lazarus/languages/lazaruside.po
mattias 66cbe700a5 updated dutch translation from Darius
git-svn-id: trunk@7727 -
2005-09-17 14:18:15 +00:00

8529 lines
195 KiB
Plaintext

#: lazarusidestrconsts:lisentertransla
msgid "Enter translation language"
msgstr ""
#: lazarusidestrconsts:lislazarusversionstring
msgid "0.9.9 beta"
msgstr ""
#: lazarusidestrconsts:lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr ""
#: lazarusidestrconsts:lismenucollectpofil
msgid "Collect .po files"
msgstr ""
#: lazarusidestrconsts:lismenucreatepofile
msgid "Create .po files"
msgstr ""
#: lazarusidestrconsts:listhishelpmessage
msgid "this help message"
msgstr ""
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr ""
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr ""
#: lazarusidestrconsts:lisideoptions
msgid "IDE Options:"
msgstr ""
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr ""
#: lazarusidestrconsts:lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr ""
#: lazarusidestrconsts:lisskiploadinglastproject
msgid "Skip loading last project"
msgstr ""
#: lazarusidestrconsts:lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr ""
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr ""
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr ""
#: lazarusidestrconsts:lisselectiontool
msgid "Selection tool"
msgstr ""
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr ""
#: lazarusidestrconsts:liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr ""
#: lazarusidestrconsts:liscompilerfilename
msgid "Compiler filename"
msgstr ""
#: lazarusidestrconsts:liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr ""
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr ""
#: lazarusidestrconsts:lislazarusdirectory
msgid "Lazarus directory"
msgstr ""
#: lazarusidestrconsts:lislclwidgettype
msgid "LCL Widget Type"
msgstr ""
#: lazarusidestrconsts:listargetcpu
msgid "Target CPU"
msgstr ""
#: lazarusidestrconsts:listargetos
msgid "Target OS"
msgstr ""
#: lazarusidestrconsts:liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr ""
#: lazarusidestrconsts:lispromptforvalue
msgid "Prompt for value"
msgstr ""
#: lazarusidestrconsts:lisprojectfilename
msgid "Project filename"
msgstr ""
#: lazarusidestrconsts:lisprojectdirectory
msgid "Project directory"
msgstr ""
#: lazarusidestrconsts:lissavecurrenteditorfile
msgid "save current editor file"
msgstr ""
#: lazarusidestrconsts:lissaveallmodified
msgid "save all modified files"
msgstr ""
#: lazarusidestrconsts:listargetfilenameofproject
msgid "Target filename of project"
msgstr ""
#: lazarusidestrconsts:listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""
#: lazarusidestrconsts:listestdirectory
msgid "Test directory"
msgstr ""
#: lazarusidestrconsts:lislaunchingcmdline
msgid "Launching target command line"
msgstr ""
#: lazarusidestrconsts:lispublishprojdir
msgid "Publish project directory"
msgstr ""
#: lazarusidestrconsts:lisprojectunitpath
msgid "Project Unit Path"
msgstr ""
#: lazarusidestrconsts:lisprojectincpath
msgid "Project Include Path"
msgstr ""
#: lazarusidestrconsts:lisprojectsrcpath
msgid "Project Src Path"
msgstr ""
#: lazarusidestrconsts:lismakeexe
msgid "Make Executable"
msgstr ""
#: lazarusidestrconsts:lisprojectmakroproperties
msgid "Project makro properties"
msgstr ""
#: lazarusidestrconsts:lisconfigdirectory
msgid "Lazarus config directory"
msgstr ""
#: lazarusidestrconsts:lismenufile
msgid "&File"
msgstr ""
#: lazarusidestrconsts:lismenuedit
msgid "&Edit"
msgstr ""
#: lazarusidestrconsts:lismenusearch
msgid "&Search"
msgstr ""
#: lazarusidestrconsts:lismenuview
msgid "&View"
msgstr ""
#: lazarusidestrconsts:lismenuproject
msgid "&Project"
msgstr ""
#: lazarusidestrconsts:lismenurun
msgid "&Run"
msgstr ""
#: lazarusidestrconsts:lismenucomponents
msgid "&Components"
msgstr ""
#: lazarusidestrconsts:lismenutools
msgid "&Tools"
msgstr ""
#: lazarusidestrconsts:lismenuenvironent
msgid "E&nvironment"
msgstr ""
#: lazarusidestrconsts:lismenuwindows
msgid "&Windows"
msgstr ""
#: lazarusidestrconsts:lismenuhelp
msgid "&Help"
msgstr ""
#: lazarusidestrconsts:lismenunewunit
msgid "New Unit"
msgstr ""
#: lazarusidestrconsts:lismenunewform
msgid "New Form"
msgstr ""
#: lazarusidestrconsts:lismenunewother
msgid "New ..."
msgstr ""
#: lazarusidestrconsts:lismenuopen
msgid "Open"
msgstr ""
#: lazarusidestrconsts:lismenurevert
msgid "Revert"
msgstr ""
#: lazarusidestrconsts:lispkgeditpublishpackage
msgid "Publish Package"
msgstr ""
#: lazarusidestrconsts:lismenuopenrecent
msgid "Open Recent"
msgstr ""
#: lazarusidestrconsts:lismenusave
msgid "Save"
msgstr ""
#: lazarusidestrconsts:lismenusaveas
msgid "Save As"
msgstr ""
#: lazarusidestrconsts:lismenusaveall
msgid "Save All"
msgstr ""
#: lazarusidestrconsts:lismenuclose
msgid "Close"
msgstr ""
#: lazarusidestrconsts:lismenucloseall
msgid "Close all editor files"
msgstr ""
#: lazarusidestrconsts:lismenucleandirectory
msgid "Clean directory"
msgstr ""
#: lazarusidestrconsts:lismenuquit
msgid "Quit"
msgstr ""
#: lazarusidestrconsts:lismenurestart
msgid "Restart"
msgstr ""
#: lazarusidestrconsts:lismenuundo
msgid "Undo"
msgstr ""
#: lazarusidestrconsts:lismenuredo
msgid "Redo"
msgstr ""
#: lazarusidestrconsts:lismenucut
msgid "Cut"
msgstr ""
#: lazarusidestrconsts:lismenucopy
msgid "Copy"
msgstr ""
#: lazarusidestrconsts:lismenupaste
msgid "Paste"
msgstr ""
#: lazarusidestrconsts:lismenuindentselection
msgid "Indent selection"
msgstr ""
#: lazarusidestrconsts:lismenuunindentselection
msgid "Unindent selection"
msgstr ""
#: lazarusidestrconsts:lismenuuppercaseselection
msgid "Uppercase selection"
msgstr ""
#: lazarusidestrconsts:lismenulowercaseselection
msgid "Lowercase selection"
msgstr ""
#: lazarusidestrconsts:lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr ""
#: lazarusidestrconsts:lismenuencloseselection
msgid "Enclose selection"
msgstr ""
#: lazarusidestrconsts:lismenucommentselection
msgid "Comment selection"
msgstr ""
#: lazarusidestrconsts:lismenuuncommentselection
msgid "Uncomment selection"
msgstr ""
#: lazarusidestrconsts:lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr ""
#: lazarusidestrconsts:lismenusortselection
msgid "Sort selection"
msgstr ""
#: lazarusidestrconsts:lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr ""
#: lazarusidestrconsts:lismenuselect
msgid "Select"
msgstr ""
#: lazarusidestrconsts:lismenuselectall
msgid "Select all"
msgstr ""
#: lazarusidestrconsts:lismenuselecttobrace
msgid "Select to brace"
msgstr ""
#: lazarusidestrconsts:lismenuselectcodeblock
msgid "Select code block"
msgstr ""
#: lazarusidestrconsts:lismenuselectword
msgid "Select word"
msgstr ""
#: lazarusidestrconsts:lismenuselectline
msgid "Select line"
msgstr ""
#: lazarusidestrconsts:lismenuselectparagraph
msgid "Select paragraph"
msgstr ""
#: lazarusidestrconsts:lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr ""
#: lazarusidestrconsts:lismenuinserttext
msgid "Insert text"
msgstr ""
#: lazarusidestrconsts:lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr ""
#: lazarusidestrconsts:lismenuinsertgeneral
msgid "General"
msgstr ""
#: lazarusidestrconsts:lismenucompletecode
msgid "Complete Code"
msgstr ""
#: lazarusidestrconsts:lismenuextractproc
msgid "Extract procedure"
msgstr ""
#: lazarusidestrconsts:lismenufindidentifierrefs
msgid "Find Identifier References"
msgstr ""
#: lazarusidestrconsts:lismenurenameidentifier
msgid "Rename Identifier"
msgstr ""
#: lazarusidestrconsts:lismenuinsertgplnotice
msgid "GPL notice"
msgstr ""
#: lazarusidestrconsts:lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr ""
#: lazarusidestrconsts:lismenuinsertusername
msgid "Current username"
msgstr ""
#: lazarusidestrconsts:lismenuinsertdatetime
msgid "Current date and time"
msgstr ""
#: lazarusidestrconsts:lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr ""
#: lazarusidestrconsts:lismenufind
msgid "Find"
msgstr ""
#: lazarusidestrconsts:lismenufindnext
msgid "Find &Next"
msgstr ""
#: lazarusidestrconsts:lismenufindprevious
msgid "Find &Previous"
msgstr ""
#: lazarusidestrconsts:lismenufindinfiles
msgid "Find &in files"
msgstr ""
#: lazarusidestrconsts:lismenureplace
msgid "Replace"
msgstr ""
#: lazarusidestrconsts:lismenuincrementalfind
msgid "Incremental Find"
msgstr ""
#: lazarusidestrconsts:lismenugotoline
msgid "Goto line"
msgstr ""
#: lazarusidestrconsts:lismenujumpback
msgid "Jump back"
msgstr ""
#: lazarusidestrconsts:lismenujumpforward
msgid "Jump forward"
msgstr ""
#: lazarusidestrconsts:lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr ""
#: lazarusidestrconsts:lismenuviewjumphistory
msgid "View Jump-History"
msgstr ""
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr ""
#: lazarusidestrconsts:lismenufindcodeblockstart
msgid "Find code block start"
msgstr ""
#: lazarusidestrconsts:lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr ""
#: lazarusidestrconsts:lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr ""
#: lazarusidestrconsts:lismenugotoincludedirective
msgid "Goto include directive"
msgstr ""
#: lazarusidestrconsts:lismenujumptonexterror
msgid "Jump to next error"
msgstr ""
#: lazarusidestrconsts:lismenujumptopreverror
msgid "Jump to previous error"
msgstr ""
#: lazarusidestrconsts:lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr ""
#: lazarusidestrconsts:lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr ""
#: lazarusidestrconsts:lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr ""
#: lazarusidestrconsts:lismenuviewobjectinspector
msgid "Object Inspector"
msgstr ""
#: lazarusidestrconsts:lismenuviewsourceeditor
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts:lismenuviewcodeexplorer
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts:lismenujumpto
msgid "Jump to"
msgstr ""
#: lazarusidestrconsts:lismenuviewunits
msgid "Units..."
msgstr ""
#: lazarusidestrconsts:lismenuviewforms
msgid "Forms..."
msgstr ""
#: lazarusidestrconsts:lismenuviewunitdependencies
msgid "View Unit Dependencies"
msgstr ""
#: lazarusidestrconsts:lismenuviewunitinfo
msgid "View Unit Information"
msgstr ""
#: lazarusidestrconsts:lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr ""
#: lazarusidestrconsts:lismenuviewmessages
msgid "Messages"
msgstr ""
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr ""
#: lazarusidestrconsts:liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr ""
#: lazarusidestrconsts:lissaveallmessagestofile
msgid "Save all messages to file"
msgstr ""
#: lazarusidestrconsts:lismenuviewsearchresults
msgid "Search Results"
msgstr ""
#: lazarusidestrconsts:lissearchagain
msgid "Search again"
msgstr ""
#: lazarusidestrconsts:lismenuviewanchoreditor
msgid "View Anchor Editor"
msgstr ""
#: lazarusidestrconsts:lismenudebugwindows
msgid "Debug windows"
msgstr ""
#: lazarusidestrconsts:lismenuviewwatches
msgid "Watches"
msgstr ""
#: lazarusidestrconsts:lismenuviewbreakpoints
msgid "BreakPoints"
msgstr ""
#: lazarusidestrconsts:lismenuviewlocalvariables
msgid "Local Variables"
msgstr ""
#: lazarusidestrconsts:lismenuviewcallstack
msgid "Call Stack"
msgstr ""
#: lazarusidestrconsts:lismenuviewdebugoutput
msgid "Debug output"
msgstr ""
#: lazarusidestrconsts:lismenunewproject
msgid "New Project"
msgstr ""
#: lazarusidestrconsts:lismenunewprojectfromfile
msgid "New Project from file"
msgstr ""
#: lazarusidestrconsts:lismenuopenproject
msgid "Open Project"
msgstr ""
#: lazarusidestrconsts:lismenuopenrecentproject
msgid "Open Recent Project"
msgstr ""
#: lazarusidestrconsts:lismenusaveproject
msgid "Save Project"
msgstr ""
#: lazarusidestrconsts:lismenusaveprojectas
msgid "Save Project As..."
msgstr ""
#: lazarusidestrconsts:lismenupublishproject
msgid "Publish Project"
msgstr ""
#: lazarusidestrconsts:lismenuprojectinspector
msgid "Project Inspector"
msgstr ""
#: lazarusidestrconsts:lismenuaddtoproject
msgid "Add editor file to Project"
msgstr ""
#: lazarusidestrconsts:lismenuremovefromproject
msgid "Remove from Project"
msgstr ""
#: lazarusidestrconsts:lismenuviewsource
msgid "View Source"
msgstr ""
#: lazarusidestrconsts:lismenuviewprojecttodos
msgid "View ToDo List"
msgstr ""
#: lazarusidestrconsts:lismenuprojectoptions
msgid "Project Options..."
msgstr ""
#: lazarusidestrconsts:lismenubuild
msgid "Build"
msgstr ""
#: lazarusidestrconsts:lismenubuildall
msgid "Build all"
msgstr ""
#: lazarusidestrconsts:lismenuabortbuild
msgid "Abort Build"
msgstr ""
#: lazarusidestrconsts:lismenuprojectrun
msgid "Run"
msgstr ""
#: lazarusidestrconsts:lismenupause
msgid "Pause"
msgstr ""
#: lazarusidestrconsts:lismenustepinto
msgid "Step into"
msgstr ""
#: lazarusidestrconsts:lismenustepover
msgid "Step over"
msgstr ""
#: lazarusidestrconsts:lismenuruntocursor
msgid "Run to cursor"
msgstr ""
#: lazarusidestrconsts:lismenustop
msgid "Stop"
msgstr ""
#: lazarusidestrconsts:lismenuresetdebugger
msgid "Reset debugger"
msgstr ""
#: lazarusidestrconsts:lismenucompileroptions
msgid "Compiler Options..."
msgstr ""
#: lazarusidestrconsts:lismenurunparameters
msgid "Run Parameters ..."
msgstr ""
#: lazarusidestrconsts:lismenubuildfile
msgid "Build File"
msgstr ""
#: lazarusidestrconsts:lismenurunfile
msgid "Run File"
msgstr ""
#: lazarusidestrconsts:lismenuconfigbuildfile
msgid "Configure Build+Run File"
msgstr ""
#: lazarusidestrconsts:lismenuinspect
msgid "Inspect ..."
msgstr ""
#: lazarusidestrconsts:lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr ""
#: lazarusidestrconsts:lismenuaddwatch
msgid "Add watch ..."
msgstr ""
#: lazarusidestrconsts:lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr ""
#: lazarusidestrconsts:lismenuaddbpsource
msgid "Source breakpoint"
msgstr ""
#: lazarusidestrconsts:lismenuopenpackage
msgid "Open loaded package"
msgstr ""
#: lazarusidestrconsts:lismenuopenrecentpkg
msgid "Open recent package"
msgstr ""
#: lazarusidestrconsts:lismenuopenpackagefile
msgid "Open package file (.lpk)"
msgstr ""
#: lazarusidestrconsts:lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr ""
#: lazarusidestrconsts:lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr ""
#: lazarusidestrconsts:lismenupackagegraph
msgid "Package Graph"
msgstr ""
#: lazarusidestrconsts:lismenueditinstallpkgs
msgid "Configure installed packages"
msgstr ""
#: lazarusidestrconsts:lismenuconfigcustomcomps
msgid "Configure custom components"
msgstr ""
#: lazarusidestrconsts:lismenusettings
msgid "Configure custom tools ..."
msgstr ""
#: lazarusidestrconsts:lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr ""
#: lazarusidestrconsts:lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr ""
#: lazarusidestrconsts:lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr ""
#: lazarusidestrconsts:lismenumakeresourcestring
msgid "Make Resource String"
msgstr ""
#: lazarusidestrconsts:lismenudiff
msgid "Diff"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdfmtolfm
msgid "Convert DFM file to LFM"
msgstr ""
#: lazarusidestrconsts:lismenuchecklfm
msgid "Check LFM file in editor"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr ""
#: lazarusidestrconsts:lismenubuildlazarus
msgid "Build Lazarus"
msgstr ""
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr ""
#: lazarusidestrconsts:lismenugeneraloptions
msgid "Environment options"
msgstr ""
#: lazarusidestrconsts:lismenueditoroptions
msgid "Editor options"
msgstr ""
#: lazarusidestrconsts:lismenueditcodetemplates
msgid "Code Templates"
msgstr ""
#: lazarusidestrconsts:lismendebuggeroptions
msgid "Debugger Options"
msgstr ""
#: lazarusidestrconsts:lismenucodetoolsoptions
msgid "CodeTools options"
msgstr ""
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts:lismenuaboutlazarus
msgid "About Lazarus"
msgstr ""
#: lazarusidestrconsts:lismenuonlinehelp
msgid "Online Help"
msgstr ""
#: lazarusidestrconsts:lismenuconfigurehelp
msgid "Configure Help"
msgstr ""
#: lazarusidestrconsts:lismenucontexthelp
msgid "Context sensitive Help"
msgstr ""
#: lazarusidestrconsts:lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr ""
#: lazarusidestrconsts:lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr ""
#: lazarusidestrconsts:lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr ""
#: lazarusidestrconsts:lisdsgselectparentcomponent
msgid "Select parent component"
msgstr ""
#: lazarusidestrconsts:lisdsgordermovetofront
msgid "Move component to front"
msgstr ""
#: lazarusidestrconsts:lisdsgordermovetoback
msgid "Move component to back"
msgstr ""
#: lazarusidestrconsts:lisdsgorderforwardone
msgid "Move component one forward"
msgstr ""
#: lazarusidestrconsts:lisdsgorderbackone
msgid "Move component one back"
msgstr ""
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr ""
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr ""
#: lazarusidestrconsts:liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr ""
#: lazarusidestrconsts:lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr ""
#: lazarusidestrconsts:lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""
#: lazarusidestrconsts:lisdelphiproject
msgid "Delphi project"
msgstr ""
#: lazarusidestrconsts:lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisformaterror
msgid "Format error"
msgstr ""
#: lazarusidestrconsts:lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr ""
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts:liserrorcreatinglrs
msgid "Error creating lrs"
msgstr ""
#: lazarusidestrconsts:lislfmfilenotfound
msgid "LFM file not found"
msgstr ""
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or the units came from a case insensitive file system (windows/Delphi) and are now on a case sensitive filesystem (linux, bsd, macosx). In this case you should abort now, rename the units all lowercase and try again.%s3) Or you can ignore the missing units and continue.%s%sShould the missing units be commented out?"
msgstr ""
#: lazarusidestrconsts:lisunitnotfound
msgid "Unit not found"
msgstr ""
#: lazarusidestrconsts:lisunitsnotfound2
msgid "Units not found"
msgstr ""
#: lazarusidestrconsts:lisunitlfmfile
msgid "Unit: %s%sLFM file: %s"
msgstr ""
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr ""
#: lazarusidestrconsts:lisnotadelphiproject
msgid "Not a Delphi project"
msgstr ""
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr ""
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr ""
#: lazarusidestrconsts:lisresourceloaderror
msgid "Resource load error"
msgstr ""
#: lazarusidestrconsts:lisnoname
msgid "noname"
msgstr ""
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr ""
#: lazarusidestrconsts:lisrenamefile
msgid "Rename file?"
msgstr ""
#: lazarusidestrconsts:listhislookslikeapascalfilefpc10xexpectspascalfiles
msgid "This looks like a pascal file.%sfpc 1.0.x expects pascal files lowercase.%sRename it to lowercase?"
msgstr ""
#: lazarusidestrconsts:lisoverwritefile
msgid "Overwrite file?"
msgstr ""
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr ""
#: lazarusidestrconsts:lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr ""
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr ""
#: lazarusidestrconsts:lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr ""
#: lazarusidestrconsts:lisstreamingerror
msgid "Streaming error"
msgstr ""
#: lazarusidestrconsts:lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr ""
#: lazarusidestrconsts:lisresourcesaveerror
msgid "Resource save error"
msgstr ""
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr ""
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr ""
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr ""
#: lazarusidestrconsts:lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr ""
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr ""
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarus
msgid "The file %s%s%s%sseems to be the program file of an existing lazarus Project1.%sOpen project?%sCancel will load the file as normal source."
msgstr ""
#: lazarusidestrconsts:lisprojectinfofiledetected
msgid "Project info file detected"
msgstr ""
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr ""
#: lazarusidestrconsts:lisprogramdetected
msgid "Program detected"
msgstr ""
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr ""
#: lazarusidestrconsts:lisformloaderror
msgid "Form load error"
msgstr ""
#: lazarusidestrconsts:lissaveprojectlpi
msgid "Save Project %s (*.lpi)"
msgstr ""
#: lazarusidestrconsts:lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr ""
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr ""
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:lischooseadifferentname
msgid "Choose a different name"
msgstr ""
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr ""
#: lazarusidestrconsts:lisunitidentifierexists
msgid "Unit identifier exists"
msgstr ""
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose
msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name"
msgstr ""
#: lazarusidestrconsts:liserrorcreatingfile
msgid "Error creating file"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscopyerror2
msgid "Copy error"
msgstr ""
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr ""
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr ""
#: lazarusidestrconsts:lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts:lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts:lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts:lissourcemodified
msgid "Source modified"
msgstr ""
#: lazarusidestrconsts:lisopenproject
msgid "Open Project?"
msgstr ""
#: lazarusidestrconsts:lisopentheprojectanswernotoloaditasxmlfile
msgid "Open the project %s?%sAnswer No to load it as xml file."
msgstr ""
#: lazarusidestrconsts:lisopenpackage
msgid "Open Package?"
msgstr ""
#: lazarusidestrconsts:lisopenthepackageanswernotoloaditasxmlfile
msgid "Open the package %s?%sAnswer No to load it as xml file."
msgstr ""
#: lazarusidestrconsts:lisrevertfailed
msgid "Revert failed"
msgstr ""
#: lazarusidestrconsts:lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr ""
#: lazarusidestrconsts:lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr ""
#: lazarusidestrconsts:lisfilenottext
msgid "File not text"
msgstr ""
#: lazarusidestrconsts:lisunabletorenamefile
msgid "Unable to rename file"
msgstr ""
#: lazarusidestrconsts:lisunabletocopyfile
msgid "Unable to copy file"
msgstr ""
#: lazarusidestrconsts:lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr ""
#: lazarusidestrconsts:lisinvalidcommand
msgid "Invalid command"
msgstr ""
#: lazarusidestrconsts:listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr ""
#: lazarusidestrconsts:lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr ""
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr ""
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr ""
#: lazarusidestrconsts:liscommandafterinvalid
msgid "Command after invalid"
msgstr ""
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr ""
#: lazarusidestrconsts:liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr ""
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr ""
#: lazarusidestrconsts:lisaddtoproject
msgid "Add %s to project?"
msgstr ""
#: lazarusidestrconsts:listhefile
msgid "The file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr ""
#: lazarusidestrconsts:lisremovefromproject
msgid "Remove from project"
msgstr ""
#: lazarusidestrconsts:liscreateaprojectfirst
msgid "Create a project first!"
msgstr ""
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr ""
#: lazarusidestrconsts:lisbuildnewproject
msgid "Build new project"
msgstr ""
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr ""
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built. :)"
msgstr ""
#: lazarusidestrconsts:lisexecutingcommandbefore
msgid "Executing command befor"
msgstr ""
#: lazarusidestrconsts:lisexecutingcommandafter
msgid "Executing command after"
msgstr ""
#: lazarusidestrconsts:lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr ""
#: lazarusidestrconsts:liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisnotnow
msgid "Not now"
msgstr ""
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr ""
#: lazarusidestrconsts:lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisreaderror
msgid "Read Error"
msgstr ""
#: lazarusidestrconsts:lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr ""
#: lazarusidestrconsts:liswriteerror
msgid "Write Error"
msgstr ""
#: lazarusidestrconsts:lisunabletowritetofile
msgid "Unable to write to file %s%s%s!"
msgstr ""
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway2
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisdeletefilefailed
msgid "Delete file failed"
msgstr ""
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr ""
#: lazarusidestrconsts:lisrenamefilefailed
msgid "Rename file failed"
msgstr ""
#: lazarusidestrconsts:lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr ""
#: lazarusidestrconsts:lisbackupfilefailed
msgid "Backup file failed"
msgstr ""
#: lazarusidestrconsts:lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr ""
#: lazarusidestrconsts:lisfilenotlowercase
msgid "File not lowercase"
msgstr ""
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
msgstr ""
#: lazarusidestrconsts:lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr ""
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr ""
#: lazarusidestrconsts:lislazaruseditorv
msgid "Lazarus Editor v%s"
msgstr ""
#: lazarusidestrconsts:lisnewproject
msgid "%s - (new project)"
msgstr ""
#: lazarusidestrconsts:liscompiling
msgid "%s (compiling ...)"
msgstr ""
#: lazarusidestrconsts:lisdebugging
msgid "%s (debugging ...)"
msgstr ""
#: lazarusidestrconsts:lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files"
msgstr ""
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr ""
#: lazarusidestrconsts:lisclassnotfound
msgid "Class not found"
msgstr ""
#: lazarusidestrconsts:lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr ""
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts:liscontrolneedsparent
msgid "Control needs parent"
msgstr ""
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts:lisconversionerror
msgid "Conversion error"
msgstr ""
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr ""
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr ""
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again."
msgstr ""
#: lazarusidestrconsts:lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr ""
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again."
msgstr ""
#: lazarusidestrconsts:lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr ""
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr ""
#: lazarusidestrconsts:liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr ""
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts:lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr ""
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr ""
#: lazarusidestrconsts:listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr ""
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts:lisseemessages
msgid "See messages."
msgstr ""
#: lazarusidestrconsts:liserror
msgid "Error: "
msgstr ""
#: lazarusidestrconsts:lissavechanges
msgid "Save changes?"
msgstr ""
#: lazarusidestrconsts:lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr ""
#: lazarusidestrconsts:lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr ""
#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage
msgid "Unable to find method. Plz fix the error shown in the message window."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin
msgid "Unable to create new method. Plz fix the error shown in the message window."
msgstr ""
#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage
msgid "Unable to show method. Plz fix the error shown in the message window."
msgstr ""
#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag
msgid "Unable to rename method. Plz fix the error shown in the message window."
msgstr ""
#: lazarusidestrconsts:lisstopdebugging
msgid "Stop Debugging?"
msgstr ""
#: lazarusidestrconsts:lisstopthedebugging
msgid "Stop the debugging?"
msgstr ""
#: lazarusidestrconsts:liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr ""
#: lazarusidestrconsts:lisresourcefilecomment
msgid "This is an automatically generated lazarus resource file"
msgstr ""
#: lazarusidestrconsts:lisopenfile
msgid "Open file"
msgstr ""
#: lazarusidestrconsts:lislazarusfile
msgid "Lazarus File"
msgstr ""
#: lazarusidestrconsts:lispascalunit
msgid "Pascal unit"
msgstr ""
#: lazarusidestrconsts:lispascalsourcefile
msgid "Pascal source file"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr ""
#: lazarusidestrconsts:lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr ""
#: lazarusidestrconsts:lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisopenprojectfile
msgid "Open Project File"
msgstr ""
#: lazarusidestrconsts:lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr ""
#: lazarusidestrconsts:lisallfiles
msgid "All Files"
msgstr ""
#: lazarusidestrconsts:lisopenpackagefile
msgid "Open Package File"
msgstr ""
#: lazarusidestrconsts:lissavespace
msgid "Save "
msgstr ""
#: lazarusidestrconsts:lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr ""
#: lazarusidestrconsts:lischoosedirectory
msgid "Choose directory"
msgstr ""
#: lazarusidestrconsts:lisdestinationdirectory
msgid "Destination directory"
msgstr ""
#: lazarusidestrconsts:liscommandafter
msgid "Command after"
msgstr ""
#: lazarusidestrconsts:lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr ""
#: lazarusidestrconsts:lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr ""
#: lazarusidestrconsts:lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr ""
#: lazarusidestrconsts:lischoosemakepath
msgid "Choose make path"
msgstr ""
#: lazarusidestrconsts:lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr ""
#: lazarusidestrconsts:lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""
#: lazarusidestrconsts:lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr ""
#: lazarusidestrconsts:lisxmlfiles
msgid "XML files"
msgstr ""
#: lazarusidestrconsts:lissavechangestoproject
msgid "Save changes to project %s?"
msgstr ""
#: lazarusidestrconsts:lisprojectchanged
msgid "Project changed"
msgstr ""
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr ""
#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr ""
#: lazarusidestrconsts:liscompilererror
msgid "Compiler error"
msgstr ""
#: lazarusidestrconsts:lisplzcheckthecompilername
msgid "Please check the compiler name"
msgstr ""
#: lazarusidestrconsts:lisaboutlazarus
msgid "About Lazarus"
msgstr ""
#: lazarusidestrconsts:lisversion
msgid "Version"
msgstr ""
#: lazarusidestrconsts:lisdate
msgid "Date"
msgstr ""
#: lazarusidestrconsts:lisclose
msgid "Close"
msgstr ""
#: lazarusidestrconsts:lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers."
msgstr ""
#: lazarusidestrconsts:lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr ""
#: lazarusidestrconsts:lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr ""
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr ""
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr ""
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:liscopyerror
msgid "Copy Error"
msgstr ""
#: lazarusidestrconsts:lishintnewunit
msgid "New Unit"
msgstr ""
#: lazarusidestrconsts:lishintopen
msgid "Open"
msgstr ""
#: lazarusidestrconsts:lishintsave
msgid "Save"
msgstr ""
#: lazarusidestrconsts:lishintsaveall
msgid "Save all"
msgstr ""
#: lazarusidestrconsts:lishintnewform
msgid "New Form"
msgstr ""
#: lazarusidestrconsts:lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr ""
#: lazarusidestrconsts:lishintviewunits
msgid "View Units"
msgstr ""
#: lazarusidestrconsts:lishintviewforms
msgid "View Forms"
msgstr ""
#: lazarusidestrconsts:lishintrun
msgid "Run"
msgstr ""
#: lazarusidestrconsts:lishintpause
msgid "Pause"
msgstr ""
#: lazarusidestrconsts:lishintstepinto
msgid "Step Into"
msgstr ""
#: lazarusidestrconsts:lishintstepover
msgid "Step Over"
msgstr ""
#: lazarusidestrconsts:lisgplnotice
msgid "Copyright (C) <year> <name of author>%sThis program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts:lislgplnotice
msgid "Copyright (C) <year> <name of author>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts:dlgbakdirectory
msgid "(no subdirectoy)"
msgstr ""
#: lazarusidestrconsts:dlgsearchcaption
msgid "Searching..."
msgstr ""
#: lazarusidestrconsts:dlgsearchabort
msgid "Search terminated by user."
msgstr ""
#: lazarusidestrconsts:lissmatches
msgid "Matches"
msgstr ""
#: lazarusidestrconsts:lisssearching
msgid "Searching"
msgstr ""
#: lazarusidestrconsts:lisssearchtext
msgid "Search text"
msgstr ""
#: lazarusidestrconsts:dlgdesktop
msgid "Desktop"
msgstr ""
#: lazarusidestrconsts:dlgwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts:dlgfrmeditor
msgid "Form Editor"
msgstr ""
#: lazarusidestrconsts:dlgobjinsp
msgid "Object Inspector"
msgstr ""
#: lazarusidestrconsts:dlgenvfiles
msgid "Files"
msgstr ""
#: lazarusidestrconsts:lisignorebinaries
msgid "Ignore binaries"
msgstr ""
#: lazarusidestrconsts:lissimplesyntax
msgid "Simple Syntax"
msgstr ""
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr ""
#: lazarusidestrconsts:lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr ""
#: lazarusidestrconsts:lisexcludefilter
msgid "Exclude Filter"
msgstr ""
#: lazarusidestrconsts:lisprojectinformation
msgid "Project Information"
msgstr ""
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr ""
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr ""
#: lazarusidestrconsts:lisuseincludefilter
msgid "Use Include Filter"
msgstr ""
#: lazarusidestrconsts:lisincludefilter
msgid "Include Filter"
msgstr ""
#: lazarusidestrconsts:dlgenvbckup
msgid "Backup"
msgstr ""
#: lazarusidestrconsts:dlgnaming
msgid "Naming"
msgstr ""
#: lazarusidestrconsts:lislazdoc
msgid "LazDoc"
msgstr ""
#: lazarusidestrconsts:dlgcancel
msgid "Cancel"
msgstr ""
#: lazarusidestrconsts:lisa2pcreatenewfile
msgid "Create new file"
msgstr ""
#: lazarusidestrconsts:dlgenvlanguage
msgid "Language"
msgstr ""
#: lazarusidestrconsts:dlgautosave
msgid "Auto save"
msgstr ""
#: lazarusidestrconsts:dlgedfiles
msgid "Editor files"
msgstr ""
#: lazarusidestrconsts:dlgenvproject
msgid "Project"
msgstr ""
#: lazarusidestrconsts:dlgintvinsec
msgid "Interval in secs"
msgstr ""
#: lazarusidestrconsts:dlgdesktopfiles
msgid "Desktop files"
msgstr ""
#: lazarusidestrconsts:dlgsavedfile
msgid "Save desktop settings to file"
msgstr ""
#: lazarusidestrconsts:dlgloaddfile
msgid "Load desktop settings from file"
msgstr ""
#: lazarusidestrconsts:dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr ""
#: lazarusidestrconsts:dlghideideonrun
msgid "Hide IDE windows on run"
msgstr ""
#: lazarusidestrconsts:dlgpalhints
msgid "Hints for component palette"
msgstr ""
#: lazarusidestrconsts:dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr ""
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr ""
#: lazarusidestrconsts:dlgwinpos
msgid "Window Positions"
msgstr ""
#: lazarusidestrconsts:dlgmainmenu
msgid "Main Menu"
msgstr ""
#: lazarusidestrconsts:dlgsrcedit
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts:dlgmsgs
msgid "Messages"
msgstr ""
#: lazarusidestrconsts:dlgprojfiles
msgid "Project files"
msgstr ""
#: lazarusidestrconsts:dlgenvtype
msgid "Type"
msgstr ""
#: lazarusidestrconsts:dlgenvnone
msgid "None"
msgstr ""
#: lazarusidestrconsts:dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr ""
#: lazarusidestrconsts:dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr ""
#: lazarusidestrconsts:dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr ""
#: lazarusidestrconsts:dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr ""
#: lazarusidestrconsts:dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr ""
#: lazarusidestrconsts:dlgedcustomext
msgid "User defined extension"
msgstr ""
#: lazarusidestrconsts:dlgmaxcntr
msgid "Maximum counter"
msgstr ""
#: lazarusidestrconsts:dlgedbsubdir
msgid "Sub directory"
msgstr ""
#: lazarusidestrconsts:dlgenvotherfiles
msgid "Other files"
msgstr ""
#: lazarusidestrconsts:dlgmaxrecentfiles
msgid "Max recent files"
msgstr ""
#: lazarusidestrconsts:dlgmaxrecentprojs
msgid "Max recent project files"
msgstr ""
#: lazarusidestrconsts:dlgqopenlastprj
msgid "Open last project at start"
msgstr ""
#: lazarusidestrconsts:dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr ""
#: lazarusidestrconsts:dlgfpcpath
msgid "Compiler path (%s)"
msgstr ""
#: lazarusidestrconsts:dlgfpcsrcpath
msgid "FPC source directory"
msgstr ""
#: lazarusidestrconsts:dlgmakepath
msgid "Make path"
msgstr ""
#: lazarusidestrconsts:dlgdebugtype
msgid "Debugger type and path"
msgstr ""
#: lazarusidestrconsts:dlgtestprjdir
msgid "Directory for building test projects"
msgstr ""
#: lazarusidestrconsts:dlgqshowgrid
msgid "Show grid"
msgstr ""
#: lazarusidestrconsts:dlggridcolor
msgid "Grid color"
msgstr ""
#: lazarusidestrconsts:dlgqsnaptogrid
msgid "Snap to grid"
msgstr ""
#: lazarusidestrconsts:dlggridx
msgid "Grid size X"
msgstr ""
#: lazarusidestrconsts:dlggridxhint
msgid "Horizontal grid step size"
msgstr ""
#: lazarusidestrconsts:dlggridy
msgid "Grid size Y"
msgstr ""
#: lazarusidestrconsts:dlggridyhint
msgid "Vertical grid step size"
msgstr ""
#: lazarusidestrconsts:dlgguidelines
msgid "Show Guide Lines"
msgstr ""
#: lazarusidestrconsts:dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr ""
#: lazarusidestrconsts:dlglefttopclr
msgid "color for left, top"
msgstr ""
#: lazarusidestrconsts:dlgrightbottomclr
msgid "color for right, bottom"
msgstr ""
#: lazarusidestrconsts:dlgshowcaps
msgid "Show component captions"
msgstr ""
#: lazarusidestrconsts:dlgshowedrhints
msgid "Show editor hints"
msgstr ""
#: lazarusidestrconsts:dlgautoform
msgid "Auto create form when opening unit"
msgstr ""
#: lazarusidestrconsts:dlgrightclickselects
msgid "Right Click selects"
msgstr ""
#: lazarusidestrconsts:dlggrabbercolor
msgid "Grabber color"
msgstr ""
#: lazarusidestrconsts:dlgmarkercolor
msgid "Marker color"
msgstr ""
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr ""
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr ""
#: lazarusidestrconsts:dlgenvgrid
msgid "Grid"
msgstr ""
#: lazarusidestrconsts:dlgenvlguidelines
msgid "Guide lines"
msgstr ""
#: lazarusidestrconsts:dlgenvmisc
msgid "Miscellaneous"
msgstr ""
#: lazarusidestrconsts:dlgruberbandselectioncolor
msgid "Selection"
msgstr ""
#: lazarusidestrconsts:dlgruberbandcreationcolor
msgid "Creation"
msgstr ""
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
msgid "Select grand childs"
msgstr ""
#: lazarusidestrconsts:dlgrubberbandgroup
msgid "Rubber band"
msgstr ""
#: lazarusidestrconsts:dlgpasext
msgid "Default pascal extension"
msgstr ""
#: lazarusidestrconsts:dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr ""
#: lazarusidestrconsts:dlgambigfileact
msgid "Ambiguous file action:"
msgstr ""
#: lazarusidestrconsts:dlgenvask
msgid "Ask"
msgstr ""
#: lazarusidestrconsts:dlgautodel
msgid "Auto delete file"
msgstr ""
#: lazarusidestrconsts:dlgautoren
msgid "Auto rename file lowercase"
msgstr ""
#: lazarusidestrconsts:dlgnoautomaticrenaming
msgid "no automatic renaming"
msgstr ""
#: lazarusidestrconsts:dlgambigwarn
msgid "Warn on compile"
msgstr ""
#: lazarusidestrconsts:dlgignoreverb
msgid "Ignore"
msgstr ""
#: lazarusidestrconsts:dlgbackcolor
msgid "Background"
msgstr ""
#: lazarusidestrconsts:dlgsubpropkcolor
msgid "Subpropertes"
msgstr ""
#: lazarusidestrconsts:dlgreferencecolor
msgid "Reference"
msgstr ""
#: lazarusidestrconsts:dlgvaluecolor
msgid "Value"
msgstr ""
#: lazarusidestrconsts:dlgdefvaluecolor
msgid "Default value"
msgstr ""
#: lazarusidestrconsts:dlgpropnamecolor
msgid "Property name"
msgstr ""
#: lazarusidestrconsts:dlgoimiscellaneous
msgid "Miscellaneous"
msgstr ""
#: lazarusidestrconsts:dlgoiitemheight
msgid "Item height"
msgstr ""
#: lazarusidestrconsts:lisshowhintsinobjectinspector
msgid "Show hints in Object Inspector"
msgstr ""
#: lazarusidestrconsts:dlgenvcolors
msgid "Colors"
msgstr ""
#: lazarusidestrconsts:dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr ""
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr ""
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ."
msgstr ""
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts:dlgeddisplay
msgid "Display"
msgstr ""
#: lazarusidestrconsts:dlgkeymapping
msgid "Key Mappings"
msgstr ""
#: lazarusidestrconsts:dlgedcolor
msgid "Color"
msgstr ""
#: lazarusidestrconsts:dlgkeymappingerrors
msgid "Key mapping errors"
msgstr ""
#: lazarusidestrconsts:dlgedback
msgid "Back"
msgstr ""
#: lazarusidestrconsts:dlgreport
msgid "Report"
msgstr ""
#: lazarusidestrconsts:dlgednoerr
msgid "No errors in key mapping found."
msgstr ""
#: lazarusidestrconsts:dlgdeltemplate
msgid "Delete template "
msgstr ""
#: lazarusidestrconsts:dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr ""
#: lazarusidestrconsts:dlgallfiles
msgid "All files"
msgstr ""
#: lazarusidestrconsts:lislazarusunit
msgid "Lazarus unit"
msgstr ""
#: lazarusidestrconsts:lislazarusproject
msgid "Lazarus project"
msgstr ""
#: lazarusidestrconsts:lislazarusform
msgid "Lazarus form"
msgstr ""
#: lazarusidestrconsts:lislazaruspackage
msgid "Lazarus package"
msgstr ""
#: lazarusidestrconsts:lislazarusprojectsource
msgid "Lazarus project source"
msgstr ""
#: lazarusidestrconsts:dlgaltsetclmode
msgid "Alt-Key sets column mode"
msgstr ""
#: lazarusidestrconsts:dlgautoident
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts:dlgbrachighlight
msgid "Bracket highlighting"
msgstr ""
#: lazarusidestrconsts:dlgdragdroped
msgid "Drag Drop editing"
msgstr ""
#: lazarusidestrconsts:dlgdropfiles
msgid "Drop files"
msgstr ""
#: lazarusidestrconsts:dlghalfpagescroll
msgid "Half page scroll"
msgstr ""
#: lazarusidestrconsts:dlgkeepcaretx
msgid "Keep X caret"
msgstr ""
#: lazarusidestrconsts:dlgpersistentcaret
msgid "Persistent caret"
msgstr ""
#: lazarusidestrconsts:dlgrightmousemovescursor
msgid "Right mouse moves caret"
msgstr ""
#: lazarusidestrconsts:dlgscrollbyoneless
msgid "Scroll by one less"
msgstr ""
#: lazarusidestrconsts:dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr ""
#: lazarusidestrconsts:dlgscrollpastendline
msgid "Scroll past end of line"
msgstr ""
#: lazarusidestrconsts:dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr ""
#: lazarusidestrconsts:dlgshowscrollhint
msgid "Show scroll hint"
msgstr ""
#: lazarusidestrconsts:dlgmouselinks
msgid "Mouse links"
msgstr ""
#: lazarusidestrconsts:dlgshowgutterhints
msgid "Show gutter hints"
msgstr ""
#: lazarusidestrconsts:dlgsmarttabs
msgid "Smart tabs"
msgstr ""
#: lazarusidestrconsts:dlgtabstospaces
msgid "Tabs to spaces"
msgstr ""
#: lazarusidestrconsts:dlgtabindent
msgid "Tab indents blocks"
msgstr ""
#: lazarusidestrconsts:dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr ""
#: lazarusidestrconsts:dlgundoaftersave
msgid "Undo after save"
msgstr ""
#: lazarusidestrconsts:dlgdoubleclickline
msgid "Double click line"
msgstr ""
#: lazarusidestrconsts:dlgfindtextatcursor
msgid "Find text at cursor"
msgstr ""
#: lazarusidestrconsts:dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr ""
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr ""
#: lazarusidestrconsts:dlgblockindent
msgid "Block indent:"
msgstr ""
#: lazarusidestrconsts:dlgundolimit
msgid "Undo limit:"
msgstr ""
#: lazarusidestrconsts:dlgtabwidths
msgid "Tab widths:"
msgstr ""
#: lazarusidestrconsts:dlgmargingutter
msgid "Margin and gutter"
msgstr ""
#: lazarusidestrconsts:dlgvisiblerightmargin
msgid "Visible right margin"
msgstr ""
#: lazarusidestrconsts:dlgvisiblegutter
msgid "Visible gutter"
msgstr ""
#: lazarusidestrconsts:dlgshowlinenumbers
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts:dlgshowcompilinglinenumbers
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts:dlgrightmargin
msgid "Right margin"
msgstr ""
#: lazarusidestrconsts:dlgrightmargincolor
msgid "Right margin color"
msgstr ""
#: lazarusidestrconsts:dlggutterwidth
msgid "Gutter width"
msgstr ""
#: lazarusidestrconsts:dlgguttercolor
msgid "Gutter color"
msgstr ""
#: lazarusidestrconsts:dlgeditorfont
msgid "Editor font"
msgstr ""
#: lazarusidestrconsts:dlgdefaulteditorfont
msgid "Default editor font"
msgstr ""
#: lazarusidestrconsts:dlgeditorfontheight
msgid "Editor font height"
msgstr ""
#: lazarusidestrconsts:dlgextralinespacing
msgid "Extra line spacing"
msgstr ""
#: lazarusidestrconsts:dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr ""
#: lazarusidestrconsts:dlgcheckconsistency
msgid "Check consistency"
msgstr ""
#: lazarusidestrconsts:lisedoptschoosescheme
msgid "Choose Scheme"
msgstr ""
#: lazarusidestrconsts:dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr ""
#: lazarusidestrconsts:dlglang
msgid "Language:"
msgstr ""
#: lazarusidestrconsts:dlgclrscheme
msgid "Color Scheme:"
msgstr ""
#: lazarusidestrconsts:dlgfileexts
msgid "File extensions:"
msgstr ""
#: lazarusidestrconsts:dlgedelement
msgid "Element"
msgstr ""
#: lazarusidestrconsts:dlgsetelementdefault
msgid "Set element to default"
msgstr ""
#: lazarusidestrconsts:dlgsetallelementdefault
msgid "Set all elements to default"
msgstr ""
#: lazarusidestrconsts:dlgforecolor
msgid "Foreground color"
msgstr ""
#: lazarusidestrconsts:dlgedusedefcolor
msgid "Use default color"
msgstr ""
#: lazarusidestrconsts:dlgtextattributes
msgid "Text attributes"
msgstr ""
#: lazarusidestrconsts:dlgedbold
msgid "Bold"
msgstr ""
#: lazarusidestrconsts:dlgedital
msgid "Italic"
msgstr ""
#: lazarusidestrconsts:dlgedunder
msgid "Underline"
msgstr ""
#: lazarusidestrconsts:dlgedidcomlet
msgid "Identifier completion"
msgstr ""
#: lazarusidestrconsts:dlgedcodeparams
msgid "Code parameters"
msgstr ""
#: lazarusidestrconsts:dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr ""
#: lazarusidestrconsts:dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr ""
#: lazarusidestrconsts:dlgeddelay
msgid "Delay"
msgstr ""
#: lazarusidestrconsts:dlgtimesecondunit
msgid "sec"
msgstr ""
#: lazarusidestrconsts:dlgedcodetempl
msgid "Code templates"
msgstr ""
#: lazarusidestrconsts:dlgtplfname
msgid "Template file name"
msgstr ""
#: lazarusidestrconsts:dlgedadd
msgid "Add..."
msgstr ""
#: lazarusidestrconsts:dlgededit
msgid "Edit..."
msgstr ""
#: lazarusidestrconsts:dlgeddelete
msgid "Delete"
msgstr ""
#: lazarusidestrconsts:dlgindentcodeto
msgid "Indent code to"
msgstr ""
#: lazarusidestrconsts:dlgcodetoolstab
msgid "Code Tools"
msgstr ""
#: lazarusidestrconsts:dlgcodetoolsopts
msgid "CodeTools Options"
msgstr ""
#: lazarusidestrconsts:dlgcodecreation
msgid "Code Creation"
msgstr ""
#: lazarusidestrconsts:dlgwordspolicies
msgid "Words"
msgstr ""
#: lazarusidestrconsts:dlglinesplitting
msgid "Line Splitting"
msgstr ""
#: lazarusidestrconsts:dlgspacenotcosmos
msgid "Space"
msgstr ""
#: lazarusidestrconsts:dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr ""
#: lazarusidestrconsts:dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr ""
#: lazarusidestrconsts:dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr ""
#: lazarusidestrconsts:dlgcentercursorline
msgid "Center Cursor Line"
msgstr ""
#: lazarusidestrconsts:dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr ""
#: lazarusidestrconsts:dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr ""
#: lazarusidestrconsts:dlgalphabetically
msgid "Alphabetically"
msgstr ""
#: lazarusidestrconsts:dlgcdtlast
msgid "Last"
msgstr ""
#: lazarusidestrconsts:dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr ""
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr ""
#: lazarusidestrconsts:dlglast
msgid "Last (i.e. at end of source)"
msgstr ""
#: lazarusidestrconsts:dlginfrontofmethods
msgid "In front of methods"
msgstr ""
#: lazarusidestrconsts:dlgbehindmethods
msgid "Behind methods"
msgstr ""
#: lazarusidestrconsts:dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr ""
#: lazarusidestrconsts:dlgmethodinspolicy
msgid "Method insert policy"
msgstr ""
#: lazarusidestrconsts:dlgcdtclassorder
msgid "Class order"
msgstr ""
#: lazarusidestrconsts:dlgkeywordpolicy
msgid "Keyword policy"
msgstr ""
#: lazarusidestrconsts:dlgcdtlower
msgid "lowercase"
msgstr ""
#: lazarusidestrconsts:dlgcdtuppercase
msgid "UPPERCASE"
msgstr ""
#: lazarusidestrconsts:dlg1up2low
msgid "Lowercase, first letter up"
msgstr ""
#: lazarusidestrconsts:dlgidentifierpolicy
msgid "Identifier policy"
msgstr ""
#: lazarusidestrconsts:dlgpropertycompletion
msgid "Property completion"
msgstr ""
#: lazarusidestrconsts:lisheadercommentforclass
msgid "Header comment for class"
msgstr ""
#: lazarusidestrconsts:dlgcompleteproperties
msgid "Complete properties"
msgstr ""
#: lazarusidestrconsts:dlgcdtreadprefix
msgid "Read prefix"
msgstr ""
#: lazarusidestrconsts:dlgcdtwriteprefix
msgid "Write prefix"
msgstr ""
#: lazarusidestrconsts:dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr ""
#: lazarusidestrconsts:dlgcdtvariableprefix
msgid "Variable prefix"
msgstr ""
#: lazarusidestrconsts:dlgsetpropertyvariable
msgid "Set property Variable"
msgstr ""
#: lazarusidestrconsts:dlgmaxlinelength
msgid "Max line length:"
msgstr ""
#: lazarusidestrconsts:dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr ""
#: lazarusidestrconsts:dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr ""
#: lazarusidestrconsts:dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr ""
#: lazarusidestrconsts:dlginsspacefront
msgid "Insert space in front of"
msgstr ""
#: lazarusidestrconsts:dlginsspaceafter
msgid "Insert space after"
msgstr ""
#: lazarusidestrconsts:dlgwrdpreview
msgid "Preview"
msgstr ""
#: lazarusidestrconsts:locwndsrceditor
msgid "Lazarus Source Editor"
msgstr ""
#: lazarusidestrconsts:dlgcompileroptions
msgid "Compiler Options"
msgstr ""
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr ""
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr ""
#: lazarusidestrconsts:dlgsearchpaths
msgid "Paths"
msgstr ""
#: lazarusidestrconsts:dlgcoparsing
msgid "Parsing"
msgstr ""
#: lazarusidestrconsts:dlgcodegeneration
msgid "Code"
msgstr ""
#: lazarusidestrconsts:dlgcolinking
msgid "Linking"
msgstr ""
#: lazarusidestrconsts:dlgcomessages
msgid "Messages"
msgstr ""
#: lazarusidestrconsts:dlgcoother
msgid "Other"
msgstr ""
#: lazarusidestrconsts:dlgcoinherited
msgid "Inherited"
msgstr ""
#: lazarusidestrconsts:dlgcocompilation
msgid "Compilation"
msgstr ""
#: lazarusidestrconsts:lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr ""
#: lazarusidestrconsts:lisunitoutputdirectory
msgid "Unit Output directory"
msgstr ""
#: lazarusidestrconsts:lisselectanode
msgid "Select a node"
msgstr ""
#: lazarusidestrconsts:dlgshowcompileroptions
msgid "Show compiler options"
msgstr ""
#: lazarusidestrconsts:dlgcoopts
msgid "Options: "
msgstr ""
#: lazarusidestrconsts:dlgcostyle
msgid "Style:"
msgstr ""
#: lazarusidestrconsts:lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr ""
#: lazarusidestrconsts:lisunitpath
msgid "unit path"
msgstr ""
#: lazarusidestrconsts:lisincludepath
msgid "include path"
msgstr ""
#: lazarusidestrconsts:lisobjectpath
msgid "object path"
msgstr ""
#: lazarusidestrconsts:lislibrarypath
msgid "library path"
msgstr ""
#: lazarusidestrconsts:lislinkeroptions
msgid "linker options"
msgstr ""
#: lazarusidestrconsts:liscustomoptions
msgid "custom options"
msgstr ""
#: lazarusidestrconsts:dlgcoasis
msgid "As-Is"
msgstr ""
#: lazarusidestrconsts:dlgsyntaxoptions
msgid "Syntax options"
msgstr ""
#: lazarusidestrconsts:dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr ""
#: lazarusidestrconsts:dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr ""
#: lazarusidestrconsts:dlgassertcode
msgid "Include Assertion Code"
msgstr ""
#: lazarusidestrconsts:dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr ""
#: lazarusidestrconsts:dlgcppinline
msgid "C++ Styled INLINE"
msgstr ""
#: lazarusidestrconsts:dlgcmacro
msgid "C Style Macros (global)"
msgstr ""
#: lazarusidestrconsts:dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr ""
#: lazarusidestrconsts:dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr ""
#: lazarusidestrconsts:dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr ""
#: lazarusidestrconsts:dlgdeplhicomp
msgid "Delphi Compatible"
msgstr ""
#: lazarusidestrconsts:dlgcoansistr
msgid "Use Ansi Strings"
msgstr ""
#: lazarusidestrconsts:dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr ""
#: lazarusidestrconsts:dlgcounitstyle
msgid "Unit Style:"
msgstr ""
#: lazarusidestrconsts:dlgcosmartlinkable
msgid "Smart Linkable"
msgstr ""
#: lazarusidestrconsts:dlgcochecks
msgid "Checks:"
msgstr ""
#: lazarusidestrconsts:dlgcorange
msgid "Range"
msgstr ""
#: lazarusidestrconsts:dlgcooverflow
msgid "Overflow"
msgstr ""
#: lazarusidestrconsts:dlgcostack
msgid "Stack"
msgstr ""
#: lazarusidestrconsts:dlgheapsize
msgid "Heap Size"
msgstr ""
#: lazarusidestrconsts:dlgcogenerate
msgid "Generate:"
msgstr ""
#: lazarusidestrconsts:dlgconormal
msgid "Normal Code"
msgstr ""
#: lazarusidestrconsts:dlgcofast
msgid "Faster Code"
msgstr ""
#: lazarusidestrconsts:dlgcosmaller
msgid "Smaller Code"
msgstr ""
#: lazarusidestrconsts:dlgtargetproc
msgid "Target Processor:"
msgstr ""
#: lazarusidestrconsts:dlgoptimiz
msgid "Optimizations:"
msgstr ""
#: lazarusidestrconsts:dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr ""
#: lazarusidestrconsts:dlguncertopt
msgid "Uncertain Optimizations"
msgstr ""
#: lazarusidestrconsts:dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr ""
#: lazarusidestrconsts:dlglevel1opt
msgid "Level 1 (Quick Optimizations)"
msgstr ""
#: lazarusidestrconsts:dlglevel2opt
msgid "Level 2 (Level 1 + Slower Optimizations)"
msgstr ""
#: lazarusidestrconsts:dlglevel3opt
msgid "Level 3 (Level 2 + Uncertain)"
msgstr ""
#: lazarusidestrconsts:dlgtargetos
msgid "Target OS"
msgstr ""
#: lazarusidestrconsts:dlgcodebugging
msgid "Debugging:"
msgstr ""
#: lazarusidestrconsts:dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr ""
#: lazarusidestrconsts:dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr ""
#: lazarusidestrconsts:dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr ""
#: lazarusidestrconsts:dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr ""
#: lazarusidestrconsts:dlgcovalgrind
msgid "Generate code for valgrind"
msgstr ""
#: lazarusidestrconsts:dlggprof
msgid "Generate code for gprof"
msgstr ""
#: lazarusidestrconsts:dlgcostrip
msgid "Strip Symbols From Executable"
msgstr ""
#: lazarusidestrconsts:dlglinklibraries
msgid "Link Style:"
msgstr ""
#: lazarusidestrconsts:dlglinksmart
msgid "Link Smart"
msgstr ""
#: lazarusidestrconsts:dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr ""
#: lazarusidestrconsts:liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr ""
#: lazarusidestrconsts:dlgverbosity
msgid "Verbosity during compilation:"
msgstr ""
#: lazarusidestrconsts:dlgcoshowerr
msgid "Show Errors"
msgstr ""
#: lazarusidestrconsts:dlgshowwarnings
msgid "Show Warnings"
msgstr ""
#: lazarusidestrconsts:dlgshownotes
msgid "Show Notes"
msgstr ""
#: lazarusidestrconsts:dlgshowhint
msgid "Show Hints"
msgstr ""
#: lazarusidestrconsts:dlgshowgeneralinfo
msgid "Show general info"
msgstr ""
#: lazarusidestrconsts:dlgshowprocserror
msgid "Show all procs on error"
msgstr ""
#: lazarusidestrconsts:dlgshoweverything
msgid "Show everything"
msgstr ""
#: lazarusidestrconsts:dlgshowsummary
msgid "Show summary"
msgstr ""
#: lazarusidestrconsts:dlgshowdebuginfo
msgid "Show debug info"
msgstr ""
#: lazarusidestrconsts:dlgshowusedfiles
msgid "Show used files"
msgstr ""
#: lazarusidestrconsts:dlgshowtriedfiles
msgid "Show tried files"
msgstr ""
#: lazarusidestrconsts:dlgshowdefinedmacros
msgid "Show defined macros"
msgstr ""
#: lazarusidestrconsts:dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr ""
#: lazarusidestrconsts:dlgshowconditionals
msgid "Show conditionals"
msgstr ""
#: lazarusidestrconsts:dlgshownothing
msgid "Show nothing (only errors)"
msgstr ""
#: lazarusidestrconsts:dlgwritefpclogo
msgid "Write an FPC logo"
msgstr ""
#: lazarusidestrconsts:dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr ""
#: lazarusidestrconsts:dlgconfigfiles
msgid "Config Files:"
msgstr ""
#: lazarusidestrconsts:dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr ""
#: lazarusidestrconsts:dlgusecustomconfig
msgid "Use addional Compiler Config File"
msgstr ""
#: lazarusidestrconsts:liscustomoptions2
msgid "Custom options"
msgstr ""
#: lazarusidestrconsts:dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr ""
#: lazarusidestrconsts:dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr ""
#: lazarusidestrconsts:dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr ""
#: lazarusidestrconsts:dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr ""
#: lazarusidestrconsts:dlgcolibraries
msgid "Libraries (-Fl):"
msgstr ""
#: lazarusidestrconsts:dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr ""
#: lazarusidestrconsts:liscompiler
msgid "Compiler"
msgstr ""
#: lazarusidestrconsts:listofpcpath
msgid "Path:"
msgstr ""
#: lazarusidestrconsts:liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr ""
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr ""
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr ""
#: lazarusidestrconsts:liscoclickokifaresuretodothat
msgid "%s%sClick OK if are sure to do that."
msgstr ""
#: lazarusidestrconsts:liscocallon
msgid "Call on:"
msgstr ""
#: lazarusidestrconsts:liscocalloncompile
msgid "Compile"
msgstr ""
#: lazarusidestrconsts:liscocallonbuild
msgid "Build"
msgstr ""
#: lazarusidestrconsts:liscocallonrun
msgid "Run"
msgstr ""
#: lazarusidestrconsts:liscoexecuteafter
msgid "Execute after"
msgstr ""
#: lazarusidestrconsts:liscoexecutebefore
msgid "Execute before"
msgstr ""
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr ""
#: lazarusidestrconsts:liscocommand
msgid "Command:"
msgstr ""
#: lazarusidestrconsts:liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr ""
#: lazarusidestrconsts:liscoscanformakemessages
msgid "Scan for Make messages"
msgstr ""
#: lazarusidestrconsts:liscoshowallmessages
msgid "Show all messages"
msgstr ""
#: lazarusidestrconsts:dlgunitoutp
msgid "Unit output directory (-FE):"
msgstr ""
#: lazarusidestrconsts:liscodefault
msgid "default (%s)"
msgstr ""
#: lazarusidestrconsts:dlgbutapply
msgid "Apply"
msgstr ""
#: lazarusidestrconsts:dlgcoshowoptions
msgid "Show Options"
msgstr ""
#: lazarusidestrconsts:dlgcoloadsave
msgid "Load/Save"
msgstr ""
#: lazarusidestrconsts:dlgmainviewforms
msgid "View project forms"
msgstr ""
#: lazarusidestrconsts:dlgmainviewunits
msgid "View project units"
msgstr ""
#: lazarusidestrconsts:dlgmulti
msgid "Multi"
msgstr ""
#: lazarusidestrconsts:dlgprojectoptions
msgid "Project Options"
msgstr ""
#: lazarusidestrconsts:dlgpoapplication
msgid "Application"
msgstr ""
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts:dlgpofroms
msgid "Forms"
msgstr ""
#: lazarusidestrconsts:dlgpomisc
msgid "Miscellaneous"
msgstr ""
#: lazarusidestrconsts:dlgapplicationsettings
msgid "Application Settings"
msgstr ""
#: lazarusidestrconsts:dlgpotitle
msgid "Title:"
msgstr ""
#: lazarusidestrconsts:dlgpooutputsettings
msgid "Output Settings"
msgstr ""
#: lazarusidestrconsts:dlgpotargetfilename
msgid "Target file name:"
msgstr ""
#: lazarusidestrconsts:dlgautocreateforms
msgid "Auto-create forms:"
msgstr ""
#: lazarusidestrconsts:dlgavailableforms
msgid "Available forms:"
msgstr ""
#: lazarusidestrconsts:dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr ""
#: lazarusidestrconsts:dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr ""
#: lazarusidestrconsts:dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr ""
#: lazarusidestrconsts:lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr ""
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr ""
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr ""
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr ""
#: lazarusidestrconsts:lisprojectisrunnable
msgid "Project is runnable"
msgstr ""
#: lazarusidestrconsts:dlgrunparameters
msgid "Run parameters"
msgstr ""
#: lazarusidestrconsts:dlgrunolocal
msgid "Local"
msgstr ""
#: lazarusidestrconsts:dlgrunoenvironment
msgid "Environment"
msgstr ""
#: lazarusidestrconsts:dlghostapplication
msgid "Host application"
msgstr ""
#: lazarusidestrconsts:dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr ""
#: lazarusidestrconsts:dlguselaunchingapp
msgid "Use launching application"
msgstr ""
#: lazarusidestrconsts:dlgroworkingdirectory
msgid "Working directory"
msgstr ""
#: lazarusidestrconsts:dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr ""
#: lazarusidestrconsts:dlgrunousedisplay
msgid "Use display"
msgstr ""
#: lazarusidestrconsts:dlgrunosystemvariables
msgid "System variables"
msgstr ""
#: lazarusidestrconsts:dlgrunovariable
msgid "Variable"
msgstr ""
#: lazarusidestrconsts:dlgrunovalue
msgid "Value"
msgstr ""
#: lazarusidestrconsts:dlgrunouseroverrides
msgid "User overrides"
msgstr ""
#: lazarusidestrconsts:dlgincludesystemvariables
msgid "Include system variables"
msgstr ""
#: lazarusidestrconsts:dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr ""
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr ""
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr ""
#: lazarusidestrconsts:dlgthedirectory
msgid "The directory \""
msgstr ""
#: lazarusidestrconsts:dlgdoesnotexist
msgid "\" does not exist."
msgstr ""
#: lazarusidestrconsts:dlgtexttofing
msgid "&Text to Find"
msgstr ""
#: lazarusidestrconsts:dlgreplacewith
msgid "&Replace With"
msgstr ""
#: lazarusidestrconsts:dlgfropts
msgid "Options"
msgstr ""
#: lazarusidestrconsts:dlgcasesensitive
msgid "Case Sensitive"
msgstr ""
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr ""
#: lazarusidestrconsts:dlgwholewordsonly
msgid "Whole Words Only"
msgstr ""
#: lazarusidestrconsts:lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr ""
#: lazarusidestrconsts:dlgregularexpressions
msgid "Regular Expressions"
msgstr ""
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr ""
#: lazarusidestrconsts:dlgmultiline
msgid "Multi Line"
msgstr ""
#: lazarusidestrconsts:lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr ""
#: lazarusidestrconsts:dlgpromptonreplace
msgid "Prompt On Replace"
msgstr ""
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr ""
#: lazarusidestrconsts:dlgsrorigin
msgid "Origin"
msgstr ""
#: lazarusidestrconsts:dlgfromcursor
msgid "From Cursor"
msgstr ""
#: lazarusidestrconsts:dlgentirescope
msgid "Entire Scope"
msgstr ""
#: lazarusidestrconsts:dlgscope
msgid "Scope"
msgstr ""
#: lazarusidestrconsts:lisfriincurrentunit
msgid "in current unit"
msgstr ""
#: lazarusidestrconsts:lisfriinmainproject
msgid "in main project"
msgstr ""
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr ""
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr ""
#: lazarusidestrconsts:lisfrirenameallreferences
msgid "Rename all References"
msgstr ""
#: lazarusidestrconsts:dlgglobal
msgid "Global"
msgstr ""
#: lazarusidestrconsts:dlgselectedtext
msgid "Selected Text"
msgstr ""
#: lazarusidestrconsts:dlgdirection
msgid "Direction"
msgstr ""
#: lazarusidestrconsts:lisfrforwardsearch
msgid "Forward search"
msgstr ""
#: lazarusidestrconsts:lisfrbackwardsearch
msgid "Backward search"
msgstr ""
#: lazarusidestrconsts:dlgupword
msgid "Up"
msgstr ""
#: lazarusidestrconsts:dlgdownword
msgid "Down"
msgstr ""
#: lazarusidestrconsts:dlgreplaceall
msgid "Replace All"
msgstr ""
#: lazarusidestrconsts:dlggetposition
msgid "Get position"
msgstr ""
#: lazarusidestrconsts:dlgleftpos
msgid "Left:"
msgstr ""
#: lazarusidestrconsts:dlgwidthpos
msgid "Width:"
msgstr ""
#: lazarusidestrconsts:dlgtoppos
msgid "Top:"
msgstr ""
#: lazarusidestrconsts:dlgheightpos
msgid "Height:"
msgstr ""
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr ""
#: lazarusidestrconsts:rsiwpdefault
msgid "Default"
msgstr ""
#: lazarusidestrconsts:rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr ""
#: lazarusidestrconsts:rsiwpdocked
msgid "Docked"
msgstr ""
#: lazarusidestrconsts:rsiwpcustomposition
msgid "Custom position"
msgstr ""
#: lazarusidestrconsts:rsiwprestorewindowsize
msgid "Restore window size"
msgstr ""
#: lazarusidestrconsts:liscodeexplorer
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts:uemfinddeclaration
msgid "&Find Declaration"
msgstr ""
#: lazarusidestrconsts:uemopenfileatcursor
msgid "&Open file at cursor"
msgstr ""
#: lazarusidestrconsts:uemclosepage
msgid "&Close Page"
msgstr ""
#: lazarusidestrconsts:uemcut
msgid "Cut"
msgstr ""
#: lazarusidestrconsts:uemcopy
msgid "Copy"
msgstr ""
#: lazarusidestrconsts:uempaste
msgid "Paste"
msgstr ""
#: lazarusidestrconsts:uemgotobookmark
msgid "&Goto Bookmark"
msgstr ""
#: lazarusidestrconsts:uemsetfreebookmark
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts:uemnextbookmark
msgid "Goto next Bookmark"
msgstr ""
#: lazarusidestrconsts:uemprevbookmark
msgid "Goto previous Bookmark"
msgstr ""
#: lazarusidestrconsts:uembookmarkn
msgid "Bookmark"
msgstr ""
#: lazarusidestrconsts:lisopenlfm
msgid "Open %s"
msgstr ""
#: lazarusidestrconsts:uemsetbookmark
msgid "&Set Bookmark"
msgstr ""
#: lazarusidestrconsts:uemreadonly
msgid "Read Only"
msgstr ""
#: lazarusidestrconsts:uemshowlinenumbers
msgid "Show Line Numbers"
msgstr ""
#: lazarusidestrconsts:uemshowunitinfo
msgid "Unit Info"
msgstr ""
#: lazarusidestrconsts:uemdebugword
msgid "Debug"
msgstr ""
#: lazarusidestrconsts:uemaddbreakpoint
msgid "&Add Breakpoint"
msgstr ""
#: lazarusidestrconsts:uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr ""
#: lazarusidestrconsts:uemruntocursor
msgid "&Run to Cursor"
msgstr ""
#: lazarusidestrconsts:uemviewcallstack
msgid "View Call Stack"
msgstr ""
#: lazarusidestrconsts:uemmoveeditorleft
msgid "Move Editor Left"
msgstr ""
#: lazarusidestrconsts:uemmoveeditorright
msgid "Move Editor Right"
msgstr ""
#: lazarusidestrconsts:uemrefactor
msgid "Refactoring"
msgstr ""
#: lazarusidestrconsts:uemcompletecode
msgid "Complete Code"
msgstr ""
#: lazarusidestrconsts:uemencloseselection
msgid "Enclose Selection"
msgstr ""
#: lazarusidestrconsts:uemextractproc
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts:ueminvertassignment
msgid "Invert Assignment"
msgstr ""
#: lazarusidestrconsts:uemfindidentifierreferences
msgid "Find Identifier References"
msgstr ""
#: lazarusidestrconsts:uemrenameidentifier
msgid "Rename Identifier"
msgstr ""
#: lazarusidestrconsts:uemeditorproperties
msgid "Editor properties"
msgstr ""
#: lazarusidestrconsts:uenotimplcap
msgid "Not implemented yet"
msgstr ""
#: lazarusidestrconsts:uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr ""
#: lazarusidestrconsts:uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr ""
#: lazarusidestrconsts:uefilerocap
msgid "File is readonly"
msgstr ""
#: lazarusidestrconsts:uefilerotext1
msgid "The file \""
msgstr ""
#: lazarusidestrconsts:uefilerotext2
msgid "\" is not writable."
msgstr ""
#: lazarusidestrconsts:uemodified
msgid "Modified"
msgstr ""
#: lazarusidestrconsts:uepreadonly
msgid "Readonly"
msgstr ""
#: lazarusidestrconsts:uepins
msgid "INS"
msgstr ""
#: lazarusidestrconsts:uepovr
msgid "OVR"
msgstr ""
#: lazarusidestrconsts:fdinvalidmutliselectioncap
msgid "Invalid mutliselection"
msgstr ""
#: lazarusidestrconsts:lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr ""
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr ""
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr ""
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr ""
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr ""
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr ""
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorin
msgid "Error in %s"
msgstr ""
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%shas created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:fdinvalidmutliselectiontext
msgid "Multiselected components must be of a single form."
msgstr ""
#: lazarusidestrconsts:lisinvaliddelete
msgid "Invalid delete"
msgstr ""
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr ""
#: lazarusidestrconsts:fdmalignword
msgid "Align"
msgstr ""
#: lazarusidestrconsts:fdmmirrorhorizontal
msgid "Mirror horizontal"
msgstr ""
#: lazarusidestrconsts:fdmmirrorvertical
msgid "Mirror vertical"
msgstr ""
#: lazarusidestrconsts:fdmscaleword
msgid "Scale"
msgstr ""
#: lazarusidestrconsts:fdmsizeword
msgid "Size"
msgstr ""
#: lazarusidestrconsts:fdmtaborder
msgid "Tab order..."
msgstr ""
#: lazarusidestrconsts:fdmorder
msgid "Order"
msgstr ""
#: lazarusidestrconsts:fdmordermovetofront
msgid "Move to front"
msgstr ""
#: lazarusidestrconsts:fdmordermovetoback
msgid "Move to back"
msgstr ""
#: lazarusidestrconsts:fdmorderforwardone
msgid "Forward one"
msgstr ""
#: lazarusidestrconsts:fdmorderbackone
msgid "Back one"
msgstr ""
#: lazarusidestrconsts:fdmdeleteselection
msgid "Delete selection"
msgstr ""
#: lazarusidestrconsts:lischangeclass
msgid "Change Class"
msgstr ""
#: lazarusidestrconsts:fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr ""
#: lazarusidestrconsts:lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr ""
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr ""
#: lazarusidestrconsts:fdmshowoptions
msgid "Show Options for form editing"
msgstr ""
#: lazarusidestrconsts:srkmeditkeys
msgid "Edit Keys"
msgstr ""
#: lazarusidestrconsts:srkmcommand
msgid "Command "
msgstr ""
#: lazarusidestrconsts:srkmconflic
msgid "Conflict "
msgstr ""
#: lazarusidestrconsts:srkmconflicw
msgid " conflicts with "
msgstr ""
#: lazarusidestrconsts:srkmcommand1
msgid " command1 \""
msgstr ""
#: lazarusidestrconsts:srkmcommand2
msgid " command2 \""
msgstr ""
#: lazarusidestrconsts:srkmeditforcmd
msgid "Edit keys for command"
msgstr ""
#: lazarusidestrconsts:srkmkey
msgid "Key"
msgstr ""
#: lazarusidestrconsts:srkmgrabkey
msgid "Grab Key"
msgstr ""
#: lazarusidestrconsts:srkmpresskey
msgid "Please press a key ..."
msgstr ""
#: lazarusidestrconsts:srkmalternkey
msgid "Alternative Key"
msgstr ""
#: lazarusidestrconsts:srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr ""
#: lazarusidestrconsts:srkmecwordleft
msgid "Move cursor word left"
msgstr ""
#: lazarusidestrconsts:srkmecwordright
msgid "Move cursor word right"
msgstr ""
#: lazarusidestrconsts:srkmeclinestart
msgid "Move cursor to line start"
msgstr ""
#: lazarusidestrconsts:srkmeclineend
msgid "Move cursor to line end"
msgstr ""
#: lazarusidestrconsts:srkmecpageup
msgid "Move cursor up one page"
msgstr ""
#: lazarusidestrconsts:srkmecpagedown
msgid "Move cursor down one page"
msgstr ""
#: lazarusidestrconsts:srkmecpageleft
msgid "Move cursor left one page"
msgstr ""
#: lazarusidestrconsts:srkmecpageright
msgid "Move cursor right one page"
msgstr ""
#: lazarusidestrconsts:srkmecpagetop
msgid "Move cursor to top of page"
msgstr ""
#: lazarusidestrconsts:srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr ""
#: lazarusidestrconsts:srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr ""
#: lazarusidestrconsts:srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr ""
#: lazarusidestrconsts:srkmecgotoxy
msgid "Goto XY"
msgstr ""
#: lazarusidestrconsts:srkmecselleft
msgid "SelLeft"
msgstr ""
#: lazarusidestrconsts:srkmecselright
msgid "SelRight"
msgstr ""
#: lazarusidestrconsts:srkmecselup
msgid "Select Up"
msgstr ""
#: lazarusidestrconsts:srkmecseldown
msgid "Select Down"
msgstr ""
#: lazarusidestrconsts:srkmecselwordleft
msgid "Select Word Left"
msgstr ""
#: lazarusidestrconsts:srkmecselwordright
msgid "Select Word Right"
msgstr ""
#: lazarusidestrconsts:srkmecsellinestart
msgid "Select Line Start"
msgstr ""
#: lazarusidestrconsts:srkmecsellineend
msgid "Select Line End"
msgstr ""
#: lazarusidestrconsts:srkmecselpageup
msgid "Select Page Up"
msgstr ""
#: lazarusidestrconsts:srkmecselpagedown
msgid "Select Page Down"
msgstr ""
#: lazarusidestrconsts:srkmecselpageleft
msgid "Select Page Left"
msgstr ""
#: lazarusidestrconsts:srkmecselpageright
msgid "Select Page Right"
msgstr ""
#: lazarusidestrconsts:srkmecselpagetop
msgid "Select Page Top"
msgstr ""
#: lazarusidestrconsts:srkmecselpagebottom
msgid "Select Page Bottom"
msgstr ""
#: lazarusidestrconsts:srkmecseleditortop
msgid "Select to absolute beginning"
msgstr ""
#: lazarusidestrconsts:srkmecseleditorbottom
msgid "Select to absolute end"
msgstr ""
#: lazarusidestrconsts:srkmecselgotoxy
msgid "Select Goto XY"
msgstr ""
#: lazarusidestrconsts:srkmecselectall
msgid "Select All"
msgstr ""
#: lazarusidestrconsts:srkmecdeletelastchar
msgid "Delete Last Char"
msgstr ""
#: lazarusidestrconsts:srkmecdeletechar
msgid "Delete char at cursor"
msgstr ""
#: lazarusidestrconsts:srkmecdeleteword
msgid "Delete to end of word"
msgstr ""
#: lazarusidestrconsts:srkmecdeletelastword
msgid "Delete to start of word"
msgstr ""
#: lazarusidestrconsts:srkmecdeletebol
msgid "Delete to beginning of line"
msgstr ""
#: lazarusidestrconsts:srkmecdeleteeol
msgid "Delete to end of line"
msgstr ""
#: lazarusidestrconsts:srkmecdeleteline
msgid "Delete current line"
msgstr ""
#: lazarusidestrconsts:srkmecclearall
msgid "Delete whole text"
msgstr ""
#: lazarusidestrconsts:srkmeclinebreak
msgid "Break line and move cursor"
msgstr ""
#: lazarusidestrconsts:srkmecinsertline
msgid "Break line, leave cursor"
msgstr ""
#: lazarusidestrconsts:srkmecchar
msgid "Char"
msgstr ""
#: lazarusidestrconsts:srkmecimestr
msgid "Ime Str"
msgstr ""
#: lazarusidestrconsts:srkmeccut
msgid "Cut selection to clipboard"
msgstr ""
#: lazarusidestrconsts:srkmeccopy
msgid "Copy selection to clipboard"
msgstr ""
#: lazarusidestrconsts:srkmecpaste
msgid "Paste clipboard to current position"
msgstr ""
#: lazarusidestrconsts:srkmecscrollup
msgid "Scroll up one line"
msgstr ""
#: lazarusidestrconsts:srkmecscrolldown
msgid "Scroll down one line"
msgstr ""
#: lazarusidestrconsts:srkmecscrollleft
msgid "Scroll left one char"
msgstr ""
#: lazarusidestrconsts:srkmecscrollright
msgid "Scroll right one char"
msgstr ""
#: lazarusidestrconsts:srkmecinsertmode
msgid "Insert Mode"
msgstr ""
#: lazarusidestrconsts:srkmecoverwritemode
msgid "Overwrite Mode"
msgstr ""
#: lazarusidestrconsts:srkmectogglemode
msgid "Toggle Mode"
msgstr ""
#: lazarusidestrconsts:srkmecblockindent
msgid "Indent block"
msgstr ""
#: lazarusidestrconsts:srkmecblockunindent
msgid "Unindent block"
msgstr ""
#: lazarusidestrconsts:srkmecshifttab
msgid "Shift Tab"
msgstr ""
#: lazarusidestrconsts:srkmecmatchbracket
msgid "Go to matching bracket"
msgstr ""
#: lazarusidestrconsts:srkmecnormalselect
msgid "Normal selection mode"
msgstr ""
#: lazarusidestrconsts:srkmeccolumnselect
msgid "Column selection mode"
msgstr ""
#: lazarusidestrconsts:srkmeclineselect
msgid "Line selection mode"
msgstr ""
#: lazarusidestrconsts:srkmecautocompletion
msgid "Code template completion"
msgstr ""
#: lazarusidestrconsts:srkmecuserfirst
msgid "User First"
msgstr ""
#: lazarusidestrconsts:srkmecsetfreebookmark
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts:srkmecprevbookmark
msgid "Previous Bookmark"
msgstr ""
#: lazarusidestrconsts:srkmecnextbookmark
msgid "Next Bookmark"
msgstr ""
#: lazarusidestrconsts:srkmecgotomarker
msgid "Go to Marker %d"
msgstr ""
#: lazarusidestrconsts:srkmecsetmarker
msgid "Set Marker %d"
msgstr ""
#: lazarusidestrconsts:srkmecjumptoeditor
msgid "Focus to source editor"
msgstr ""
#: lazarusidestrconsts:srkmecnexteditor
msgid "Go to next editor"
msgstr ""
#: lazarusidestrconsts:srkmecpreveditor
msgid "Go to prior editor"
msgstr ""
#: lazarusidestrconsts:srkmecmoveeditorleft
msgid "Move editor left"
msgstr ""
#: lazarusidestrconsts:srkmecmoveeditorright
msgid "Move editor right"
msgstr ""
#: lazarusidestrconsts:srkmecgotoeditor
msgid "Go to editor %d"
msgstr ""
#: lazarusidestrconsts:srkmecnew
msgid "New"
msgstr ""
#: lazarusidestrconsts:srkmecnewunit
msgid "New unit"
msgstr ""
#: lazarusidestrconsts:srkmecnewform
msgid "New form"
msgstr ""
#: lazarusidestrconsts:srkmecsaveas
msgid "Save as"
msgstr ""
#: lazarusidestrconsts:srkmecsaveall
msgid "Save all"
msgstr ""
#: lazarusidestrconsts:srkmeccloseall
msgid "Close all"
msgstr ""
#: lazarusidestrconsts:srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr ""
#: lazarusidestrconsts:srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr ""
#: lazarusidestrconsts:srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr ""
#: lazarusidestrconsts:srkmecinsertusername
msgid "Insert current username"
msgstr ""
#: lazarusidestrconsts:srkmecinsertdatetime
msgid "Insert current date and time"
msgstr ""
#: lazarusidestrconsts:srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr ""
#: lazarusidestrconsts:srkmecfind
msgid "Find text"
msgstr ""
#: lazarusidestrconsts:srkmecfindnext
msgid "Find next"
msgstr ""
#: lazarusidestrconsts:srkmecfindprevious
msgid "Find previous"
msgstr ""
#: lazarusidestrconsts:srkmecfindinfiles
msgid "Find in files"
msgstr ""
#: lazarusidestrconsts:srkmecreplace
msgid "Replace text"
msgstr ""
#: lazarusidestrconsts:srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr ""
#: lazarusidestrconsts:srkmecfindproceduremethod
msgid "Find procedure method"
msgstr ""
#: lazarusidestrconsts:srkmecgotolinenumber
msgid "Go to line number"
msgstr ""
#: lazarusidestrconsts:srkmecaddjumppoint
msgid "Add jump point"
msgstr ""
#: lazarusidestrconsts:srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr ""
#: lazarusidestrconsts:srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr ""
#: lazarusidestrconsts:srkmectoggleformunit
msgid "Switch between form and unit"
msgstr ""
#: lazarusidestrconsts:srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr ""
#: lazarusidestrconsts:srkmectogglesourceeditor
msgid "View Source Editor"
msgstr ""
#: lazarusidestrconsts:srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr ""
#: lazarusidestrconsts:srkmectogglemessages
msgid "View messages"
msgstr ""
#: lazarusidestrconsts:srkmectogglesearchresults
msgid "View Search Results"
msgstr ""
#: lazarusidestrconsts:srkmectogglewatches
msgid "View watches"
msgstr ""
#: lazarusidestrconsts:srkmectogglebreakpoints
msgid "View breakpoints"
msgstr ""
#: lazarusidestrconsts:srkmectoggledebuggerout
msgid "View debugger output"
msgstr ""
#: lazarusidestrconsts:srkmectogglelocals
msgid "View local variables"
msgstr ""
#: lazarusidestrconsts:srkmectogglecallstack
msgid "View call stack"
msgstr ""
#: lazarusidestrconsts:srkmecviewunits
msgid "View units"
msgstr ""
#: lazarusidestrconsts:srkmecviewforms
msgid "View forms"
msgstr ""
#: lazarusidestrconsts:srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr ""
#: lazarusidestrconsts:srkmecviewunitinfo
msgid "View unit information"
msgstr ""
#: lazarusidestrconsts:srkmecviewanchoreditor
msgid "View anchor editor"
msgstr ""
#: lazarusidestrconsts:srkmecwordcompletion
msgid "Word completion"
msgstr ""
#: lazarusidestrconsts:srkmeccompletecode
msgid "Complete code"
msgstr ""
#: lazarusidestrconsts:srkmecshowcodecontext
msgid "Show code context"
msgstr ""
#: lazarusidestrconsts:srkmecextractproc
msgid "Extract procedure"
msgstr ""
#: lazarusidestrconsts:srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr ""
#: lazarusidestrconsts:srkmecrenameidentifier
msgid "Rename identifier"
msgstr ""
#: lazarusidestrconsts:srkmecinvertassignment
msgid "Invert assignment"
msgstr ""
#: lazarusidestrconsts:srkmecsyntaxcheck
msgid "Syntax check"
msgstr ""
#: lazarusidestrconsts:srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr ""
#: lazarusidestrconsts:srkmecfinddeclaration
msgid "Find declaration"
msgstr ""
#: lazarusidestrconsts:srkmecfindblockotherend
msgid "Find block other end"
msgstr ""
#: lazarusidestrconsts:srkmecfindblockstart
msgid "Find block start"
msgstr ""
#: lazarusidestrconsts:srkmecbuild
msgid "build program/project"
msgstr ""
#: lazarusidestrconsts:srkmecbuildall
msgid "build all files of program/project"
msgstr ""
#: lazarusidestrconsts:srkmecabortbuild
msgid "abort build"
msgstr ""
#: lazarusidestrconsts:srkmecrun
msgid "run program"
msgstr ""
#: lazarusidestrconsts:srkmecpause
msgid "pause program"
msgstr ""
#: lazarusidestrconsts:srkmecstopprogram
msgid "stop program"
msgstr ""
#: lazarusidestrconsts:srkmecresetdebugger
msgid "reset debugger"
msgstr ""
#: lazarusidestrconsts:srkmecaddbreakpoint
msgid "add break point"
msgstr ""
#: lazarusidestrconsts:srkmecremovebreakpoint
msgid "remove break point"
msgstr ""
#: lazarusidestrconsts:srkmecrunparameters
msgid "run parameters"
msgstr ""
#: lazarusidestrconsts:srkmeccompileroptions
msgid "compiler options"
msgstr ""
#: lazarusidestrconsts:srkmecbuildfile
msgid "build file"
msgstr ""
#: lazarusidestrconsts:srkmecrunfile
msgid "run file"
msgstr ""
#: lazarusidestrconsts:srkmecconfigbuildfile
msgid "config build file"
msgstr ""
#: lazarusidestrconsts:srkmecinspect
msgid "inspect"
msgstr ""
#: lazarusidestrconsts:srkmecevaluate
msgid "evaluate/modify"
msgstr ""
#: lazarusidestrconsts:srkmecaddwatch
msgid "add watch"
msgstr ""
#: lazarusidestrconsts:srkmecexttoolsettings
msgid "External tools settings"
msgstr ""
#: lazarusidestrconsts:srkmecbuildlazarus
msgid "Build lazarus"
msgstr ""
#: lazarusidestrconsts:srkmecexttool
msgid "External tool %d"
msgstr ""
#: lazarusidestrconsts:srkmeccustomtool
msgid "Custom tool %d"
msgstr ""
#: lazarusidestrconsts:srkmecenvironmentoptions
msgid "General environment options"
msgstr ""
#: lazarusidestrconsts:srkmeccodetoolsoptions
msgid "Codetools options"
msgstr ""
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr ""
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr ""
#: lazarusidestrconsts:srkmecmakeresourcestring
msgid "Make resource string"
msgstr ""
#: lazarusidestrconsts:srkmecdiff
msgid "Diff"
msgstr ""
#: lazarusidestrconsts:srkmecunknown
msgid "unknown editor command"
msgstr ""
#: lazarusidestrconsts:srvk_unknown
msgid "Unknown"
msgstr ""
#: lazarusidestrconsts:srvk_lbutton
msgid "Mouse Button Left"
msgstr ""
#: lazarusidestrconsts:srvk_rbutton
msgid "Mouse Button Right"
msgstr ""
#: lazarusidestrconsts:srvk_mbutton
msgid "Mouse Button Middle"
msgstr ""
#: lazarusidestrconsts:srvk_back
msgid "Backspace"
msgstr ""
#: lazarusidestrconsts:srvk_tab
msgid "Tab"
msgstr ""
#: lazarusidestrconsts:srvk_clear
msgid "Clear"
msgstr ""
#: lazarusidestrconsts:srvk_return
msgid "Return"
msgstr ""
#: lazarusidestrconsts:srvk_shift
msgid "Shift"
msgstr ""
#: lazarusidestrconsts:srvk_control
msgid "Control"
msgstr ""
#: lazarusidestrconsts:srvk_menu
msgid "Menu"
msgstr ""
#: lazarusidestrconsts:srvk_pause
msgid "Pause key"
msgstr ""
#: lazarusidestrconsts:srvk_capital
msgid "Capital"
msgstr ""
#: lazarusidestrconsts:srvk_kana
msgid "Kana"
msgstr ""
#: lazarusidestrconsts:srvk_junja
msgid "Junja"
msgstr ""
#: lazarusidestrconsts:srvk_final
msgid "Final"
msgstr ""
#: lazarusidestrconsts:srvk_hanja
msgid "Hanja"
msgstr ""
#: lazarusidestrconsts:srvk_escape
msgid "Escape"
msgstr ""
#: lazarusidestrconsts:srvk_convert
msgid "Convert"
msgstr ""
#: lazarusidestrconsts:srvk_nonconvert
msgid "Nonconvert"
msgstr ""
#: lazarusidestrconsts:srvk_accept
msgid "Accept"
msgstr ""
#: lazarusidestrconsts:srvk_modechange
msgid "Mode Change"
msgstr ""
#: lazarusidestrconsts:srvk_space
msgid "Space key"
msgstr ""
#: lazarusidestrconsts:srvk_prior
msgid "Prior"
msgstr ""
#: lazarusidestrconsts:srvk_next
msgid "Next"
msgstr ""
#: lazarusidestrconsts:srvk_end
msgid "End"
msgstr ""
#: lazarusidestrconsts:srvk_home
msgid "Home"
msgstr ""
#: lazarusidestrconsts:srvk_left
msgid "Left"
msgstr ""
#: lazarusidestrconsts:srvk_up
msgid "Up"
msgstr ""
#: lazarusidestrconsts:srvk_right
msgid "Right"
msgstr ""
#: lazarusidestrconsts:srvk_print
msgid "Print"
msgstr ""
#: lazarusidestrconsts:srvk_execute
msgid "Execute"
msgstr ""
#: lazarusidestrconsts:srvk_snapshot
msgid "Snapshot"
msgstr ""
#: lazarusidestrconsts:srvk_insert
msgid "Insert"
msgstr ""
#: lazarusidestrconsts:srvk_help
msgid "Help"
msgstr ""
#: lazarusidestrconsts:srvk_lwin
msgid "left windows key"
msgstr ""
#: lazarusidestrconsts:srvk_rwin
msgid "right windows key"
msgstr ""
#: lazarusidestrconsts:srvk_apps
msgid "application key"
msgstr ""
#: lazarusidestrconsts:srvk_numpad
msgid "Numpad %d"
msgstr ""
#: lazarusidestrconsts:srvk_numlock
msgid "Numlock"
msgstr ""
#: lazarusidestrconsts:srvk_scroll
msgid "Scroll"
msgstr ""
#: lazarusidestrconsts:srvk_irregular
msgid "Irregular "
msgstr ""
#: lazarusidestrconsts:srkmcatcursormoving
msgid "Cursor moving commands"
msgstr ""
#: lazarusidestrconsts:srkmcatselection
msgid "Text selection commands"
msgstr ""
#: lazarusidestrconsts:srkmcatediting
msgid "Text editing commands"
msgstr ""
#: lazarusidestrconsts:srkmcatcmdcmd
msgid "Command commands"
msgstr ""
#: lazarusidestrconsts:srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr ""
#: lazarusidestrconsts:srkmcatmarker
msgid "Text marker commands"
msgstr ""
#: lazarusidestrconsts:srkmcatcodetools
msgid "CodeTools commands"
msgstr ""
#: lazarusidestrconsts:srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr ""
#: lazarusidestrconsts:srkmcatfilemenu
msgid "File menu commands"
msgstr ""
#: lazarusidestrconsts:srkmcatviewmenu
msgid "View menu commands"
msgstr ""
#: lazarusidestrconsts:srkmcatprojectmenu
msgid "Project menu commands"
msgstr ""
#: lazarusidestrconsts:srkmcatrunmenu
msgid "Run menu commands"
msgstr ""
#: lazarusidestrconsts:srkmcatcomponentsmenu
msgid "Components menu commands"
msgstr ""
#: lazarusidestrconsts:srkmcattoolmenu
msgid "Tools menu commands"
msgstr ""
#: lazarusidestrconsts:srkmcatenvmenu
msgid "Environment menu commands"
msgstr ""
#: lazarusidestrconsts:srkmcarhelpmenu
msgid "Help menu commands"
msgstr ""
#: lazarusidestrconsts:liskeycatdesigner
msgid "Designer commands"
msgstr ""
#: lazarusidestrconsts:liskeycatcustom
msgid "Custom commands"
msgstr ""
#: lazarusidestrconsts:rslanguageautomatic
msgid "Automatic (or english)"
msgstr ""
#: lazarusidestrconsts:rslanguageenglish
msgid "English"
msgstr ""
#: lazarusidestrconsts:rslanguagedeutsch
msgid "Deutsch"
msgstr ""
#: lazarusidestrconsts:rslanguagespanish
msgid "Spanish"
msgstr ""
#: lazarusidestrconsts:rslanguagespanishutf
msgid "Spanish (UTF8)"
msgstr ""
#: lazarusidestrconsts:rslanguagefrench
msgid "French"
msgstr ""
#: lazarusidestrconsts:rslanguagerussian
msgid "Russian"
msgstr ""
#: lazarusidestrconsts:rslanguagerussianwin
msgid "Russian(CP1251)"
msgstr ""
#: lazarusidestrconsts:rslanguagerussianutf
msgid "Russian(UTF8)"
msgstr ""
#: lazarusidestrconsts:rslanguagepolish
msgid "Polish"
msgstr ""
#: lazarusidestrconsts:rslanguagepolishiso
msgid "Polish(ISO 8859-2)"
msgstr ""
#: lazarusidestrconsts:rslanguagepolishwin
msgid "Polish(CP1250)"
msgstr ""
#: lazarusidestrconsts:rslanguageitalian
msgid "Italian"
msgstr ""
#: lazarusidestrconsts:rslanguageitalianiso
msgid "Italian(ISO 8859-1)"
msgstr ""
#: lazarusidestrconsts:rslanguagecatalan
msgid "Catalan"
msgstr ""
#: lazarusidestrconsts:rslanguagefinnish
msgid "Finnish"
msgstr ""
#: lazarusidestrconsts:rslanguagefinnishwin
msgid "Finnish for MS Windows"
msgstr ""
#: lazarusidestrconsts:rslanguagehebrew
msgid "Hebrew"
msgstr ""
#: lazarusidestrconsts:rslanguagearabic
msgid "Arabic"
msgstr ""
#: lazarusidestrconsts:rslanguageportugues
msgid "Portuguese"
msgstr ""
#: lazarusidestrconsts:dlgunitdepcaption
msgid "Unit dependencies"
msgstr ""
#: lazarusidestrconsts:dlgunitdepbrowse
msgid "Browse..."
msgstr ""
#: lazarusidestrconsts:dlgunitdeprefresh
msgid "Refresh"
msgstr ""
#: lazarusidestrconsts:lisdocumentationeditor
msgid "Documentation Editor"
msgstr ""
#: lazarusidestrconsts:liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr ""
#: lazarusidestrconsts:lismakenotfound
msgid "Make not found"
msgstr ""
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr ""
#: lazarusidestrconsts:liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr ""
#: lazarusidestrconsts:lisbuildlcl
msgid "Build LCL"
msgstr ""
#: lazarusidestrconsts:lisbuildcomponent
msgid "Build Component"
msgstr ""
#: lazarusidestrconsts:lisbuildcodetools
msgid "Build CodeTools"
msgstr ""
#: lazarusidestrconsts:lisbuildsynedit
msgid "Build SynEdit"
msgstr ""
#: lazarusidestrconsts:lisbuildideintf
msgid "Build IDE Interface"
msgstr ""
#: lazarusidestrconsts:lisbuildjitform
msgid "Build JIT Form"
msgstr ""
#: lazarusidestrconsts:lisbuildpkgreg
msgid "Build Package Registration"
msgstr ""
#: lazarusidestrconsts:lisbuildide
msgid "Build IDE"
msgstr ""
#: lazarusidestrconsts:lisbuildstarter
msgid "Build Starter"
msgstr ""
#: lazarusidestrconsts:lisbuildexamples
msgid "Build Examples"
msgstr ""
#: lazarusidestrconsts:lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr ""
#: lazarusidestrconsts:lislazbuildcleanall
msgid "Clean all"
msgstr ""
#: lazarusidestrconsts:lislazbuildsettobuildall
msgid "Set to %sBuild All%s"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
msgid "Build Components (SynEdit, CodeTools)"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildide
msgid "Build IDE"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildexamples
msgid "Build Examples"
msgstr ""
#: lazarusidestrconsts:lislazbuildoptions
msgid "Options:"
msgstr ""
#: lazarusidestrconsts:lislazbuildtargetos
msgid "Target OS:"
msgstr ""
#: lazarusidestrconsts:lislazbuildtargetdirectory
msgid "Target Directory:"
msgstr ""
#: lazarusidestrconsts:lislazbuildlclinterface
msgid "LCL interface"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildjitform
msgid "Build JITForm"
msgstr ""
#: lazarusidestrconsts:lislazbuildwithstaticpackages
msgid "With Packages"
msgstr ""
#: lazarusidestrconsts:lislazbuildrestartafterbuild
msgid "Restart After Successfull Build"
msgstr ""
#: lazarusidestrconsts:lislazbuildok
msgid "Ok"
msgstr ""
#: lazarusidestrconsts:lisctdtemplates
msgid "Templates"
msgstr ""
#: lazarusidestrconsts:lissavesettings
msgid "Save Settings"
msgstr ""
#: lazarusidestrconsts:lislazbuildcancel
msgid "Cancel"
msgstr ""
#: lazarusidestrconsts:lislazbuildnone
msgid "None"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuild
msgid "Build"
msgstr ""
#: lazarusidestrconsts:lislazbuildcleanbuild
msgid "Clean+Build"
msgstr ""
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr ""
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr ""
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr ""
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsok
msgid "Ok"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsnone
msgid "None"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptskeyword
msgid "Keyword"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsidentifier
msgid "Identifier"
msgstr ""
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr ""
#: lazarusidestrconsts:lisfrifindreferences
msgid "Find References"
msgstr ""
#: lazarusidestrconsts:lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr ""
#: lazarusidestrconsts:lisfrirenameto
msgid "Rename to"
msgstr ""
#: lazarusidestrconsts:lisfrirename
msgid "Rename"
msgstr ""
#: lazarusidestrconsts:lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr ""
#: lazarusidestrconsts:lisfrisearchwhere
msgid "Search where"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptscolon
msgid "Colon"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptscomma
msgid "Comma"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptspoint
msgid "Point"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsat
msgid "At"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsnumber
msgid "Number"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsstringconst
msgid "String constant"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsnewline
msgid "Newline"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsspace
msgid "Space"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptssymbol
msgid "Symbol"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefswriteerror
msgid "Write error"
msgstr ""
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsreaderror
msgid "Read error"
msgstr ""
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr ""
#: lazarusidestrconsts:lislclunitpathmissing
msgid "LCL unit path missing"
msgstr ""
#: lazarusidestrconsts:lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr ""
#: lazarusidestrconsts:listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory
msgid "Project directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC CVS source below. Used to autocreate macros."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsfpccvssourcedirectory
msgid "FPC CVS source directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal CVS source directory. Not required. This will improve find declarationand debugging."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcvssources
msgid "Create Defines for Free Pascal CVS Sources"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedir
msgid "The Free Pascal CVS source directory."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdirectory
msgid "%s directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsexit
msgid "Exit"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsedit
msgid "Edit"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdefine
msgid "Define"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsundefine
msgid "Undefine"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsblock
msgid "Block"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsif
msgid "If"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsifdef
msgid "IfDef"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsifndef
msgid "IfNDef"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefselseif
msgid "ElseIf"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefselse
msgid "Else"
msgstr ""
#: lazarusidestrconsts:lisctdefstools
msgid "Tools"
msgstr ""
#: lazarusidestrconsts:lisctdefsopenpreview
msgid "Open Preview"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcvssource
msgid "Insert Free Pascal CVS Source Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsname
msgid "Name:"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdescription
msgid "Description:"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsvariable
msgid "Variable:"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsaction
msgid "Action: %s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
msgid "none selected"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr ""
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnewnode
msgid "NewNode"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr ""
#: lazarusidestrconsts:liscodetempladdcodetemplate
msgid "Add code template"
msgstr ""
#: lazarusidestrconsts:liscodetempladd
msgid "Add"
msgstr ""
#: lazarusidestrconsts:liscodetempleditcodetemplate
msgid "Edit code template"
msgstr ""
#: lazarusidestrconsts:liscodetemplchange
msgid "Change"
msgstr ""
#: lazarusidestrconsts:liscodetempltoken
msgid "Token:"
msgstr ""
#: lazarusidestrconsts:liscodetemplcomment
msgid "Comment:"
msgstr ""
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr ""
#: lazarusidestrconsts:liscodetemplerror
msgid "Error"
msgstr ""
#: lazarusidestrconsts:lishelpdatabasenotfound
msgid "Help Database not found"
msgstr ""
#: lazarusidestrconsts:lishelpcontextnotfound
msgid "Help Context not found"
msgstr ""
#: lazarusidestrconsts:lishelpviewernotfound
msgid "Help Viewer not found"
msgstr ""
#: lazarusidestrconsts:lishelpnotfound
msgid "Help not found"
msgstr ""
#: lazarusidestrconsts:lishelpviewererror
msgid "Help Viewer Error"
msgstr ""
#: lazarusidestrconsts:lishelpselectorerror
msgid "Help Selector Error"
msgstr ""
#: lazarusidestrconsts:lisunknownerrorpleasereportthisbug
msgid "Unknown Error, please report this bug"
msgstr ""
#: lazarusidestrconsts:lismakeresourcestring
msgid "Make ResourceString"
msgstr ""
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr ""
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring
msgid "Please choose a resourstring section from the list."
msgstr ""
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr ""
#: lazarusidestrconsts:lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr ""
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
msgid "String Constant in source"
msgstr ""
#: lazarusidestrconsts:lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr ""
#: lazarusidestrconsts:lismakeresstridentifierprefix
msgid "Identifier Prefix:"
msgstr ""
#: lazarusidestrconsts:lismakeresstridentifierlength
msgid "Identifier Length:"
msgstr ""
#: lazarusidestrconsts:lismakeresstrcustomidentifier
msgid "Custom Identifier"
msgstr ""
#: lazarusidestrconsts:lismakeresstrresourcestringsection
msgid "Resourcestring Section:"
msgstr ""
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr ""
#: lazarusidestrconsts:lismakeresstrappendtosection
msgid "Append to section"
msgstr ""
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr ""
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr ""
#: lazarusidestrconsts:lismakeresstrsourcepreview
msgid "Source preview"
msgstr ""
#: lazarusidestrconsts:lisnostringconstantfound
msgid "No String Constant Found"
msgstr ""
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again."
msgstr ""
#: lazarusidestrconsts:lisdiffdlgtext1
msgid "Text1"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgonlyselection
msgid "Only selection"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgtext2
msgid "Text2"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr ""
#: lazarusidestrconsts:listodolistcaption
msgid "ToDo List"
msgstr ""
#: lazarusidestrconsts:listodolistrefresh
msgid "Refresh todo items"
msgstr ""
#: lazarusidestrconsts:listodolistgotoline
msgid "Goto selected source line"
msgstr ""
#: lazarusidestrconsts:listodolistprintlist
msgid "Print todo items"
msgstr ""
#: lazarusidestrconsts:listodolistoptions
msgid "ToDo options..."
msgstr ""
#: lazarusidestrconsts:listodoldescription
msgid "Description"
msgstr ""
#: lazarusidestrconsts:listodolfile
msgid "File"
msgstr ""
#: lazarusidestrconsts:listodolline
msgid "Line"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypeunit
msgid "Unit"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypeinclude
msgid "Include file"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypetext
msgid "Text"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypebinary
msgid "Binary"
msgstr ""
#: lazarusidestrconsts:lisviewprojectunits
msgid "View Project Units"
msgstr ""
#: lazarusidestrconsts:lisinformationaboutunit
msgid "Information about %s"
msgstr ""
#: lazarusidestrconsts:lisuidyes
msgid "yes"
msgstr ""
#: lazarusidestrconsts:lisuidno
msgid "no"
msgstr ""
#: lazarusidestrconsts:lisuidbytes
msgid "%s bytes"
msgstr ""
#: lazarusidestrconsts:lisuidname
msgid "Name:"
msgstr ""
#: lazarusidestrconsts:lisuidtype
msgid "Type:"
msgstr ""
#: lazarusidestrconsts:lisuidinproject
msgid "in Project:"
msgstr ""
#: lazarusidestrconsts:lisuidincludedby
msgid "Included by:"
msgstr ""
#: lazarusidestrconsts:lisuidclear
msgid "Clear"
msgstr ""
#: lazarusidestrconsts:lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr ""
#: lazarusidestrconsts:lisuidunit
msgid "Unit"
msgstr ""
#: lazarusidestrconsts:lisuidsrc
msgid "Src"
msgstr ""
#: lazarusidestrconsts:lisuidok
msgid "Ok"
msgstr ""
#: lazarusidestrconsts:lisuidsize
msgid "Size:"
msgstr ""
#: lazarusidestrconsts:lisuidlines
msgid "Lines:"
msgstr ""
#: lazarusidestrconsts:lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr ""
#: lazarusidestrconsts:lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr ""
#: lazarusidestrconsts:lissearchfor
msgid "Search For "
msgstr ""
#: lazarusidestrconsts:lisuenotfound
msgid "Not found"
msgstr ""
#: lazarusidestrconsts:lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr ""
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lisuesearching
msgid "Searching: %s"
msgstr ""
#: lazarusidestrconsts:lisuereadonly
msgid "%s/ReadOnly"
msgstr ""
#: lazarusidestrconsts:lisuegotoline
msgid "Goto line :"
msgstr ""
#: lazarusidestrconsts:listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr ""
#: lazarusidestrconsts:listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr ""
#: lazarusidestrconsts:listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr ""
#: lazarusidestrconsts:listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr ""
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr ""
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr ""
#: lazarusidestrconsts:listmunknownmacro
msgid "(unknown macro: %s)"
msgstr ""
#: lazarusidestrconsts:lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr ""
#: lazarusidestrconsts:lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr ""
#: lazarusidestrconsts:lisfriidentifier
msgid "Identifier: %s"
msgstr ""
#: lazarusidestrconsts:lissvuooverridesystemvariable
msgid "Override system variable"
msgstr ""
#: lazarusidestrconsts:lissvuook
msgid "Ok"
msgstr ""
#: lazarusidestrconsts:lissortselsortselection
msgid "Sort selection"
msgstr ""
#: lazarusidestrconsts:lissortselpreview
msgid "Preview"
msgstr ""
#: lazarusidestrconsts:lissortselascending
msgid "Ascending"
msgstr ""
#: lazarusidestrconsts:lissortseldescending
msgid "Descending"
msgstr ""
#: lazarusidestrconsts:lissortseldomain
msgid "Domain"
msgstr ""
#: lazarusidestrconsts:lissortsellines
msgid "Lines"
msgstr ""
#: lazarusidestrconsts:lissortselwords
msgid "Words"
msgstr ""
#: lazarusidestrconsts:lissortselparagraphs
msgid "Paragraphs"
msgstr ""
#: lazarusidestrconsts:lissortseloptions
msgid "Options"
msgstr ""
#: lazarusidestrconsts:lissortselcasesensitive
msgid "Case Sensitive"
msgstr ""
#: lazarusidestrconsts:lissortselignorespace
msgid "Ignore Space"
msgstr ""
#: lazarusidestrconsts:lissortselsort
msgid "Accept"
msgstr ""
#: lazarusidestrconsts:lissortselcancel
msgid "Cancel"
msgstr ""
#: lazarusidestrconsts:lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr ""
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr ""
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first."
msgstr ""
#: lazarusidestrconsts:lisprojoptserror
msgid "Error"
msgstr ""
#: lazarusidestrconsts:lispatheditselectdirectory
msgid "Select directory"
msgstr ""
#: lazarusidestrconsts:lispatheditsearchpaths
msgid "Search paths:"
msgstr ""
#: lazarusidestrconsts:lispatheditmovepathdown
msgid "Move path down"
msgstr ""
#: lazarusidestrconsts:lispatheditmovepathup
msgid "Move path up"
msgstr ""
#: lazarusidestrconsts:lispatheditbrowse
msgid "Browse"
msgstr ""
#: lazarusidestrconsts:lispatheditpathtemplates
msgid "Path templates"
msgstr ""
#: lazarusidestrconsts:lisnewdlgnoitemselected
msgid "No item selected"
msgstr ""
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr ""
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr ""
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr ""
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr ""
#: lazarusidestrconsts:lispackage
msgid "Package"
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr ""
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatefile
msgid "Unable to create file"
msgstr ""
#: lazarusidestrconsts:liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletowritefile
msgid "Unable to write file"
msgstr ""
#: lazarusidestrconsts:lisunabletowritefile2
msgid "Unable to write file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisfileisnotwritable
msgid "File is not writable"
msgstr ""
#: lazarusidestrconsts:lisunabletowritetofile2
msgid "Unable to write to file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletowritefilename
msgid "Unable to write file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletoreadfile
msgid "Unable to read file"
msgstr ""
#: lazarusidestrconsts:lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr ""
#: lazarusidestrconsts:liserrordeletingfile
msgid "Error deleting file"
msgstr ""
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorrenamingfile
msgid "Error renaming file"
msgstr ""
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr ""
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisambiguousfilefound
msgid "Ambiguous file found"
msgstr ""
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr ""
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""
#: lazarusidestrconsts:lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr ""
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr ""
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr ""
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisprojaddpackagenotfound
msgid "Package not found"
msgstr ""
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr ""
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr ""
#: lazarusidestrconsts:lisprojaddinvalidversion
msgid "Invalid version"
msgstr ""
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr ""
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr ""
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisprojaddtoproject
msgid "Add to project"
msgstr ""
#: lazarusidestrconsts:lisprojaddnewrequirement
msgid "New Requirement"
msgstr ""
#: lazarusidestrconsts:lisprojaddfiles
msgid "Add files"
msgstr ""
#: lazarusidestrconsts:lisprojaddeditorfile
msgid "Add editor files"
msgstr ""
#: lazarusidestrconsts:lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr ""
#: lazarusidestrconsts:lisprojaddpackagename
msgid "Package Name:"
msgstr ""
#: lazarusidestrconsts:lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr ""
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr ""
#: lazarusidestrconsts:liscomppalopenpackage
msgid "Open package"
msgstr ""
#: lazarusidestrconsts:liscomppalopenunit
msgid "Open unit"
msgstr ""
#: lazarusidestrconsts:lismacropromptenterdata
msgid "Enter data"
msgstr ""
#: lazarusidestrconsts:lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr ""
#: lazarusidestrconsts:lisdebuggererror
msgid "Debugger error"
msgstr ""
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr ""
#: lazarusidestrconsts:lisexecutionstopped
msgid "Execution stopped"
msgstr ""
#: lazarusidestrconsts:lisexecutionstoppedon
msgid "Execution stopped%s"
msgstr ""
#: lazarusidestrconsts:lisexecutionpaused
msgid "Execution paused"
msgstr ""
#: lazarusidestrconsts:lisexecutionpausedadress
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgstr ""
#: lazarusidestrconsts:lisfilenotfound
msgid "File not found"
msgstr ""
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr ""
#: lazarusidestrconsts:lisruntofailed
msgid "Run-to failed"
msgstr ""
#: lazarusidestrconsts:lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr ""
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr ""
#: lazarusidestrconsts:lisdebuggerinvalid
msgid "Debugger invalid"
msgstr ""
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr ""
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr ""
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffrevertall
msgid "Reload from disk"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr ""
#: lazarusidestrconsts:lisedtdefcurrentproject
msgid "Current Project"
msgstr ""
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr ""
#: lazarusidestrconsts:lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr ""
#: lazarusidestrconsts:lisedtdefprojectincpath
msgid "Project IncPath"
msgstr ""
#: lazarusidestrconsts:lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr ""
#: lazarusidestrconsts:lisedtdefallpackages
msgid "All packages"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr ""
#: lazarusidestrconsts:lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr ""
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr ""
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr ""
#: lazarusidestrconsts:lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr ""
#: lazarusidestrconsts:lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts:lisexttoolexternaltools
msgid "External Tools"
msgstr ""
#: lazarusidestrconsts:lisexttoolremove
msgid "Remove"
msgstr ""
#: lazarusidestrconsts:lisexttoolmoveup
msgid "Move Up"
msgstr ""
#: lazarusidestrconsts:lisexttoolmovedown
msgid "Move Down"
msgstr ""
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr ""
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr ""
#: lazarusidestrconsts:lisedtexttooledittool
msgid "Edit Tool"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolprogramfilename
msgid "Programfilename:"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolparameters
msgid "Parameters:"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolkey
msgid "Key"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolctrl
msgid "Ctrl"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolalt
msgid "Alt"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolshift
msgid "Shift"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolmacros
msgid "Macros"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolinsert
msgid "Insert"
msgstr ""
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr ""
#: lazarusidestrconsts:lisfindfiletexttofind
msgid "Text to find:"
msgstr ""
#: lazarusidestrconsts:lisfindfilecasesensitive
msgid "Case sensitive"
msgstr ""
#: lazarusidestrconsts:lisfindfilewholewordsonly
msgid "Whole words only"
msgstr ""
#: lazarusidestrconsts:lisfindfileregularexpressions
msgid "Regular expressions"
msgstr ""
#: lazarusidestrconsts:lisfindfilewhere
msgid "Where"
msgstr ""
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
msgid "search all files in project"
msgstr ""
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
msgid "search all open files"
msgstr ""
#: lazarusidestrconsts:lisfindfilesearchindirectories
msgid "search in directories"
msgstr ""
#: lazarusidestrconsts:lisfindfiledirectoryoptions
msgid "Directory options"
msgstr ""
#: lazarusidestrconsts:lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr ""
#: lazarusidestrconsts:lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr ""
#: lazarusidestrconsts:lisfindfileonlytextfiles
msgid "Only text files"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackage
msgid "Package: %s"
msgstr ""
#: lazarusidestrconsts:lispkgmangproject
msgid "Project: %s"
msgstr ""
#: lazarusidestrconsts:lispkgmanglazarus
msgid "Lazarus"
msgstr ""
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr ""
#: lazarusidestrconsts:lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr ""
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lispkgmangreplacefile
msgid "Replace File"
msgstr ""
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr ""
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lispkgmangdeletefailed
msgid "Delete failed"
msgstr ""
#: lazarusidestrconsts:lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr ""
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr ""
#: lazarusidestrconsts:lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr ""
#: lazarusidestrconsts:lispkgmangbrokendependency
msgid "Broken dependency"
msgstr ""
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr ""
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr ""
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr ""
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr ""
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangerrorwritingfile
msgid "Error writing file"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr ""
#: lazarusidestrconsts:lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr ""
#: lazarusidestrconsts:lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr ""
#: lazarusidestrconsts:lispkgmangsavepackage
msgid "Save Package?"
msgstr ""
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr ""
#: lazarusidestrconsts:lispkgmangnewpackage
msgid "NewPackage"
msgstr ""
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr ""
#: lazarusidestrconsts:lispackageneedsinstallation
msgid "Package needs installation"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr ""
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletoreadpackagefile
msgid "Unable to read package file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lispkgmangsavepackage2
msgid "Save package?"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr ""
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr ""
#: lazarusidestrconsts:lismissingpackages
msgid "Missing Packages"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr ""
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr ""
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr ""
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr ""
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr ""
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisconfirmchanges
msgid "Confirm changes"
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenotsaved
msgid "File not saved"
msgstr ""
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr ""
#: lazarusidestrconsts:lispkgmangfileisinproject
msgid "File is in Project"
msgstr ""
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr ""
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr ""
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr ""
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr ""
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr ""
#: lazarusidestrconsts:lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackageisrequired
msgid "Package is required"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr ""
#: lazarusidestrconsts:lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr ""
#: lazarusidestrconsts:lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr ""
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr ""
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr ""
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr ""
#: lazarusidestrconsts:lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr ""
#: lazarusidestrconsts:lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr ""
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr ""
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr ""
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr ""
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr ""
#: lazarusidestrconsts:lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgsysregistrationerror
msgid "Registration Error"
msgstr ""
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr ""
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr ""
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr ""
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr ""
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr ""
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found.All its components are deactivated. Please fix this."
msgstr ""
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr ""
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file was found.%sA broken dummy package was created."
msgstr ""
#: lazarusidestrconsts:lispkgdefsoutputdirectory
msgid "Output directory"
msgstr ""
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr ""
#: lazarusidestrconsts:lispkgdefsunitpath
msgid "Unit Path"
msgstr ""
#: lazarusidestrconsts:lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr ""
#: lazarusidestrconsts:lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr ""
#: lazarusidestrconsts:lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr ""
#: lazarusidestrconsts:lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr ""
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr ""
#: lazarusidestrconsts:lisaf2pthefileisalreadyinthepackage
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""
#: lazarusidestrconsts:lisaf2punitname
msgid "Unit Name: "
msgstr ""
#: lazarusidestrconsts:lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr ""
#: lazarusidestrconsts:lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr ""
#: lazarusidestrconsts:lisaf2pfiletype
msgid "File Type"
msgstr ""
#: lazarusidestrconsts:lisaf2pdestinationpackage
msgid "Destination Package"
msgstr ""
#: lazarusidestrconsts:lisaf2pshowall
msgid "Show All"
msgstr ""
#: lazarusidestrconsts:lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidfilename
msgid "Invalid filename"
msgstr ""
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr ""
#: lazarusidestrconsts:lisa2pfilenotunit
msgid "File not unit"
msgstr ""
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts:lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr ""
#: lazarusidestrconsts:lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr ""
#: lazarusidestrconsts:lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr ""
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr ""
#: lazarusidestrconsts:lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisa2pfilealreadyexists
msgid "File already exists"
msgstr ""
#: lazarusidestrconsts:lisa2pfileisused
msgid "File is used"
msgstr ""
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr ""
#: lazarusidestrconsts:lisa2pthemaximumversionislowerthantheminimimversion
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr ""
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s and filename differ."
msgstr ""
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr ""
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidfile
msgid "Invalid file"
msgstr ""
#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr ""
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:lisa2ppagenametoolong
msgid "Page Name too long"
msgstr ""
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr ""
#: lazarusidestrconsts:lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr ""
#: lazarusidestrconsts:lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr ""
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts:lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts:lisa2paddunit
msgid "Add Unit"
msgstr ""
#: lazarusidestrconsts:lisa2pnewfile
msgid "New File"
msgstr ""
#: lazarusidestrconsts:lisa2pnewcomponent
msgid "New Component"
msgstr ""
#: lazarusidestrconsts:lisa2paddfile
msgid "Add File"
msgstr ""
#: lazarusidestrconsts:lisa2paddfiles
msgid "Add Files"
msgstr ""
#: lazarusidestrconsts:lisa2punitfilename
msgid "Unit file name:"
msgstr ""
#: lazarusidestrconsts:lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr ""
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr ""
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr ""
#: lazarusidestrconsts:lisa2pancestortype
msgid "Ancestor Type"
msgstr ""
#: lazarusidestrconsts:lisa2pshowall
msgid "Show all"
msgstr ""
#: lazarusidestrconsts:lisa2pnewclassname
msgid "New class name:"
msgstr ""
#: lazarusidestrconsts:lisa2ppalettepage
msgid "Palette Page:"
msgstr ""
#: lazarusidestrconsts:lisa2punitfilename2
msgid "Unit File Name:"
msgstr ""
#: lazarusidestrconsts:lisa2punitname
msgid "Unit Name:"
msgstr ""
#: lazarusidestrconsts:lisa2pfilename
msgid "File name:"
msgstr ""
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr ""
#: lazarusidestrconsts:lisa2pdependency
msgid "Dependency"
msgstr ""
#: lazarusidestrconsts:lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr ""
#: lazarusidestrconsts:lisoipfilename
msgid "Filename: %s"
msgstr ""
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr ""
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr ""
#: lazarusidestrconsts:lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr ""
#: lazarusidestrconsts:lisoipdescription
msgid "Description: "
msgstr ""
#: lazarusidestrconsts:lisoippleaseselectapackage
msgid "Please select a package"
msgstr ""
#: lazarusidestrconsts:lisoipnopackageselected
msgid "No package selected"
msgstr ""
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr ""
#: lazarusidestrconsts:lisoippackagename
msgid "Package Name"
msgstr ""
#: lazarusidestrconsts:lisoipstate
msgid "State"
msgstr ""
#: lazarusidestrconsts:lisoipmodified
msgid "modified"
msgstr ""
#: lazarusidestrconsts:lisoipmissing
msgid "missing"
msgstr ""
#: lazarusidestrconsts:lisoipinstalledstatic
msgid "installed static"
msgstr ""
#: lazarusidestrconsts:lisoipinstalleddynamic
msgid "installed dynamic"
msgstr ""
#: lazarusidestrconsts:lisoipautoinstallstatic
msgid "auto install static"
msgstr ""
#: lazarusidestrconsts:lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr ""
#: lazarusidestrconsts:lisoipreadonly
msgid "readonly"
msgstr ""
#: lazarusidestrconsts:lisoipopenloadedpackage
msgid "Open loaded package"
msgstr ""
#: lazarusidestrconsts:lispckeditremovefile
msgid "Remove file"
msgstr ""
#: lazarusidestrconsts:lispckeditreaddfile
msgid "Re-Add file"
msgstr ""
#: lazarusidestrconsts:lispckeditremovedependency
msgid "Remove dependency"
msgstr ""
#: lazarusidestrconsts:lispckeditmovedependencyup
msgid "Move dependency up"
msgstr ""
#: lazarusidestrconsts:lispckeditmovedependencydown
msgid "Move dependency down"
msgstr ""
#: lazarusidestrconsts:lispckeditreadddependency
msgid "Re-Add dependency"
msgstr ""
#: lazarusidestrconsts:lispckeditcompile
msgid "Compile"
msgstr ""
#: lazarusidestrconsts:lispckeditrecompileclean
msgid "Recompile clean"
msgstr ""
#: lazarusidestrconsts:lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr ""
#: lazarusidestrconsts:lispckeditaddtoproject
msgid "Add to project"
msgstr ""
#: lazarusidestrconsts:lispckeditinstall
msgid "Install"
msgstr ""
#: lazarusidestrconsts:lispckedituninstall
msgid "Uninstall"
msgstr ""
#: lazarusidestrconsts:lispckeditviewpackgesource
msgid "View Package Source"
msgstr ""
#: lazarusidestrconsts:lispckeditgeneraloptions
msgid "General Options"
msgstr ""
#: lazarusidestrconsts:lispckeditsavechanges
msgid "Save Changes?"
msgstr ""
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr ""
#: lazarusidestrconsts:lispckeditpage
msgid "%s, Page: %s"
msgstr ""
#: lazarusidestrconsts:lispckeditremovefile2
msgid "Remove file?"
msgstr ""
#: lazarusidestrconsts:lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr ""
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr ""
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr ""
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr ""
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr ""
#: lazarusidestrconsts:lispckeditcompileeverything
msgid "Compile everything?"
msgstr ""
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr ""
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr ""
#: lazarusidestrconsts:lispckeditsavepackage
msgid "Save package"
msgstr ""
#: lazarusidestrconsts:lispckeditcompilepackage
msgid "Compile package"
msgstr ""
#: lazarusidestrconsts:lispckeditaddanitem
msgid "Add an item"
msgstr ""
#: lazarusidestrconsts:lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr ""
#: lazarusidestrconsts:lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr ""
#: lazarusidestrconsts:lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr ""
#: lazarusidestrconsts:lispckeditcompopts
msgid "Compiler Options"
msgstr ""
#: lazarusidestrconsts:lispckedithelp
msgid "Help"
msgstr ""
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr ""
#: lazarusidestrconsts:lispckeditmore
msgid "More ..."
msgstr ""
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr ""
#: lazarusidestrconsts:lispckeditrequiredpackages
msgid "Required Packages"
msgstr ""
#: lazarusidestrconsts:lispckeditfileproperties
msgid "File Properties"
msgstr ""
#: lazarusidestrconsts:lispckeditregisterunit
msgid "Register unit"
msgstr ""
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr ""
#: lazarusidestrconsts:lispckeditregisteredplugins
msgid "Registered plugins"
msgstr ""
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr ""
#: lazarusidestrconsts:lispkgmanguseunit
msgid "Use unit"
msgstr ""
#: lazarusidestrconsts:lispckeditminimumversion
msgid "Minimum Version:"
msgstr ""
#: lazarusidestrconsts:lispckeditmaximumversion
msgid "Maximum Version:"
msgstr ""
#: lazarusidestrconsts:lispckeditapplychanges
msgid "Apply changes"
msgstr ""
#: lazarusidestrconsts:lispckeditpackage
msgid "Package %s"
msgstr ""
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr ""
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr ""
#: lazarusidestrconsts:lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""
#: lazarusidestrconsts:lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr ""
#: lazarusidestrconsts:lispckeditreadonly
msgid "Read Only: %s"
msgstr ""
#: lazarusidestrconsts:lispckeditmodified
msgid "Modified: %s"
msgstr ""
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr ""
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr ""
#: lazarusidestrconsts:lispkgeditrevertpackage
msgid "Revert package?"
msgstr ""
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr ""
#: lazarusidestrconsts:lispckoptsusage
msgid "Usage"
msgstr ""
#: lazarusidestrconsts:lispckoptsideintegration
msgid "IDE Integration"
msgstr ""
#: lazarusidestrconsts:lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr ""
#: lazarusidestrconsts:lispckoptsauthor
msgid "Author:"
msgstr ""
#: lazarusidestrconsts:lispckoptslicense
msgid "License:"
msgstr ""
#: lazarusidestrconsts:lispckoptsmajor
msgid "Major"
msgstr ""
#: lazarusidestrconsts:lispckoptsminor
msgid "Minor"
msgstr ""
#: lazarusidestrconsts:lispckoptsrelease
msgid "Release"
msgstr ""
#: lazarusidestrconsts:lisbuildnumber
msgid "Build Number"
msgstr ""
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr ""
#: lazarusidestrconsts:lispckoptspackagetype
msgid "PackageType"
msgstr ""
#: lazarusidestrconsts:lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr ""
#: lazarusidestrconsts:lispckoptsruntimeonly
msgid "Runtime only"
msgstr ""
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr ""
#: lazarusidestrconsts:lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr ""
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr ""
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr ""
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr ""
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr ""
#: lazarusidestrconsts:lispckoptsinclude
msgid "Include"
msgstr ""
#: lazarusidestrconsts:lispckoptsobject
msgid "Object"
msgstr ""
#: lazarusidestrconsts:lispckoptslibrary
msgid "Library"
msgstr ""
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr ""
#: lazarusidestrconsts:lispckoptslinker
msgid "Linker"
msgstr ""
#: lazarusidestrconsts:lispckoptscustom
msgid "Custom"
msgstr ""
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr ""
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr ""
#: lazarusidestrconsts:lispckoptspackageoptions
msgid "Package Options"
msgstr ""
#: lazarusidestrconsts:lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr ""
#: lazarusidestrconsts:lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr ""
#: lazarusidestrconsts:lispckexplpackagenotfound
msgid "Package %s not found"
msgstr ""
#: lazarusidestrconsts:lispckexplstate
msgid "%sState: "
msgstr ""
#: lazarusidestrconsts:lispckexplautocreated
msgid "AutoCreated"
msgstr ""
#: lazarusidestrconsts:lispckexplinstalled
msgid "Installed"
msgstr ""
#: lazarusidestrconsts:lispckexplinstallonnextstart
msgid "Install on next start"
msgstr ""
#: lazarusidestrconsts:lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr ""
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr ""
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr ""
#: lazarusidestrconsts:lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr ""
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr ""
#: lazarusidestrconsts:lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr ""
#: lazarusidestrconsts:lismenueditormenueditor
msgid "Menu Editor"
msgstr ""
#: lazarusidestrconsts:lismenueditorselectmenu
msgid "Select Menu:"
msgstr ""
#: lazarusidestrconsts:lismenueditorselecttemplate
msgid "Select Template:"
msgstr ""
#: lazarusidestrconsts:lismenueditortemplatepreview
msgid "Template Preview"
msgstr ""
#: lazarusidestrconsts:lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr ""
#: lazarusidestrconsts:lismenueditorcancel
msgid "Cancel"
msgstr ""
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr ""
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr ""
#: lazarusidestrconsts:lismenueditordeleteitem
msgid "Delete Item"
msgstr ""
#: lazarusidestrconsts:lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr ""
#: lazarusidestrconsts:lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr ""
#: lazarusidestrconsts:lismenueditormoveup
msgid "Move Up (or left)"
msgstr ""
#: lazarusidestrconsts:lismenueditormovedown
msgid "Move Down (or right)"
msgstr ""
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr ""
#: lazarusidestrconsts:lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr ""
#: lazarusidestrconsts:lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr ""
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr ""
#: lazarusidestrconsts:lismenutemplatefile
msgid "File"
msgstr ""
#: lazarusidestrconsts:lismenutemplatenew
msgid "New"
msgstr ""
#: lazarusidestrconsts:lismenutemplateopen
msgid "Open"
msgstr ""
#: lazarusidestrconsts:lismenutemplateopenrecent
msgid "Open Recent"
msgstr ""
#: lazarusidestrconsts:lismenutemplatesave
msgid "Save"
msgstr ""
#: lazarusidestrconsts:lismenutemplatesaveas
msgid "Save As"
msgstr ""
#: lazarusidestrconsts:lismenutemplateclose
msgid "Close"
msgstr ""
#: lazarusidestrconsts:lismenutemplateexit
msgid "Exit"
msgstr ""
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr ""
#: lazarusidestrconsts:lismenutemplateedit
msgid "Edit"
msgstr ""
#: lazarusidestrconsts:lismenutemplateundo
msgid "Undo"
msgstr ""
#: lazarusidestrconsts:lismenutemplateredo
msgid "Redo"
msgstr ""
#: lazarusidestrconsts:lismenutemplatecut
msgid "Cut"
msgstr ""
#: lazarusidestrconsts:lismenutemplatecopy
msgid "Copy"
msgstr ""
#: lazarusidestrconsts:lismenutemplatepaste
msgid "Paste"
msgstr ""
#: lazarusidestrconsts:lismenutemplatefind
msgid "Find"
msgstr ""
#: lazarusidestrconsts:lismenutemplatefindnext
msgid "Find Next"
msgstr ""
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr ""
#: lazarusidestrconsts:lismenutemplatehelp
msgid "Help"
msgstr ""
#: lazarusidestrconsts:lismenutemplatecontents
msgid "Contents"
msgstr ""
#: lazarusidestrconsts:lismenutemplatetutorial
msgid "Tutorial"
msgstr ""
#: lazarusidestrconsts:lismenutemplateabout
msgid "About"
msgstr ""
#: lazarusidestrconsts:liscontributors
msgid "Contributors"
msgstr ""
#: lazarusidestrconsts:lischaractermap
msgid "Character Map"
msgstr ""
#: lazarusidestrconsts:lisctdefchoosedirectory
msgid "Choose Directory"
msgstr ""
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr ""
#: lazarusidestrconsts:lisctdefvariable
msgid "Variable: %s"
msgstr ""
#: lazarusidestrconsts:lisctdefnovariableselected
msgid "<no variable selected>"
msgstr ""
#: lazarusidestrconsts:lisctdefvariablename
msgid "Variable Name"
msgstr ""
#: lazarusidestrconsts:liscldircleansubdirectories
msgid "Clean sub directories"
msgstr ""
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr ""
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr ""
#: lazarusidestrconsts:liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr ""
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr ""
#: lazarusidestrconsts:liscldircleandirectory
msgid "Clean Directory"
msgstr ""
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr ""
#: lazarusidestrconsts:lisfixlfmfile
msgid "Fix LFM file"
msgstr ""
#: lazarusidestrconsts:lisnocodeselected
msgid "No code selected"
msgstr ""
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr ""
#: lazarusidestrconsts:lisinvalidselection
msgid "Invalid selection"
msgstr ""
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr ""
#: lazarusidestrconsts:lisextractprocedure
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts:lisnameofnewprocedure
msgid "Name of new procedure"
msgstr ""
#: lazarusidestrconsts:lisextract
msgid "Extract"
msgstr ""
#: lazarusidestrconsts:lisinvalidprocname
msgid "Invalid proc name"
msgstr ""
#: lazarusidestrconsts:lispublicmethod
msgid "Public Method"
msgstr ""
#: lazarusidestrconsts:lisprivatemethod
msgid "Private Method"
msgstr ""
#: lazarusidestrconsts:lisprotectedmethod
msgid "Protected Method"
msgstr ""
#: lazarusidestrconsts:lispublishedmethod
msgid "Published Method"
msgstr ""
#: lazarusidestrconsts:lisprocedure
msgid "Procedure"
msgstr ""
#: lazarusidestrconsts:lisprocedurewithinterface
msgid "Procedure with interface"
msgstr ""
#: lazarusidestrconsts:lissubprocedure
msgid "Sub Procedure"
msgstr ""
#: lazarusidestrconsts:lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr ""
#: lazarusidestrconsts:lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr ""
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr ""
#: lazarusidestrconsts:lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr ""
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr ""
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr ""
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr ""
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:lishlpoptshelpoptions
msgid "Help Options"
msgstr ""
#: lazarusidestrconsts:lishlpoptsviewers
msgid "Viewers"
msgstr ""
#: lazarusidestrconsts:lishlpoptsproperties
msgid "Properties:"
msgstr ""
#: lazarusidestrconsts:lishlpoptsdatabases
msgid "Databases"
msgstr ""
#: lazarusidestrconsts:lisencloseselection
msgid "Enclose Selection"
msgstr ""
#: lazarusidestrconsts:lisenclose
msgid "Enclose"
msgstr ""
#: lazarusidestrconsts:lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr ""
#: lazarusidestrconsts:liserrors
msgid "Errors"
msgstr ""
#: lazarusidestrconsts:lislfmfile
msgid "LFM file"
msgstr ""
#: lazarusidestrconsts:lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr ""
#: lazarusidestrconsts:liscomptest
msgid "Test"
msgstr ""
#: lazarusidestrconsts:lisa2pswitchpaths
msgid "Switch Paths"
msgstr ""
#: lazarusidestrconsts:lisa2paddfilestopackage
msgid "Add files to package"
msgstr ""
#: lazarusidestrconsts:lisa2paddtopackage
msgid "Add to package"
msgstr ""
#: lazarusidestrconsts:lisa2pfilename2
msgid "Filename"
msgstr ""
#: lazarusidestrconsts:lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr ""
#: lazarusidestrconsts:lisselectahelpitem
msgid "Select a help item:"
msgstr ""
#: lazarusidestrconsts:liserrormovingcomponent
msgid "Error moving component"
msgstr ""
#: lazarusidestrconsts:liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr ""
#: lazarusidestrconsts:lisinstalledpackages
msgid "Installed Packages"
msgstr ""
#: lazarusidestrconsts:lisavailablepackages
msgid "Available packages"
msgstr ""
#: lazarusidestrconsts:lisexportlist
msgid "Export list"
msgstr ""
#: lazarusidestrconsts:lisimportlist
msgid "Import list"
msgstr ""
#: lazarusidestrconsts:lisuninstallselection
msgid "Uninstall selection"
msgstr ""
#: lazarusidestrconsts:lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr ""
#: lazarusidestrconsts:lisinstallselection
msgid "Install selection"
msgstr ""
#: lazarusidestrconsts:lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr ""
#: lazarusidestrconsts:lissaveandexitdialog
msgid "Save and exit dialog"
msgstr ""
#: lazarusidestrconsts:lisalignment
msgid "Alignment"
msgstr ""
#: lazarusidestrconsts:lishorizontal
msgid "Horizontal"
msgstr ""
#: lazarusidestrconsts:lisnochange
msgid "No change"
msgstr ""
#: lazarusidestrconsts:listops
msgid "Tops"
msgstr ""
#: lazarusidestrconsts:lisleftsides
msgid "Left sides"
msgstr ""
#: lazarusidestrconsts:liscenters
msgid "Centers"
msgstr ""
#: lazarusidestrconsts:lisbottoms
msgid "Bottoms"
msgstr ""
#: lazarusidestrconsts:lisrightsides
msgid "Right sides"
msgstr ""
#: lazarusidestrconsts:liscenterinwindow
msgid "Center in window"
msgstr ""
#: lazarusidestrconsts:lisspaceequally
msgid "Space equally"
msgstr ""
#: lazarusidestrconsts:listopspaceequally
msgid "Top space equally"
msgstr ""
#: lazarusidestrconsts:lisbottomspaceequally
msgid "Bottom space equally"
msgstr ""
#: lazarusidestrconsts:lisleftspaceequally
msgid "Left space equally"
msgstr ""
#: lazarusidestrconsts:lisrightspaceequally
msgid "Right space equally"
msgstr ""
#: lazarusidestrconsts:lisvertical
msgid "Vertical"
msgstr ""
#: lazarusidestrconsts:lisscalingfactor
msgid "Scaling factor:"
msgstr ""
#: lazarusidestrconsts:liscustomprogram
msgid "Custom Program"
msgstr ""
#: lazarusidestrconsts:lisprogram
msgid "Program"
msgstr ""
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr ""
#: lazarusidestrconsts:lisnpselectaprojecttype
msgid "Select a project type"
msgstr ""
#: lazarusidestrconsts:lisnpcreateanewproject
msgid "Create a new project"
msgstr ""
#: lazarusidestrconsts:lisnpcreate
msgid "Create"
msgstr ""
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr ""
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr ""
#: lazarusidestrconsts:lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr ""
#: lazarusidestrconsts:lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr ""
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr ""
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr ""
#: lazarusidestrconsts:lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr ""
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr ""
#: lazarusidestrconsts:lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr ""
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr ""
#: lazarusidestrconsts:lisoldclass
msgid "Old Class"
msgstr ""
#: lazarusidestrconsts:lisnewclass
msgid "New Class"
msgstr ""
#: lazarusidestrconsts:lisoldancestors
msgid "Old Ancestors"
msgstr ""
#: lazarusidestrconsts:lisnewancestors
msgid "New Ancestors"
msgstr ""
#: lazarusidestrconsts:lisceocodeexplorer
msgid "CodeExplorer Options"
msgstr ""
#: lazarusidestrconsts:lisceoupdate
msgid "Update"
msgstr ""
#: lazarusidestrconsts:lisceorefreshautomatically
msgid "Refresh automatically"
msgstr ""
#: lazarusidestrconsts:lisceoneveronlymanually
msgid "Never, only manually"
msgstr ""
#: lazarusidestrconsts:lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr ""
#: lazarusidestrconsts:lisceoonidle
msgid "On idle"
msgstr ""
#: lazarusidestrconsts:lismenulazdoc
msgid "LazDoc Editor"
msgstr ""
#: lazarusidestrconsts:lislazdocmainformcaption
msgid "LazDoc editor"
msgstr ""
#: lazarusidestrconsts:lislazdocnotagcaption
msgid "<NONE>"
msgstr ""
#: lazarusidestrconsts:lislazdocnodocumentation
msgid "Documentation entry does not exist"
msgstr ""
#: lazarusidestrconsts:lislazdocshorttag
msgid "Short"
msgstr ""
#: lazarusidestrconsts:lislazdocdescrtag
msgid "Description"
msgstr ""
#: lazarusidestrconsts:lislazdocerrorstag
msgid "Errors"
msgstr ""
#: lazarusidestrconsts:lislazdocaddpathbutton
msgid "Add path"
msgstr ""
#: lazarusidestrconsts:lislazdocdeletepathbutton
msgid "Remove path"
msgstr ""
#: lazarusidestrconsts:lislazdocpathsgroupbox
msgid "LazDoc settings"
msgstr ""