid "New"
|
|
msgstr "Nuwe"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateopen
|
|
msgctxt "lazarusidestrconsts.lismenutemplateopen"
|
|
msgid "Open"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplateopenrecent
|
|
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
|
msgid "Open Recent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplatepaste
|
|
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
|
|
msgid "Paste"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplateredo
|
|
msgctxt "lazarusidestrconsts.lismenutemplateredo"
|
|
msgid "Redo"
|
|
msgstr "Herdoen"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatesave
|
|
msgctxt "lazarusidestrconsts.lismenutemplatesave"
|
|
msgid "Save"
|
|
msgstr "Stoor"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatesaveas
|
|
msgid "Save As"
|
|
msgstr "Stoor Alles"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatetutorial
|
|
msgid "Tutorial"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutemplateundo
|
|
msgctxt "lazarusidestrconsts.lismenutemplateundo"
|
|
msgid "Undo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Nutsgoed"
|
|
|
|
#: lazarusidestrconsts.lismenuuncommentselection
|
|
msgid "Uncomment selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuundo
|
|
msgctxt "lazarusidestrconsts.lismenuundo"
|
|
msgid "Undo"
|
|
msgstr "Ontdoen"
|
|
|
|
#: lazarusidestrconsts.lismenuunindentselection
|
|
msgid "Unindent selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuuppercaseselection
|
|
msgid "Uppercase selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuview
|
|
msgid "&View"
|
|
msgstr "&Aansig"
|
|
|
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
|
msgid "Anchor Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewassembler
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewbreakpoints
|
|
msgid "BreakPoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewcallstack
|
|
msgid "Call Stack"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
|
msgid "Code Browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
|
msgid "Component Palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Komponente"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugoutput
|
|
msgid "Debug output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewforms
|
|
msgid "Forms..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewidespeedbuttons
|
|
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
|
|
msgid "IDE speed buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewjumphistory
|
|
msgid "Jump-History ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewlocalvariables
|
|
msgid "Local Variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewmessages
|
|
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
|
msgid "Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewobjectinspector
|
|
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
|
msgid "Object Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewregisters
|
|
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
|
msgid "Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewsource
|
|
msgid "&View Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewsourceeditor
|
|
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewtodolist
|
|
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
|
|
msgid "ToDo List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
|
msgid "Toggle form/unit view"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
|
msgid "Unit Dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
|
msgid "Unit Information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewunits
|
|
msgid "Units..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewwatches
|
|
msgid "Watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuwindow
|
|
msgid "&Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismessageseditor
|
|
msgid "Messages Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismodifiedlgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismore
|
|
msgid "More"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovepage
|
|
msgid "Move Page ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismvdocking
|
|
msgid "Docking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnever
|
|
msgid "Never"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnew
|
|
msgid "new"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewancestors
|
|
msgid "New Ancestors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewclass
|
|
msgid "New Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewconsoleapplication
|
|
msgid "New console application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
|
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
|
|
msgid "Create a new program."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
|
|
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
|
|
msgid "Create a new pascal unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
|
|
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
|
msgid "Create a new unit with a frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
|
|
msgid "Inherit from an existing component."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewencoding
|
|
msgid "New encoding:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewproject
|
|
msgid "%s - (new project)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
|
msgid "New units are added to uses sections:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisno
|
|
msgid "No"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnochange
|
|
msgid "No change"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoidewindowselected
|
|
msgid "No IDE window selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoname
|
|
msgid "noname"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnone
|
|
msgid "%snone"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnone2
|
|
msgid "none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnonodeselected
|
|
msgid "no node selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoprogramfilesfound
|
|
msgid "No program file %s%s%s found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
|
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotadelphiproject
|
|
msgid "Not a Delphi project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotadelphiunit
|
|
msgid "Not a Delphi unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplemented
|
|
msgid "Not implemented"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplementedyet
|
|
msgid "Not implemented yet:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplementedyet2
|
|
msgid "Not implemented yet."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotnow
|
|
msgid "Not now"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnpcreate
|
|
msgid "Create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnpselectaprojecttype
|
|
msgid "Select a project type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
|
msgid "Number of files to convert: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectpath
|
|
msgid "object path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoff
|
|
msgid "? (Off)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
|
|
msgid "Add to favourite properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
|
|
msgid "Choose a base class for the favourite property %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifclassnotfound
|
|
msgid "Class %s%s%s not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
|
|
msgid "Remove from favourite properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipdescription
|
|
msgid "Description: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipdescriptiondescription
|
|
msgid "%sDescription: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipfilename
|
|
msgid "Filename: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipmissing
|
|
msgid "missing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipmodified
|
|
msgid "modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipnopackageselected
|
|
msgid "No package selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipopenloadedpackage
|
|
msgid "Open loaded package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
|
|
msgid "Please select a package to open"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipstate
|
|
msgid "State"
|
|
msgstr "Staat"
|
|
|
|
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "%sThis package is installed, but the lpk file was not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
|
|
msgid "%sThis package was automatically created"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisok
|
|
msgid "&Ok"
|
|
msgstr "&Goed"
|
|
|
|
#: lazarusidestrconsts.lisokbtn
|
|
msgctxt "lazarusidestrconsts.lisokbtn"
|
|
msgid "OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisold
|
|
msgid "old"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoldancestors
|
|
msgid "Old Ancestors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoldclass
|
|
msgid "Old Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lison
|
|
msgid "? (On)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenfile
|
|
msgid "Open file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenfile2
|
|
msgid "Open File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenlfm
|
|
msgid "Open %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenpackage2
|
|
msgid "Open package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenproject2
|
|
msgid "Open project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopensymlink
|
|
msgid "Open symlink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopentarget
|
|
msgid "Open target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenthepackage
|
|
msgid "Open the package %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopentheproject
|
|
msgid "Open the project %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisor
|
|
msgid "or"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoriginalfilename
|
|
msgid "Original File Name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridelanguage
|
|
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
|
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
|
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
|
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
|
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverwritefile
|
|
msgid "Overwrite file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverwritefileondisk
|
|
msgid "Overwrite file on disk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackage
|
|
msgid "Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageinfo
|
|
msgid "Package Info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagestoinstallintheide
|
|
msgid "Packages to install in the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispascalsourcefile
|
|
msgid "Pascal source file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispascalunit
|
|
msgid "Pascal unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispasscount
|
|
msgid "Pass Count"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispath
|
|
msgid "Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditbrowse
|
|
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
|
msgid "Browse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathdown
|
|
msgid "Move path down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathup
|
|
msgid "Move path up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditselectdirectory
|
|
msgid "Select directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddanitem
|
|
msgid "Add an item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddtoproject
|
|
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
|
msgid "Add to project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcleardependencydefaultfilename
|
|
msgid "Clear dependency filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcompile
|
|
msgctxt "lazarusidestrconsts.lispckeditcompile"
|
|
msgid "Compile"
|
|
msgstr "Vertaleer"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Kompileer alles?"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Vertaleer paket"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
|
msgid "Compiler Options for Package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcompopts
|
|
msgctxt "lazarusidestrconsts.lispckeditcompopts"
|
|
msgid "Compiler Options"
|
|
msgstr "Vertaler Opsies"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatemakefile
|
|
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
|
msgid "Edit General Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
|
|
msgid "Edit Options to compile package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditgeneraloptions
|
|
msgid "General Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckedithelp
|
|
msgctxt "lazarusidestrconsts.lispckedithelp"
|
|
msgid "Help"
|
|
msgstr "Help"
|
|
|
|
#: lazarusidestrconsts.lispckeditinstall
|
|
msgid "Install"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditinstallpackageintheide
|
|
msgid "Install package in the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditmodified
|
|
msgid "Modified: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditmore
|
|
msgid "More ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditpackage
|
|
msgid "Package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
|
msgid "Package %s%s%s has changed.%sSave package?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
|
msgid "package %s not saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditpage
|
|
msgid "%s, Page: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditreadonly
|
|
msgid "Read Only: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
|
msgid "Recompile all required"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileclean
|
|
msgid "Recompile clean"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency2
|
|
msgid "Remove Dependency?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
|
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
|
msgid "Removed Files (these entries are not saved to the lpk file)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
|
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
|
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditsavechanges
|
|
msgid "Save Changes?"
|
|
msgstr "Stoor veranderinge?"
|
|
|
|
#: lazarusidestrconsts.lispckeditsavepackage
|
|
msgid "Save package"
|
|
msgstr "Stoor paket"
|
|
|
|
#: lazarusidestrconsts.lispckeditsetdependencydefaultfilename
|
|
msgid "Store dependency filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
|
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
|
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditviewpackgesource
|
|
msgid "View Package Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplautocreated
|
|
msgid "AutoCreated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplinstalled
|
|
msgid "Installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplisrequiredby
|
|
msgid "Selected package is required by:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplloadedpackages
|
|
msgid "Loaded Packages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplpackagenotfound
|
|
msgid "Package %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplstate
|
|
msgid "%sState: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
|
msgid "Uninstall on next start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsauthor
|
|
msgid "Author:"
|
|
msgstr "Skrywer:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
|
|
msgid "Automatically increment version on build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
|
msgid "Description/Abstract"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
|
msgid "Designtime and Runtime"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeonly
|
|
msgid "Designtime only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
|
|
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
|
|
msgid "FPDoc files path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptslicense
|
|
msgid "License:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsobject
|
|
msgid "Object"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptspackageoptions
|
|
msgid "Package Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptspackagetype
|
|
msgid "PackageType"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsruntimeonly
|
|
msgid "Runtime only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
|
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
|
msgid "Update/Rebuild"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispdabort
|
|
msgctxt "lazarusidestrconsts.lispdabort"
|
|
msgid "Abort"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispdprogress
|
|
msgid "Progress"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
|
|
msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispefilename
|
|
msgid "Filename:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispemovefiledown
|
|
msgid "Move file down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispemovefileup
|
|
msgid "Move file up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesortfiles
|
|
msgid "Sort files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
|
|
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
|
|
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
|
|
msgid "The unitname is not a valid pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
|
|
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
|
|
msgid "The unitname is used when the IDE extends uses clauses."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeviewtodolist
|
|
msgid "View ToDo list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
|
msgid "CompiledSrcPath addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
|
msgid "Output directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
|
msgid "Package Source Directory Mark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgdefsunitpath
|
|
msgid "Unit Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
|
|
msgid "Online Help not yet implemented"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
|
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
|
|
msgid "There are more functions in the popupmenu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypebinary
|
|
msgid "Binary"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeinclude
|
|
msgid "Include file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeissues
|
|
msgid "Issues xml file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelfm
|
|
msgid "LFM - Lazarus form text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelrs
|
|
msgid "LRS - Lazarus resource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypetext
|
|
msgid "Text"
|
|
msgstr "Teks"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeunit
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
|
|
msgid "Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
|
msgid "Virtual Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
|
msgid "%sAdding new Dependency for package %s: package %s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
|
msgid "%sAdding new Dependency for project %s: package %s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
|
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
|
|
msgid "A required packages was not found. See package graph."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
|
|
msgid "Circle in package dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeletefailed
|
|
msgid "Delete failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
|
msgid "Delete old package file %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
|
msgid "Error reading file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotfound
|
|
msgid "File %s%s%s not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
|
|
msgid "Ignore and save package now"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
|
msgid "invalid Compiler filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanglazarus
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangnewpackage
|
|
msgid "NewPackage"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackage
|
|
msgid "Package: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagechangedsave
|
|
msgid "Package %s%s%s changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagefilemissing
|
|
msgid "Package file missing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
|
|
msgid "Package file not saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
|
|
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
|
msgid "Package is no designtime package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
|
msgid "package main source file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
|
|
msgid "Please save the package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangproject
|
|
msgid "Project: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefileinpackage
|
|
msgid "Rename file in package?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
|
msgid "Replace existing file %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage
|
|
msgid "Save Package?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage2
|
|
msgid "Save package?"
|
|
msgstr "Stoor paket?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
|
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
|
msgid "static packages config file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
|
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
|
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
|
msgid "The file %s%s%s%sis already in the package %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
|
msgid "The file %s%s%s is not a lazarus package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
|
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
|
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
|
|
msgid "The file %s%s%s%sof package %s is missing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
|
|
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
|
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
|
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
|
|
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
|
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
|
|
msgid "There is a circle in the required packages. See package graph."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
|
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
|
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
|
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
|
msgid "This file was automatically created by Lazarus. Do not edit!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
|
msgid "This source is only used to compile and install the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
|
msgid "Unable to create directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
|
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
|
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
|
msgid "Unable to delete file %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
|
msgid "Unable to delete file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
|
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
|
msgid "Unable to load package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
|
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
|
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
|
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
|
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
|
msgid "Uninstall package %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
|
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgreg
|
|
msgid "Package Registration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
|
msgid "Can not register components without unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
|
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
|
msgid "Component Class %s%s%s already defined"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysfilename
|
|
msgid "%s%sFile Name: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
|
msgid "Invalid component class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
|
msgid "Invalid Unitname: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
|
msgid "Package file not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
|
msgid "Register procedure is nil"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
|
msgid "RegisterUnit was called, but no package is registering."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysregistrationerror
|
|
msgid "Registration Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
|
|
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
|
msgstr "SynEdit - die redigeerder wat in Lazarus gebruik word. http://sourceforge.net/projects/synedit/"
|
|
|
|
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
|
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
|
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
|
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
|
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
|
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitname
|
|
msgid "%s%sUnit Name: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitnotfound
|
|
msgid "Unit not found: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
|
|
msgid "Unit %s%s%s was removed from package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
|
msgid "Unable to read package file %s%s%s.%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldexists
|
|
msgid "Exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldglobal
|
|
msgid "Global"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldonlyexistingfiles
|
|
msgid "Only existing files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowgloballinks
|
|
msgid "Show global links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowuserlinks
|
|
msgid "Show user links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplduser
|
|
msgid "User"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleasecheckthecompilername
|
|
msgid "Please check the compiler name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleasecheckthefpcsourcedirectory
|
|
msgid "Please check the freepascal source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistall
|
|
msgid "<All>"
|
|
msgstr "<Alles>"
|
|
|
|
#: lazarusidestrconsts.lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Spring no seleksie"
|
|
|
|
#: lazarusidestrconsts.lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<Nuks>"
|
|
|
|
#: lazarusidestrconsts.lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Objek"
|
|
|
|
#: lazarusidestrconsts.lisplisttype
|
|
msgctxt "lazarusidestrconsts.lisplisttype"
|
|
msgid "Type"
|
|
msgstr "Tipe"
|
|
|
|
#: lazarusidestrconsts.lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispointer
|
|
msgid "Pointer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
|
msgid "Save in IDE config directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprint
|
|
msgid "Print"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprivate
|
|
msgid "Private"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprocedure
|
|
msgctxt "lazarusidestrconsts.lisprocedure"
|
|
msgid "Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisproductname
|
|
msgid "Product Name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisproductversion
|
|
msgid "Product Version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogram
|
|
msgctxt "lazarusidestrconsts.lisprogram"
|
|
msgid "Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
|
|
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddaddfiletoproject
|
|
msgid "Add file to project:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
|
msgid "Add editor files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddfiles
|
|
msgid "Add files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidpackagename
|
|
msgid "Invalid packagename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
|
msgid "Invalid pascal unit name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
|
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
|
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
|
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
|
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
|
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
|
msgid "The project has already a dependency for the package %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
|
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
|
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
|
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddtoproject
|
|
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
|
msgid "Add to project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectory
|
|
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectinformation
|
|
msgid "Project Information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacrounitpath
|
|
msgid "macro ProjectUnitPath"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectoutdir
|
|
msgid "Project Output directory (e.g. the ppu directory)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
|
|
msgid "Project %s%s%s successfully built. :)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
|
msgid "Delete dependency for %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspprojectinspector
|
|
msgid "Project Inspector - %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
|
msgid "Removed required packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
|
msgid "Remove file %s from project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
|
msgid "Unable to read state file %s of project %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
|
msgid "Unable to write state file for project %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptserror
|
|
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
|
msgid "Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
|
msgid "Project Source Directory Mark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
|
|
msgid "Properties of conditional compiler option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprotected
|
|
msgid "Protected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
|
msgid "Invalid Exclude filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
|
msgid "Invalid Include filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
|
msgid "Save .lrs files in the output directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
|
msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
|
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
|
msgid "The unitname is not a valid pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
|
msgid "The unitname is used when the IDE extends uses clauses."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwconvertproject
|
|
msgid "Convert Delphi Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwnewproject
|
|
msgid "New Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwopenproject
|
|
msgid "Open Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwopenrecentproject
|
|
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
|
msgid "Open Recent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwrecentprojects
|
|
msgid "Recent Projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquitlazarus
|
|
msgid "Quit Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreaderror
|
|
msgid "Read Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecordstruct
|
|
msgid "Record/Structure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisregisters
|
|
msgctxt "lazarusidestrconsts.lisregisters"
|
|
msgid "Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisregistersdlgname
|
|
msgctxt "lazarusidestrconsts.lisregistersdlgname"
|
|
msgid "Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisregistersdlgvalue
|
|
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
|
|
msgid "Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisregularexpression
|
|
msgid "Regular expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrelativepaths
|
|
msgid "Relative paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremove
|
|
msgid "remove"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveallunits
|
|
msgid "Remove all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefromproject
|
|
msgid "Remove from project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveselectedunits
|
|
msgid "Remove selected units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovethem
|
|
msgid "Remove them"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrepeatcount
|
|
msgid "Repeat Count:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcefilecomment
|
|
msgid "This is an automatically generated lazarus resource file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourceloaderror
|
|
msgid "Resource load error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresult
|
|
msgid "Result :="
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresult2
|
|
msgid "Result:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisright
|
|
msgctxt "lazarusidestrconsts.lisright"
|
|
msgid "Right"
|
|
msgstr "Regs"
|
|
|
|
#: lazarusidestrconsts.lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrightsides
|
|
msgid "Right sides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
|
msgid "The host application %s%s%s is not executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract methods - not yet overridden"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsof
|
|
msgid "Abstract methods of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamselectnone
|
|
msgid "Select none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissave
|
|
msgid "Save ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveallmessagestofile
|
|
msgid "Save all messages to file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveallmodified
|
|
msgid "save all modified files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveandexitdialog
|
|
msgid "Save and exit dialog"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveandrebuildide
|
|
msgid "Save and rebuild IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Stoor veranderinge?"
|
|
|
|
#: lazarusidestrconsts.lissavechangestoproject
|
|
msgid "Save changes to project %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavecurrenteditorfile
|
|
msgid "save current editor file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
|
msgid "Save editor info of non project files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavefileas
|
|
msgid "Save file as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
|
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
|
msgid "Save info of closed editor files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveprojectlpi
|
|
msgid "Save Project %s (*.lpi)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Stoor voorkeure"
|
|
|
|
#: lazarusidestrconsts.lissavespace
|
|
msgid "Save "
|
|
msgstr "Stoor"
|
|
|
|
#: lazarusidestrconsts.lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissearchfor
|
|
msgid "Search For "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
|
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisseemessages
|
|
msgid "See messages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectanode
|
|
msgid "Select a node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectdfmfiles
|
|
msgid "Select Delphi form files (*.dfm)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedbottomneighbour
|
|
msgid "(selected bottom neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedleftneighbour
|
|
msgid "(selected left neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedrightneighbour
|
|
msgid "(selected right neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedtopneighbour
|
|
msgid "(selected top neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectfile
|
|
msgid "Select the file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetdefault
|
|
msgid "Set default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetvalue
|
|
msgid "Set value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshort
|
|
msgid "Short:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshow
|
|
msgid "Show"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
|
msgid "Show gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
|
msgid "Show hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
|
msgid "Show information box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoldtaborder
|
|
msgid "Show old tab order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
|
msgid "Show status bar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunits
|
|
msgid "Show units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowversionandexit
|
|
msgid "show version and exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissibling
|
|
msgid "Sibling"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissimplesyntax
|
|
msgid "Simple Syntax"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskiploadinglastproject
|
|
msgid "Skip loading last project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissmallerratherthanfaster
|
|
msgid "smaller rather than faster"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissmatches
|
|
msgid "Matches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissorrynotimplementedyet
|
|
msgid "Sorry, not implemented yet"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselascending
|
|
msgid "Ascending"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselcancel
|
|
msgctxt "lazarusidestrconsts.lissortselcancel"
|
|
msgid "Cancel"
|
|
msgstr "Kanselleer"
|
|
|
|
#: lazarusidestrconsts.lissortselcasesensitive
|
|
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortseldescending
|
|
msgid "Descending"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortseldomain
|
|
msgid "Domain"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Verwerp Spasie"
|
|
|
|
#: lazarusidestrconsts.lissortsellines
|
|
msgid "Lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortseloptions
|
|
msgctxt "lazarusidestrconsts.lissortseloptions"
|
|
msgid "Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselpreview
|
|
msgctxt "lazarusidestrconsts.lissortselpreview"
|
|
msgid "Preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Aanvaar"
|
|
|
|
#: lazarusidestrconsts.lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselwords
|
|
msgctxt "lazarusidestrconsts.lissortselwords"
|
|
msgid "Words"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
|
msgid "Source and Destination are the same:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcebreakpoint
|
|
msgid "&Source breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
|
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
|
msgid "Source directory %s%s%s does not exist."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
|
msgid "Source of page %s%s%s has changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Spasieer evereedig"
|
|
|
|
#: lazarusidestrconsts.lissrcos
|
|
msgid "Src OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisssearching
|
|
msgid "Searching"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisssearchtext
|
|
msgid "Search text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstoponexception
|
|
msgid "Stop on exception"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstreamerror
|
|
msgid "Stream Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstring
|
|
msgid "String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstyle
|
|
msgctxt "lazarusidestrconsts.lisstyle"
|
|
msgid "Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccess
|
|
msgid "Success"
|
|
msgstr "Sukses"
|
|
|
|
#: lazarusidestrconsts.lissvnrevision
|
|
msgid "SVN Revision: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
|
msgid "%s%s%s is not a valid identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissvuook
|
|
msgctxt "lazarusidestrconsts.lissvuook"
|
|
msgid "Ok"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissynedit
|
|
msgid "SynEdit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listab
|
|
msgid "Tab"
|
|
msgstr "Keep"
|
|
|
|
#: lazarusidestrconsts.listaborderof
|
|
msgid "Tab Order of"
|
|
msgstr "Keep orde van"
|
|
|
|
#: lazarusidestrconsts.listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetos
|
|
msgctxt "lazarusidestrconsts.listargetos"
|
|
msgid "Target OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listcompilerinternalerror
|
|
msgid "Internal compiler error! (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listddinserttodo
|
|
msgid "Insert ToDo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listestdirectory
|
|
msgid "Test directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
|
msgid "The codetools found an error:%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
|
msgid "The command after %s%s%s is not executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
|
msgid "The command after publishing is invalid:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
msgid "The component %s can not be deleted, because it is not owned by %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
|
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
|
|
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
|
|
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
|
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
|
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
|
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
|
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
|
|
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
|
msgid "The destination directory%s%s%s%s does not exist."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
|
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
|
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
|
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectorywasnotfound
|
|
msgid "The directory %s was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefile
|
|
msgid "The file %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
|
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
|
|
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisnotadelphiunit
|
|
msgid "The file %s%s%s is not a Delphi unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
|
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
|
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
|
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefollowingunitswerenotfound1eithertheseunitsaren
|
|
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
|
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
|
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
|
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
|
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
|
|
msgid "The name %s%s%s is not a valid pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
|
msgid "The output directory %s%s%s is missing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
|
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
|
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
|
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththename
|
|
msgid "There is already a build mode with the name %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
|
msgid "There is already a form with the name %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
|
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
|
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
|
msgid "The root component can not be deleted."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
|
|
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
|
|
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
|
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
|
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
|
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhishelpmessage
|
|
msgid "this help message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillhappencontinue
|
|
msgid "This will happen:%s%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitle
|
|
msgid "&Title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
|
msgid "Function: append path delimiter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
|
msgid "Function: chomp path delimiter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfileextension
|
|
msgid "Function: extract file extension"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
|
msgid "Function: extract file name+extension"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
|
msgid "Function: extract file name only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilepath
|
|
msgid "Function: extract file path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmunknownmacro
|
|
msgid "(unknown macro: %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodogoto
|
|
msgid "Goto"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodoldescription
|
|
msgctxt "lazarusidestrconsts.listodoldescription"
|
|
msgid "Description"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodoldone
|
|
msgid "Done"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolfile
|
|
msgctxt "lazarusidestrconsts.listodolfile"
|
|
msgid "Module"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolistcaption
|
|
msgctxt "lazarusidestrconsts.listodolistcaption"
|
|
msgid "ToDo List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolistgotoline
|
|
msgid "Goto selected source line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolistoptions
|
|
msgid "ToDo options..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolistprintlist
|
|
msgid "Print todo items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolistrefresh
|
|
msgid "Refresh todo items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolline
|
|
msgid "Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolowner
|
|
msgid "Owner"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listodolpriority
|
|
msgid "Priority"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listofpcpath
|
|
msgid "Path:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
|
msgid "Toggle showing filenames with full path or with relative path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listop
|
|
msgid "Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listops
|
|
msgid "Tops"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listtodolcategory
|
|
msgctxt "lazarusidestrconsts.listtodolcategory"
|
|
msgid "Category"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listurbopascal
|
|
msgid "Turbo Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Lettertipe sonder UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisuegotoline
|
|
msgid "Goto line :"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuenotfound
|
|
msgid "Not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuereadonly
|
|
msgid "%s/ReadOnly"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
|
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuesearching
|
|
msgid "Searching: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringnotfound
|
|
msgid "Search string '%s' not found!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuethecurre
|
|
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidbytes
|
|
msgid "%s bytes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidclear
|
|
msgid "Clear"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidinproject
|
|
msgid "in Project:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidlines
|
|
msgctxt "lazarusidestrconsts.lisuidlines"
|
|
msgid "Lines:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidname
|
|
msgctxt "lazarusidestrconsts.lisuidname"
|
|
msgid "Name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidno
|
|
msgid "no"
|
|
msgstr "nee"
|
|
|
|
#: lazarusidestrconsts.lisuidok
|
|
msgctxt "lazarusidestrconsts.lisuidok"
|
|
msgid "Ok"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidpathsreadonly
|
|
msgid "Paths (Read Only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidsize
|
|
msgid "Size:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidsrc
|
|
msgid "Src"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Tipe:"
|
|
|
|
#: lazarusidestrconsts.lisuidunit
|
|
msgctxt "lazarusidestrconsts.lisuidunit"
|
|
msgid "Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuidyes
|
|
msgid "yes"
|
|
msgstr "ja"
|
|
|
|
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
|
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletobackupfileto
|
|
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeclassofto
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
|
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
|
msgid "Unable to convert file %s%s%s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
|
|
msgid "Unable to convert lfm to lrs and write lrs file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
|
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfile
|
|
msgid "Unable to copy file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfileto
|
|
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfileto2
|
|
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
|
msgid "Unable to create backup directory %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatedirectory
|
|
msgid "Unable to create directory %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatedirectory2
|
|
msgid "Unable to create directory %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile
|
|
msgid "Unable to create file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile2
|
|
msgid "Unable to create file %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile3
|
|
msgid "Unable to create file%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefilename
|
|
msgid "Unable to create file %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
|
msgid "Unable to create link %s%s%s with target %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
|
|
msgid "Unable to create new method. Please fix the error shown in the message window."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
|
msgid "Unable to delete ambiguous file %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
|
msgid "Unable to find a valid classname in %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfile
|
|
msgid "Unable to find file %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
|
|
msgid "Unable to find method. Please fix the error shown in the message window."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
|
|
msgid "Unable to find the unit of component class %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
|
|
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadpackage
|
|
msgid "Unable to load package %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoread
|
|
msgid "Unable to read %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile
|
|
msgid "Unable to read file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile2
|
|
msgid "Unable to read file %s%s%s!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfileerror
|
|
msgid "Unable to read file %s%s%s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfilename
|
|
msgid "Unable to read file %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
|
msgid "Unable to remove old backup file %s%s%s!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
|
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefile
|
|
msgid "Unable to rename file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto
|
|
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto2
|
|
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletosavefile
|
|
msgid "Unable to save file %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
|
|
msgid "Unable to show method. Please fix the error shown in the message window."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamt
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
|
|
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowrite
|
|
msgid "Unable to write %s%s%s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowrite2
|
|
msgid "Unable to write %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile
|
|
msgid "Unable to write file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile2
|
|
msgid "Unable to write file %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefileerror
|
|
msgid "Unable to write file %s%s%s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefilename
|
|
msgid "Unable to write file %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetofile
|
|
msgid "Unable to write to file %s%s%s!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetofile2
|
|
msgid "Unable to write to file %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
|
msgid "Unable to write xml stream to %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunithaschangedsave
|
|
msgid "Unit %s%s%s has changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitinpackage
|
|
msgid "%s unit %s in package %s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitlfmfile
|
|
msgid "Unit: %s%sLFM file: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfound
|
|
msgid "Unit not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitpath
|
|
msgid "unit path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitsnotfound2
|
|
msgid "Units not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusedunits
|
|
msgid "Unused units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatepreview
|
|
msgid "Update preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatereferences
|
|
msgid "Update references?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusagemessagehoption
|
|
msgid "Usage message (-h option)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseexcludefilter
|
|
msgid "Use Exclude Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseincludefilter
|
|
msgid "Use Include Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisutf8withbom
|
|
msgid "UTF-8 with BOM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalue
|
|
msgid "Value:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalue2
|
|
msgid "Value%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalues
|
|
msgid "Values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisversion
|
|
msgid "Version"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvertical
|
|
msgid "Vertical"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewprojectunits
|
|
msgid "View Project Units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvsrforwardsearch
|
|
msgid "Forward Search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvsrresetresultlist
|
|
msgid "Reset Result List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
|
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchpropert
|
|
msgid "Watch Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
|
msgid "When a unit is renamed, update references ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswladd
|
|
msgid "&Add"
|
|
msgstr "Voeg by"
|
|
|
|
#: lazarusidestrconsts.liswldelete
|
|
msgid "&Delete"
|
|
msgstr "&Skrap"
|
|
|
|
#: lazarusidestrconsts.liswldeleteall
|
|
msgid "De&lete All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswldisableall
|
|
msgid "D&isable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlenableall
|
|
msgid "E&nable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlenabled
|
|
msgid "&Enabled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlexpression
|
|
msgid "Expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlproperties
|
|
msgid "&Properties"
|
|
msgstr "&Eienskappe"
|
|
|
|
#: lazarusidestrconsts.liswlwatchlist
|
|
msgid "Watch list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswriteerror
|
|
msgid "Write Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswriteerrorfile
|
|
msgid "Write error: %s%sFile: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisxmlerror
|
|
msgid "XML Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisxmlfiles
|
|
msgid "XML files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
|
msgid "XML parser error in file %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
msgid "You can not build lazarus while debugging or compiling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.locwndsrceditor
|
|
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
|
msgid "Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsadditionalinfo
|
|
msgid "Additional info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsavailablescanners
|
|
msgid "Available scanners"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsbuild
|
|
msgid "Build:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscharacterset
|
|
msgid "Character set:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsclosecurrentpage
|
|
msgid "Close current page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscopyright
|
|
msgid "Copyright:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscreatingdirfailed
|
|
msgid "Creating directory \"%s\" failed!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscreatingsymlinkfailed
|
|
msgid "Creating symbolic link \"%s\" failed!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscreatingsymlinknotsupported
|
|
msgid "Creating symbolic link is not supported on this platform!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
|
|
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
|
|
msgid "Filter the list with the current filter expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsformdatafiledfm
|
|
msgid "Form data file (*.dfm)|*.dfm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
|
msgid "Found, but not listed here: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
|
|
msgid "Go to the next item in the search list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
|
msgid "Include Version Info in executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomposition
|
|
msgid "Custom position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpdefault
|
|
msgctxt "lazarusidestrconsts.rsiwpdefault"
|
|
msgid "Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpdocked
|
|
msgid "Docked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
|
msgid "Restore window geometry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowsize
|
|
msgid "Restore window size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
|
|
msgid "Use windowmanager setting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageafrikaans
|
|
msgid "Afrikaans"
|
|
msgstr "Afrikaans"
|
|
|
|
#: lazarusidestrconsts.rslanguagearabic
|
|
msgid "Arabic"
|
|
msgstr "Arabies"
|
|
|
|
#: lazarusidestrconsts.rslanguageautomatic
|
|
msgid "Automatic (or english)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagecatalan
|
|
msgid "Catalan"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagechinese
|
|
msgid "Chinese"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagedutch
|
|
msgid "Dutch"
|
|
msgstr "Nederlands"
|
|
|
|
#: lazarusidestrconsts.rslanguageenglish
|
|
msgid "English"
|
|
msgstr "English"
|
|
|
|
#: lazarusidestrconsts.rslanguagefinnish
|
|
msgid "Finnish"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagefrench
|
|
msgid "French"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagegerman
|
|
msgid "German"
|
|
msgstr "Duits"
|
|
|
|
#: lazarusidestrconsts.rslanguagehebrew
|
|
msgid "Hebrew"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageindonesian
|
|
msgid "Indonesian"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageitalian
|
|
msgid "Italian"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagejapanese
|
|
msgid "Japanese"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagelithuanian
|
|
msgid "Lithuanian"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagepolish
|
|
msgid "Polish"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageportugues
|
|
msgid "Portuguese"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagerussian
|
|
msgid "Russian"
|
|
msgstr "Rusies"
|
|
|
|
#: lazarusidestrconsts.rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageslovak
|
|
msgid "Slovak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagespanish
|
|
msgid "Spanish"
|
|
msgstr "Spaans"
|
|
|
|
#: lazarusidestrconsts.rslanguageturkish
|
|
msgid "Turkish"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageukrainian
|
|
msgid "Ukrainian"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsmajorrevision
|
|
msgid "Major revision:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsminorrevision
|
|
msgid "Minor revision:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsok
|
|
msgid "ok"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsotherinfo
|
|
msgid "Other info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsremove
|
|
msgid "&Remove"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresetfilter
|
|
msgid "Reset filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsscanners
|
|
msgid "Scanners"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsselectaninheritedentry
|
|
msgid "Select an inherited entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsstartanewsearch
|
|
msgid "Start a new search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsversion
|
|
msgid "Version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmalreadyconnected
|
|
msgid " The key \"%s\" is already connected to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmalternkey
|
|
msgid "Alternative key (or 2 keys combination)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcolselection
|
|
msgid "Text column selection commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatenvmenu
|
|
msgid "Environment menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatfold
|
|
msgid "Text folding commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatmarker
|
|
msgid "Text marker commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcommand
|
|
msgctxt "lazarusidestrconsts.srkmcommand"
|
|
msgid "Command:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcommand1
|
|
msgid " command1 \""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcommand2
|
|
msgid " command2 \""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmconflic
|
|
msgid "Conflict "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmconflicw
|
|
msgid " conflicts with "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddjumppoint
|
|
msgid "Add jump point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockindent
|
|
msgid "Indent block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindent
|
|
msgid "Unindent block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecbuildall
|
|
msgid "build all files of program/project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecbuildlazarus
|
|
msgid "Build lazarus"
|
|
msgstr "Bou Lazarus"
|
|
|
|
#: lazarusidestrconsts.srkmecchar
|
|
msgid "Char"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
|
|
msgid "Codetools defines editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccodetoolsoptions
|
|
msgid "Codetools options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseldown
|
|
msgid "Column Select Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
|
msgid "Column Select to absolute end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditortop
|
|
msgid "Column Select to absolute beginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselleft
|
|
msgid "Column Select Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellineend
|
|
msgid "Column Select Line End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinestart
|
|
msgid "Column Select Line Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagebottom
|
|
msgid "Column Select Page Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagedown
|
|
msgid "Column Select Page Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagetop
|
|
msgid "Column Select Page Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpageup
|
|
msgid "Column Select Page Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselright
|
|
msgid "Column Select Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselup
|
|
msgid "Column Select Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccompileroptions
|
|
msgid "compiler options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccompletecode
|
|
msgid "Complete code"
|
|
msgstr "Voltooi bron"
|
|
|
|
#: lazarusidestrconsts.srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopy
|
|
msgid "Copy selection to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccustomtool
|
|
msgid "Custom tool %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccut
|
|
msgid "Cut selection to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdiff
|
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
|
msgid "Diff"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecenvironmentoptions
|
|
msgid "General environment options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecextractproc
|
|
msgid "Extract procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecexttool
|
|
msgid "External tool %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfind
|
|
msgid "Find text"
|
|
msgstr "Vind volgende"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfinddeclaration
|
|
msgid "Find declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
|
msgid "Find identifier references"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindinfiles
|
|
msgid "Find in files"
|
|
msgstr "Vind in leêrs"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnext
|
|
msgid "Find next"
|
|
msgstr "Vind volgende"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
|
msgid "Find next word occurrence"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloads
|
|
msgid "Find overloads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevious
|
|
msgid "Find previous"
|
|
msgstr "Vind vorige"
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
|
msgid "Find previous word occurrence"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
|
msgid "Find procedure definiton"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduremethod
|
|
msgid "Find procedure method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfoldcurrent
|
|
msgid "Fold at Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfoldlevel
|
|
msgid "Fold to Level %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotoeditor
|
|
msgid "Go to editor %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotoincludedirective
|
|
msgid "Go to to include directive of current include file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotolinenumber
|
|
msgid "Go to line number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotomarker
|
|
msgid "Go to Marker %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
|
msgid "Guess misplaced $IFDEF"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "inspekteur"
|
|
|
|
#: lazarusidestrconsts.srkmecinvertassignment
|
|
msgid "Invert assignment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmakeresourcestring
|
|
msgid "Make resource string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpaste
|
|
msgid "Paste clipboard to current position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpause
|
|
msgid "pause program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprocedurelist
|
|
msgid "Procedure List ..."
|
|
msgstr "Prosedure Lys ..."
|
|
|
|
#: lazarusidestrconsts.srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecremovebreakpoint
|
|
msgid "remove break point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecremoveemptymethods
|
|
msgid "Remove empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecremoveunusedunits
|
|
msgid "Remove unused units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrenameidentifier
|
|
msgid "Rename identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecreplace
|
|
msgid "Replace text"
|
|
msgstr "Vervang teks"
|
|
|
|
#: lazarusidestrconsts.srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrun
|
|
msgid "run program"
|
|
msgstr "hardloop program"
|
|
|
|
#: lazarusidestrconsts.srkmecrunfile
|
|
msgid "run file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselectall
|
|
msgctxt "lazarusidestrconsts.srkmecselectall"
|
|
msgid "Select All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselleft
|
|
msgid "SelLeft"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsellineend
|
|
msgid "Select Line End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsellinestart
|
|
msgid "Select Line Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpagebottom
|
|
msgid "Select Page Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpagetop
|
|
msgid "Select Page Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselright
|
|
msgid "SelRight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselup
|
|
msgid "Select Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselwordleft
|
|
msgid "Select Word Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselwordright
|
|
msgid "Select Word Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
|
msgid "Set a free Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsetmarker
|
|
msgid "Set Marker %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecshowabstractmethods
|
|
msgid "Show abstract methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecshowcodecontext
|
|
msgid "Show code context"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsyntaxcheck
|
|
msgid "Syntax check"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoint
|
|
msgid "toggle break point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
|
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
|
msgid "View IDE speed buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarker
|
|
msgid "Toggle Marker %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarkupword
|
|
msgid "Toggle Current-Word highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldall
|
|
msgid "Unfold all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldcurrent
|
|
msgid "Unfold at Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecuserfirst
|
|
msgid "User First"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewtodolist
|
|
msgid "View todo list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewunits
|
|
msgid "View units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordcompletion
|
|
msgid "Word completion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeditforcmd
|
|
msgid "Edit keys of command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeditkeys
|
|
msgid "Edit Keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmgrabkey
|
|
msgid "Grab key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmgrabsecondkey
|
|
msgid "Grab second key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmkey
|
|
msgid "Key (or 2 keys combination)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmpresskey
|
|
msgid "Please press a key ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uefilerotext1
|
|
msgid "The file \""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uembookmarkn
|
|
msgid "Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "Sluit Bladsy"
|
|
|
|
#: lazarusidestrconsts.uemcompletecode
|
|
msgctxt "lazarusidestrconsts.uemcompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Voltooi Bron"
|
|
|
|
#: lazarusidestrconsts.uemcopy
|
|
msgctxt "lazarusidestrconsts.uemcopy"
|
|
msgid "Copy"
|
|
msgstr "Kopieer"
|
|
|
|
#: lazarusidestrconsts.uemcopyfilename
|
|
msgid "Copy filename"
|
|
msgstr "Kopieer lêer"
|
|
|
|
#: lazarusidestrconsts.uemcut
|
|
msgctxt "lazarusidestrconsts.uemcut"
|
|
msgid "Cut"
|
|
msgstr "Sny"
|
|
|
|
#: lazarusidestrconsts.uemdebugword
|
|
msgid "Debug"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemeditorproperties
|
|
msgid "Editor properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemencloseselection
|
|
msgctxt "lazarusidestrconsts.uemencloseselection"
|
|
msgid "Enclose Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemencoding
|
|
msgid "Encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemextractproc
|
|
msgctxt "lazarusidestrconsts.uemextractproc"
|
|
msgid "Extract Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemfindidentifierreferences
|
|
msgid "Find Identifier References"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Gaan na Boekmerke"
|
|
|
|
#: lazarusidestrconsts.uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.ueminserttodo
|
|
msgid "Insert Todo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.ueminvertassignment
|
|
msgid "Invert Assignment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmoveeditorleft
|
|
msgid "Move Editor Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmoveeditorleftmost
|
|
msgid "Move Editor Leftmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmoveeditorright
|
|
msgid "Move Editor Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmoveeditorrightmost
|
|
msgid "Move Editor Rightmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemnextbookmark
|
|
msgid "Goto next Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemodified
|
|
msgid "Modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemopenfileatcursor
|
|
msgid "&Open file at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uempaste
|
|
msgctxt "lazarusidestrconsts.uempaste"
|
|
msgid "Paste"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemprevbookmark
|
|
msgid "Goto previous Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Prosedure Spring"
|
|
|
|
#: lazarusidestrconsts.uemreadonly
|
|
msgid "Read Only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemrenameidentifier
|
|
msgid "Rename Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemruntocursor
|
|
msgid "&Run to Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemsetbookmark
|
|
msgid "&Set Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
|
msgid "Set a free Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemshowunitinfo
|
|
msgid "Unit Info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmark
|
|
msgid "&Toggle Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemtogglebreakpoint
|
|
msgid "&Toggle Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemviewcallstack
|
|
msgid "View Call Stack"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uenotimplcapagain
|
|
msgid "I told You: Not implemented yet"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uenotimpltext
|
|
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepins
|
|
msgid "INS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepovr
|
|
msgid "OVR"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepreadonly
|
|
msgid "Readonly"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr ""
|
|
|