lazarus/languages/lazaruside.nl.po
2017-05-22 22:25:41 +00:00

22025 lines
587 KiB
Plaintext

msgid ""
msgstr ""
"Project-Id-Version: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2007-06-05 09:18+0100\n"
"Last-Translator: Darius Blaszijk <dhkblaszyk@zeelandnet.nl>\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr ""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Plakken"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Algemeen"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr ""
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr ""
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Niet wijzigbaar"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Kleine letters, eerste letter hoofdletter"
#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr ""
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Regel"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr ""
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr ""
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr ""
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Bewerk bovenste lijn"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabetisch"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr ""
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Dubbelzinnig bestand actie:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Waarschuw voor compilatie"
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr ""
#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr ""
#: lazarusidestrconsts.dlgapplicationsettings
#, fuzzy
#| msgid "Application Settings"
msgid "Application settings"
msgstr "Applicatie instellingen"
#: lazarusidestrconsts.dlgassertcode
#, fuzzy
#| msgid "Include Assertion Code"
msgid "Include assertion code"
msgstr "Gebruik assertie code"
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automatisch maken van formulieren"
#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr ""
#: lazarusidestrconsts.dlgautocreatenewforms
#, fuzzy
#| msgid "When creating new forms, add them to auto-created forms"
msgid "Auto-create new forms"
msgstr "Nieuwe forms toevoegen aan de \"auto-created forms\""
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Verwijder bestand automatisch"
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr ""
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr ""
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr ""
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr ""
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Automatisch hernoemen bestand naar kleine letters"
#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr ""
#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end\n"
msgstr ""
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Beschikbare Forms:"
#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr ""
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr ""
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Achtergrond"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(geen subdirectory)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Dezelfde naam (in subdirectorie)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Achter methoden"
#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr ""
#: lazarusidestrconsts.dlgblockindent
#, fuzzy
#| msgid "Block indent"
msgid "Block indent (spaces)"
msgstr "Blok inspringen"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr ""
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr ""
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr ""
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgstr ""
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr ""
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr ""
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr ""
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr ""
#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr ""
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""
#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Klassevolgorde"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Laatste"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "Kleine letters"
#: lazarusidestrconsts.dlgcdtpreview
#, fuzzy
#| msgid "Preview (Max line length = 1)"
msgid "Preview (max line length = 1)"
msgstr "Voorbeeld (Max regellengte = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Lees voorloop"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Opgeslagen postfix"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "HOOFDLETTERS"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Variabele prefix"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Schrijf voorvoegsel"
#: lazarusidestrconsts.dlgcharcasefileact
#, fuzzy
#| msgid "Save As - auto rename pascal files lower case"
msgid "Save As - auto rename Pascal files lower case"
msgstr "Opslaan als - Pascal bestands namen converteren naar kleine letters."
#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr ""
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr ""
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr ""
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Kies code sjabloonbestand (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Toon sluitknoppen in notebook"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Kleuren schema"
#: lazarusidestrconsts.dlgcmacro
#, fuzzy
#| msgid "C Style Macros (global)"
msgid "C style macros (global)"
msgstr "C -stijl macro's (globaal)"
#: lazarusidestrconsts.dlgcoansistr
#, fuzzy
#| msgid "Use ansi strings"
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Gebruik ANSI strings"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr ""
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr ""
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr ""
#: lazarusidestrconsts.dlgcocops
#, fuzzy
#| msgid "C Style Operators (*=, +=, /= and -=)"
msgid "C style operators (*=, +=, /= and -=)"
msgstr "C -stijl Operators (*=, +=, /= and -=)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Maak MakeFile"
#: lazarusidestrconsts.dlgcodebugging
#, fuzzy
#| msgid "Debugging info"
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Debugging:"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Debugger pad toevoeging (geen):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Codecreatie"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""
#: lazarusidestrconsts.dlgcogdb
#, fuzzy
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "Genereer Debugging info voor GDB (Compileert langzamer)"
#: lazarusidestrconsts.dlgcoheaptrc
#, fuzzy
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Gebruik Heaptrc unit"
#: lazarusidestrconsts.dlgcoincfiles
#, fuzzy
#| msgid "Include Files (-Fi):"
msgid "Include files (-Fi):"
msgstr "Include bestanden (-Fi):"
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr ""
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Bibliotheken (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Linken"
#: lazarusidestrconsts.dlgcoloadsavehint
#, fuzzy
#| msgid "Load/Save"
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Laden/Bewaren"
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr ""
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr ""
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr ""
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Kleuren"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Command line parameters (zonder applicatie naam)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Make default indent for new line if comment opens at column:"
msgstr ""
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr ""
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend, if matched or not matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend, if matched or not matched (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend, if matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr ""
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Compileropties"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Completeer properties"
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr ""
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr ""
#: lazarusidestrconsts.dlgconfigfiles
#, fuzzy
#| msgid "Config Files:"
msgid "Config files"
msgstr "Configuratiebestanden:"
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr ""
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Overloop"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Ontleden"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr ""
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""
#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Bereik"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr ""
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr ""
#: lazarusidestrconsts.dlgcoshowerr
#, fuzzy
#| msgid "Show Errors"
msgid "Show errors"
msgstr "Toon fouten"
#: lazarusidestrconsts.dlgcoshowoptions
#, fuzzy
#| msgid "Show Options"
msgid "&Show Options"
msgstr "Toon opties"
#: lazarusidestrconsts.dlgcosmartlinkable
#, fuzzy
#| msgid "Smart Linkable"
msgid "Smart linkable"
msgstr "Slim te linken"
#: lazarusidestrconsts.dlgcosources
#, fuzzy
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Andere Bronnen (.pp / .pas bestanden, alleen door IDE gebruikt)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Stack"
#: lazarusidestrconsts.dlgcostrip
#, fuzzy
#| msgid "Strip Symbols From Executable"
msgid "Strip symbols from executable"
msgstr "Verwijderen symbolen uit het uitvoerbaar bestand."
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr ""
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr ""
#: lazarusidestrconsts.dlgcounitstyle
#, fuzzy
#| msgid "Unit Style"
msgid "Unit style"
msgstr "Unitstijl:"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Genereer code voor valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr ""
#: lazarusidestrconsts.dlgcppinline
#, fuzzy
#| msgid "C++ Styled INLINE"
msgid "C++ styled INLINE"
msgstr "C++-achtige INLINE"
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr ""
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr ""
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr ""
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Cursor voorbij EOL"
#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr ""
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Door gebruiker gedefinieerde extensie (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr ""
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Debuggertype en pad"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Standaard editorfont"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Standaardwaarde"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Verwijder template"
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr ""
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr ""
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr ""
#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr ""
#: lazarusidestrconsts.dlgdesktopsexported
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdesktopsimported
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr ""
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Richting"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr ""
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr ""
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr ""
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr ""
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr ""
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr ""
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr ""
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr ""
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr ""
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Terug"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Vet"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Subdirectorie"
#: lazarusidestrconsts.dlgedcodetempl
#, fuzzy
#| msgid "Code templates"
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Broncode templates"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr ""
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Door gebruiker gedefinieerde extensie"
#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr ""
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Beeld"
#: lazarusidestrconsts.dlgedfiles
#, fuzzy
#| msgid "Editor files"
msgid "Editor Files"
msgstr "Editor bestanden"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Identifier completering"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr ""
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Italic"
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr ""
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr ""
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr ""
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr ""
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr ""
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr ""
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr ""
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Onderstreep"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr ""
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Vraag"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Toelichting: Project bestanden zijn alle bestanden in de project directorie"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Backup"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Bestanden"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Raster"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Taal"
#: lazarusidestrconsts.dlgenvlanguagehint
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
msgstr ""
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Richtlijnen"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Overige"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Geen"
#: lazarusidestrconsts.dlgenvotherfiles
#, fuzzy
#| msgid "Other files"
msgid "Other Files"
msgstr "Andere bestanden"
#: lazarusidestrconsts.dlgenvproject
#, fuzzy
#| msgid "Project"
msgid "Tabs for project"
msgstr "Project"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Type"
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr ""
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr ""
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Extra regel afstand"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr ""
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Bestands extensie"
#: lazarusidestrconsts.dlgfiles
msgid "%s files"
msgstr ""
#: lazarusidestrconsts.dlgfilterall
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Alle bestanden"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphiproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Delphi project"
#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr ""
#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr ""
#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr ""
#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Lazarus Desktop instellingen"
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusfile
#, fuzzy
#| msgid "Lazarus File"
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Lazarus bestand"
#: lazarusidestrconsts.dlgfilterlazarusform
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Lazarus form"
#: lazarusidestrconsts.dlgfilterlazarusinclude
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Lazarus include bestand"
#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazaruspackage
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Lazarus pakket"
#: lazarusidestrconsts.dlgfilterlazarusproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Lazarus project"
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Lazarus project broncode"
#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Lazarus unit"
#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr ""
#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr ""
#: lazarusidestrconsts.dlgfilterxml
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "XML bestanden"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Zoek Tekst (op cursor)"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr ""
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr ""
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr ""
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Programma"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr ""
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr ""
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr ""
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Voorgrond kleur"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr ""
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr ""
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Wijze van procedures toevoegen"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Houd procedure volgorde aan"
#: lazarusidestrconsts.dlgfpcexecutable
msgid "Compiler executable (e.g. %s)"
msgstr ""
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "FPC broncode directory"
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr ""
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Formulierbewerker"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr ""
#: lazarusidestrconsts.dlgfromcursor
msgid "&From cursor"
msgstr ""
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "positie"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr ""
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Genereer code voor gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Kleur opnemen"
#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr ""
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Rasterkleur"
#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr ""
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Rastergrootte X"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Horizontale rasterafstand"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Rastergrootte Y"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Vertikale stapgrootte van raster"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr ""
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr ""
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Omgeving"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr ""
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Toon steunlijnen"
#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr ""
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr ""
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Goot kleur"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr ""
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Halve pagina scroll"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr ""
#: lazarusidestrconsts.dlgheapsize
#, fuzzy
#| msgid "Heap Size"
msgid "Heap size"
msgstr "Heap grootte"
#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr ""
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Hoogte:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Verberg IDE vensters bij uitvoeren"
#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr ""
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr ""
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr ""
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr ""
#: lazarusidestrconsts.dlghintsparametersendernotused
#, fuzzy
#| msgid "Show Hints for parameter \"Sender\" not used"
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Toon Hints voor parameter \"Sender\" niet gebruikt"
#: lazarusidestrconsts.dlghintsunused
#, fuzzy
#| msgid "Show Hints for unused units in main source"
msgid "Show hints for unused units in main"
msgstr "Toon Hints voor ongebruikte units in de hoofd broncode"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home toets springt naar dichtsbijzijnde begin"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Host applicatie"
#: lazarusidestrconsts.dlgidentifiercompletion
#, fuzzy
#| msgid "Identifier completion"
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Identifier completering"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Identifier beleid"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:\n"
msgstr ""
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Include systeemvariabelen"
#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr ""
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr ""
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Voor methoden"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Constructor naam moet zijn 'init' (destructor moet zijn 'done')"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr ""
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr ""
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr ""
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr ""
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Spatie achter invoegen"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Spatie voor invoegen"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Interval in seconden"
#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr ""
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Springen ('Method Jumping')"
#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr ""
#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr ""
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr ""
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr ""
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Toets mapping"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Toets mapping fouten"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Sleutelwoord policy"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Sta LABEL en GOTO toe"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Taal"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Laatste (einde broncode)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Lazarus directory (standaard voor alle projecten)"
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Links:"
#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "Guid lines Left,Top"
msgid "Guide lines Left,Top"
msgstr "Kleur voor links, boven"
#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly)"
msgstr ""
#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevel3opt
msgid "3 (-O2 + slow optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr ""
#: lazarusidestrconsts.dlglevelnoneopt
#, fuzzy
#| msgid "Level 0 (no extra optimizations)"
msgid "0 (no optimization)"
msgstr "Level 0 (geen extra optimalisaties)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Regel splitsen"
#: lazarusidestrconsts.dlglinksmart
#, fuzzy
#| msgid "Link Smart"
msgid "Link smart"
msgstr "Slim linken"
#: lazarusidestrconsts.dlglnumsbct
#, fuzzy
#| msgid "Display Line Numbers in Run-time Error Backtraces"
msgid "Display line numbers in run-time error backtraces"
msgstr "Toon regelnummers in Run-time Error Backtraces"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Hoofd menu"
#: lazarusidestrconsts.dlgmainviewforms
#, fuzzy
#| msgid "View project forms"
msgid "View Project Forms"
msgstr "Toon Project Forms"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr ""
#: lazarusidestrconsts.dlgmainviewunits
#, fuzzy
#| msgid "View project units"
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Toon Project Units"
#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr ""
#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr ""
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Marge en goot"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Marker kleur"
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight of Word under Caret"
msgstr ""
#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Verwijder"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Naam"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Word Brackets on caret (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable timer for markup current word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr ""
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximum teller"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Max regellengte"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Max aantal recente bestanden"
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Max aantal recente projecten"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mix methodes en properties"
#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Volgorde"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Selectie"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Fout"
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Multi-caret (column-select) move with cursor"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretmode
msgid "Multi-caret move with cursor"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi caret for column selection"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances
msgid "Multiple Lazarus instances"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr ""
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Meervoudige selectie"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find Editor for Jump Targets"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr ""
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr ""
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Naamgeving"
#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr ""
#: lazarusidestrconsts.dlgnoautomaticrenaming
#, fuzzy
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "niet automatisch hernoemen"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr ""
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr ""
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr ""
#: lazarusidestrconsts.dlgnotsplitlineafter
#, fuzzy
#| msgid "Do not split line after:"
msgid "Do not split line after"
msgstr "Splits een regel niet na :"
#: lazarusidestrconsts.dlgnotsplitlinefront
#, fuzzy
#| msgid "Do not split line In front of:"
msgid "Do not split line in front of"
msgstr "Splits een regel niet voor :"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr ""
#: lazarusidestrconsts.dlgoiitemheight
#, fuzzy
#| msgid "Item height"
msgid "Item height (0 = auto)"
msgstr "Item hoogte"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Overige"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr ""
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr ""
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr ""
#: lazarusidestrconsts.dlgotherunitfiles
#, fuzzy
#| msgid "Other unit files (-Fu) (delimiter is semicolon):"
msgid "Other unit files (-Fu):"
msgstr "Andere unit bestanden (-Fu)"
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr ""
#: lazarusidestrconsts.dlgoverwritedesktop
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?\n"
msgstr ""
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Hints voor componenten palet"
#: lazarusidestrconsts.dlgpasext
#, fuzzy
#| msgid "Default pascal extension"
msgid "Default Pascal extension"
msgstr "Standaard pascal extenties"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr ""
#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr ""
#: lazarusidestrconsts.dlgpassoptslinker
#, fuzzy
#| msgid "Pass options to linker (delimiter is space)"
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Geef opties door aan de linker (Spatie is scheidingsteken)"
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr ""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Standaard"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Geen"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr ""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr ""
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr ""
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Applicatie"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr ""
#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr ""
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr ""
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Forms"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr ""
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr ""
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr ""
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr ""
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr ""
#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr ""
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Overige"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr ""
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr ""
#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr ""
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sessie"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titel:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr ""
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr ""
#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr ""
#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest resource (and enable themes)"
msgstr ""
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr ""
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr ""
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Project Opties"
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr ""
#: lazarusidestrconsts.dlgprojfiles
#, fuzzy
#| msgid "Project files"
msgid "Project Files"
msgstr "Project bestanden"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr ""
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Propertie completering"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Propertie naam"
#: lazarusidestrconsts.dlgqopenlastprj
#, fuzzy
#| msgid "Open last project at start"
msgid "Open last project and packages at start"
msgstr "Open laatste project bij start"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Toon \"\"border spacing\"\""
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Toon grid"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Aan raster plakken"
#: lazarusidestrconsts.dlgreallydeletedesktop
msgid "Really delete desktop \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referentie"
#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr ""
#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr ""
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Vervang &alles"
#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace With"
msgid "&Replace with"
msgstr "&Vervang Door"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Rapporteer"
#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "Kleur voor rechts, onder"
#: lazarusidestrconsts.dlgrightclickselects
#, fuzzy
#| msgid "Right Click selects"
msgid "Right click selects"
msgstr "Rechts klikken selecteert"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Rechter marge"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Werkdirectory"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr ""
#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Creatie"
#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Selectie"
#: lazarusidestrconsts.dlgrunninginstancemodalerror
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s\n"
msgstr ""
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr ""
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Display (niet voor win32, bv. 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Omgeving"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Lokaal"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Systeem variabelen"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Gebruik display"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Gebruiker voorkeuren"
#: lazarusidestrconsts.dlgrunparameters
#, fuzzy
#| msgid "Run parameters"
msgid "Run Parameters"
msgstr "Start parameters"
#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr ""
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Bewaar bewerker informatie voor gesloten bestanden"
#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Sla alleen bewerker informatie op voor project bestanden"
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr ""
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Scroll met een minder"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr ""
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Toon scroll hint"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Scroll voorbij het einde van het bestand"
#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Scroll voorbij het eind van de regel"
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Zoekopdracht afgebroken door de gebruiker"
#: lazarusidestrconsts.dlgsearchcaption
#, fuzzy
#| msgid "Searching..."
msgid "Searching ..."
msgstr "Bezig met zoeken ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Paden"
#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr ""
#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr ""
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr ""
#: lazarusidestrconsts.dlgsetactivedesktop
msgid "Set active"
msgstr ""
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Geef alle element standaardwaarde"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Geef element standaardwaarde"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Geef property variabele een waarde"
#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr ""
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr ""
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of non-visual components"
msgstr ""
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Toon gecompileerde procedures"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Toon voorwaarden"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Toon debug informatie"
#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr ""
#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr ""
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Toon alles"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Toon info uitvoerbaar bestand (Win32)"
#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr ""
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Toon algemene info"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Toon goot hints"
#: lazarusidestrconsts.dlgshowhint
#, fuzzy
#| msgid "Show Hints"
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Toon Hints"
#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr ""
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Toon regelnummers"
#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr ""
#: lazarusidestrconsts.dlgshownotes
#, fuzzy
#| msgid "Show Notes"
msgid "Show notes"
msgstr "Toon notities"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Toon samenvatting"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Toon geteste bestanden"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Toon gebruikte bestanden"
#: lazarusidestrconsts.dlgshowwarnings
#, fuzzy
#| msgid "Show Warnings"
msgid "Show warnings"
msgstr "Toon waarschuwingen"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr ""
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr ""
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr ""
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Slimme tabs"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbool erachter (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Teller (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbool ervoor (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Aan steunlijnen plakken"
#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr ""
#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr ""
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Spatie"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Hints voor snelknoppen in hoofdbalk (openen, opslaan, ...)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Oorsprong"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr ""
#: lazarusidestrconsts.dlgstatickeyword
#, fuzzy
#| msgid "Static Keyword in Objects"
msgid "Static keyword in objects"
msgstr "\"Static\"-sleutelwoord in objecten"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Stop na aantal fouten:"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr ""
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr ""
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr ""
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr ""
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Syntax opties"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab laat blokken inspringen"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr ""
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabs naar spaties"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr ""
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr ""
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr ""
#: lazarusidestrconsts.dlgtargetplatform
#, fuzzy
#| msgid "Target Platform"
msgid "Target platform"
msgstr "Doelplatform:"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr ""
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr ""
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Folder voor bouwen van test projecten"
#: lazarusidestrconsts.dlgtexttofind
#, fuzzy
#| msgid "&Text to Find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "&Zoek tekst"
#: lazarusidestrconsts.dlgtoggledebugdesktop
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
msgid "Toggle as debug desktop"
msgstr ""
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Top:"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr ""
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Spatie aan het eind verwijderen"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Ongedaan maken na Opslaan"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr ""
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limiet ongedaan maken"
#: lazarusidestrconsts.dlgunitdepcaption
#, fuzzy
#| msgid "Unit dependencies"
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "Unit afhankelijkheden"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Verversen"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr ""
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr ""
#: lazarusidestrconsts.dlgusecodefolding
#, fuzzy
#| msgid "Code folding"
msgid "Code Folding"
msgstr "Code inschuiven"
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr ""
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr ""
#: lazarusidestrconsts.dlgusefpccfg
#, fuzzy
#| msgid "Use standard Compiler Config File (fpc.cfg)"
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Gebruik standaard compiler configuratie bestand (fpc.cfg)"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Gebruik start programma"
#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr ""
#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr ""
#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr ""
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr ""
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Gebruik syntax highlighting"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr ""
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr ""
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Waarde"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Aantal melding tijdens compilatie:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Zichtbare goot"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Zichtbare rechter marge"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr ""
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Breedte:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Venster"
#: lazarusidestrconsts.dlgwinpos
#, fuzzy
#| msgid "Window Positions"
msgid "Window positions"
msgstr "Venster Posities"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr ""
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Woorden"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Voorbeeld"
#: lazarusidestrconsts.dlgwritefpclogo
#, fuzzy
#| msgid "Write an FPC logo"
msgid "Write FPC logo"
msgstr "Maak een FPC logo"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Meervoudig geselecteerd componenten moeten van een enkel form zijn"
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr ""
#: lazarusidestrconsts.fdmdeleteselection
#, fuzzy
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Verwijder selectie"
#: lazarusidestrconsts.fdmmirrorhorizontal
#, fuzzy
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Spiegel horizontaal"
#: lazarusidestrconsts.fdmmirrorvertical
#, fuzzy
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Spiegel vertikaal"
#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Een terug"
#: lazarusidestrconsts.fdmorderforwardone
#, fuzzy
#| msgid "Forward one"
msgid "Forward One"
msgstr "Een vooruit"
#: lazarusidestrconsts.fdmordermovetoback
#, fuzzy
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Breng naar achter"
#: lazarusidestrconsts.fdmordermovetofront
#, fuzzy
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Breng naar voren"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr ""
#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as XML"
msgid "Save Form as XML"
msgstr "Sla formulier als xml op"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr ""
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Schaal"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Selecteer Alles"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr ""
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Grootte"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Optie: Snap to grid"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Optie: snap naar guide lijnen"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr ""
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr ""
#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr ""
#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr ""
#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgcolumnloc
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
msgid "Location"
msgstr ""
#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr ""
#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Bestanden toevoegen"
#: lazarusidestrconsts.lisa2paddfilestopackage
#, fuzzy
#| msgid "Add files to package"
msgid "Add Files to Package"
msgstr "Voeg bestanden toe aan pakket"
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Voeg aan pakket toe"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Dubbelzinnig ancestor type"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Dubbelzinnige klasse naam"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Dubbelzinnige unit naam"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Ancestor Type"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Gebroken Afhankelijkheden"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Klassenaam bestaat reeds"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr ""
#: lazarusidestrconsts.lisa2pcreatenewfile
#, fuzzy
#| msgid "Create new file"
msgid "Create New File"
msgstr "Maak een nieuw bestand"
#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr ""
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Afhankelijkheid"
#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: \"%s\""
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Bestand bestaat reeds"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File \"%s\" already exists in the package."
msgstr ""
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Bestand wordt gebruikt"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Bestandsnaam"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Bestand is geen unit"
#: lazarusidestrconsts.lisa2piconandsize
msgid "Icon (maximum 24x24):"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Ongeldige Ancestor Type"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Ongeldige Class naam"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Ongeldig bestand"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Ongeldige bestandsnaam"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Ongeldige unit naam"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, fuzzy
#| msgid "%s%s%s is not a valid unit name."
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" is geen geldige unit naam."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nieuwe Class naam:"
#: lazarusidestrconsts.lisa2pnewcomponent
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
msgid "New Component"
msgstr "Nieuw Component"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nieuw bestand"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, fuzzy
#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Geen pakket gevonden voor afhankelijkheid \"%s\".%sKies een bestaand pakket."
#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr ""
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Naam van pagina te lang"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Palette pagina:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascal units moeten de .pp of .pas extensie hebben"
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Bewaar bestand dialoogvenster"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Verkort of verleng bestandsnaam"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Toon alles"
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Wissel paden om"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, fuzzy
#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Het type van de ancestor \"%s\" heeft dezelfde naam als%sde unit \"%s\"."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, fuzzy
#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Het type van de ancestor \"%s\" is geen geldige pascal identifier."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, fuzzy
#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "De naam van de klasse \"%s\" en het type van de ancestor \"%s\" zijn gelijk."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, fuzzy
#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "De naam van de klasse \"%s\" bestaat al in%sPackage %s%sBestand: \"%s\""
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, fuzzy
#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "De naam van de klasse \"%s\" is dezelfde als%sde unit \"%s\"."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The class name %s%s%s is not a valid Pascal identifier."
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "De naam van de klasse \"%s\" is geen geldige pascal identifier."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, fuzzy
#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Het bestand \"%s\" is onderdeel van het huidige project.%sHet is niet aan te raden bestanden te delen tussen project en packages."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, fuzzy
#| msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "De bestandsnaam \"%s\" is onduidelijk, omdat het package geen standaard directorie heeft.%sGeef een bestandsnaam inclusief het pad."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, fuzzy
#| msgid "The package already has a dependency on the package %s%s%s."
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Het package heeft al een afhankelijkheid van package \"%s\"."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, fuzzy
#| msgid "The page name %s%s%s is too long (max 100 chars)."
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "De naam van de pagina \"%s\" is te lang (max. 100 letters)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, fuzzy
#| msgid "The unitname %s%s%s already exists in the package:%s%s"
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "De unitnaam \"%s\" bestaat al in het package:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, fuzzy
#| msgid "The unitname %s%s%s already exists in this package."
msgid "The unitname \"%s\" already exists in this package."
msgstr "De unitnaam \"%s\" bestaat al in dit package."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, fuzzy
#| msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "De naam van de unit \"%s\"%sen de bestandsnaam \"%s\" verschillen"
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
#, fuzzy
#| msgid "The unit name %s%s%s does not correspond to the filename."
msgid "The unit name \"%s\" does not correspond to the filename."
msgstr "De unitnaam \"%s\" correspondeert niet met de bestandsnaam."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, fuzzy
#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "De unitnaam \"%s\" is gelijk aan die van een geregistreerd component.%sDit kan tot vreemde foutmeldingen leiden."
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Unit bestand naam:"
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Unitnaam:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Unitnaam bestaat al"
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Unitnaam ongeldig"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr ""
#: lazarusidestrconsts.lisabort
#, fuzzy
msgctxt "lazarusidestrconsts.lisabort"
msgid "Abort"
msgstr "Afbreken"
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Alles afbreken"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Het laden afbreken"
#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr ""
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Het laden van het project afbreken"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr ""
#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr ""
#: lazarusidestrconsts.lisabout2
msgid "About %s"
msgstr ""
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr ""
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr ""
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Informatie over Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr ""
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Kan de lijst van medewerkers niet vinden."
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr ""
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, fuzzy
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgstr "A %s kan geen TControls bevatten.%sU kunt er alleen niet-visuele componenten op plaatsen."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr ""
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr ""
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr ""
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Activeer reguliere-expressiesyntax voor tekst en vervanging"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr ""
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr ""
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr ""
#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Toevoegen"
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr ""
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr ""
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr ""
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr ""
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr ""
#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr ""
#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr ""
#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr ""
#: lazarusidestrconsts.lisaddfilesindirectory
msgid "Add Files in Directory"
msgstr ""
#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr ""
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr ""
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr ""
#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr ""
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr ""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr ""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr ""
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr ""
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr ""
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr ""
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr ""
#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr ""
#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "%s aan het project toevoegen?"
#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr ""
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr ""
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr ""
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr ""
#: lazarusidestrconsts.lisaf2paddfiletoapackage
#, fuzzy
#| msgid "Add file to a package"
msgid "Add File to Package"
msgstr "Voeg bestand aan pakket toe"
#: lazarusidestrconsts.lisaf2pdestinationpackage
#, fuzzy
#| msgid "Destination Package"
msgid "Destination package"
msgstr "Doelpakket"
#: lazarusidestrconsts.lisaf2pfiletype
#, fuzzy
#| msgid "File Type"
msgid "File type"
msgstr "Bestandstype"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Ongeldig Package"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, fuzzy
#| msgid "Invalid package ID: %s%s%s"
msgid "Invalid package ID: \"%s\""
msgstr "Ongeldige package ID: \"%s\""
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Pakket niet wijzigbaar"
#: lazarusidestrconsts.lisaf2ppackagenotfound
#, fuzzy
#| msgid "Package %s%s%s not found."
msgid "Package \"%s\" not found."
msgstr "Pakket \"%s\" niet gevonden."
#: lazarusidestrconsts.lisaf2pshowall
#, fuzzy
#| msgid "Show All"
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Toon alles"
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Het package %s is niet wijzigbaar"
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
#, fuzzy
#| msgid "A file %s%s%s already exists.%sReplace it?"
msgid "A file \"%s\" already exists.%sReplace it?"
msgstr "Een bestand \"%s\" bestaat al.%sOverschrijven?"
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
msgid "A filter with the name \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr ""
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Uitlijning"
#: lazarusidestrconsts.lisallblockslooksok
#, fuzzy
#| msgid "All blocks looks ok."
msgid "All blocks look ok."
msgstr "Alle blokken zien er goed uit"
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr ""
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr ""
#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr ""
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr ""
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Sta het zoeken naar meerdere lijnen toe"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr ""
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr ""
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr ""
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr ""
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr ""
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr ""
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Dubbelzinnig bestand gevonden"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, fuzzy
#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Dubbelzinnig bestand gevonden: \"%s\"%sDit bestand kan worden verward met \"%s\"%sHet dubbelzinnige bestand verwijderen?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Dubbelzinnige bestanden gevonden"
#: lazarusidestrconsts.lisambiguousunitfound
#, fuzzy
#| msgid "Ambiguous Unit found"
msgid "Ambiguous unit found"
msgstr "Dubbelzinnige unit gevonden"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Anker bewerker - geen control geselecteerd"
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorsof
msgid "Anchors of %s"
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ankers van geselecteerde controls"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
#, fuzzy
#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "Bij het laden van %s is er laatst een fout opgetreden!%sDit project opnieuw laden?"
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr ""
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr ""
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Toepassen"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr ""
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""
#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr ""
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr ""
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Randruimte rond het control. De andere vier randruimtes worden opgeteld aan deze waarde."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Vraag voor het vervangen van gevonden tekst"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr ""
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr ""
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr ""
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr ""
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr ""
#: lazarusidestrconsts.lisautocheckmodifiedfiles
msgid "Automatically check (select) modified files"
msgstr ""
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr ""
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr ""
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr ""
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr ""
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr ""
#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Automatische kenmerken"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr ""
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr ""
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr ""
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr ""
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Backup bestand gefaald"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr ""
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Wijzigen van de package naam of de versie verbreekt afhankelijkheden. Moeten deze afhankelijkheden ook worden gewijzigd?%sKies Ja om alle weergegeven afhankelijkheden te wijzigen.%sKies Negeren om de afhankelijkheden te verbreken."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "begint met"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr ""
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "be less verbose, can be given multiple times"
msgstr ""
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "be more verbose, can be given multiple times"
msgstr ""
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr ""
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr ""
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr ""
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr ""
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Run commando"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr ""
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr ""
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr ""
#: lazarusidestrconsts.lisborderspace
#, fuzzy
#| msgid "BorderSpace"
msgid "Border space"
msgstr "Randruimte"
#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Bodem randruimte. Deze waarde wordt toegevoegd aan de basis randruimte en gebruikt voor de ruimte onder het control."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Bodem ankering"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Bodems"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Dit is het verwante control waaraan de bodemzijde is verankerd. Laat het leeg voor ouders."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Bodem gelijk gespaceerd"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr ""
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr ""
#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Toevoegen"
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Sluiten"
#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Verwijderen"
#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr ""
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr ""
#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "&Ingeschakeld"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr ""
#: lazarusidestrconsts.lisbtnquit
#, fuzzy
#| msgid "Quit"
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "Afsluiten"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr ""
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr ""
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Bouw"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr ""
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Bouw"
#: lazarusidestrconsts.lisbuildfollowingmodes
msgid "Build the following modes"
msgstr ""
#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr ""
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr ""
#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr ""
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr ""
#: lazarusidestrconsts.lisbuildmode
msgid "Build Mode: %s"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr ""
#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr ""
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Bouw nieuw project"
#: lazarusidestrconsts.lisbuildnumber
#, fuzzy
#| msgid "Build Number"
msgid "Build number"
msgstr "Bouw Number"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Bouw"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr ""
#: lazarusidestrconsts.lisbyte
msgid "%s byte"
msgstr ""
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr ""
#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr ""
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Annuleren"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr ""
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Laden van de unit annuleren"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Hernoemen annuleren"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr ""
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
#, fuzzy
#| msgid "Can not copy top level component."
msgid "Cannot copy top level component."
msgstr "Kan top-level component niet kopiëren."
#: lazarusidestrconsts.liscannotcreatefile
#, fuzzy
#| msgid "Cannot create file %s%s%s"
msgid "Cannot create file \"%s\""
msgstr "Kan bestand \"%s\" niet maken"
#: lazarusidestrconsts.liscannotexecute
msgid "cannot execute \"%s\""
msgstr ""
#: lazarusidestrconsts.liscannotfind
msgid "Cannot find %s"
msgstr ""
#: lazarusidestrconsts.liscannotfindexecutable
msgid "cannot find executable \"%s\""
msgstr ""
#: lazarusidestrconsts.liscannotfindlazarusstarter
#, fuzzy
#| msgid "Cannot find lazarus starter:%s%s"
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Kan Lazarus Starter niet vinden:%s%s"
#: lazarusidestrconsts.liscannotfindunit
msgid "Cannot find unit %s"
msgstr ""
#: lazarusidestrconsts.liscannotopenform
msgid "Cannot open form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsaveform
msgid "Cannot save form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsubstitutemacros
msgid "Cannot substitute macro \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr ""
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Alleen the class van TComponents kan gewijzigd worden."
#: lazarusidestrconsts.liscantfindavalidppu
msgid "Can't find a valid %s.ppu"
msgstr ""
#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr ""
#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr ""
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr ""
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr ""
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""
#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr ""
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr ""
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Fout"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr ""
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr ""
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr ""
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr ""
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr ""
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr ""
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr ""
#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr ""
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""
#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr ""
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr ""
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test Pascal file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr ""
#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr ""
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr ""
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr ""
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr ""
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr ""
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr ""
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr ""
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr ""
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr ""
#: lazarusidestrconsts.liscefilter
#, fuzzy
#| msgid "(Filter)"
msgid "(filter)"
msgstr "(Filter)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Volg cursor"
#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr ""
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr ""
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr ""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr ""
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr ""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr ""
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr ""
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr ""
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr ""
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr ""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr ""
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr ""
#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr ""
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centreer in window"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Middenpunten"
#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr ""
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr ""
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr ""
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nooit, alleen handmatig"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "On idle"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Automatisch verversen"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Ander"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Update"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Bij het wisselen van bestand in de bewerker"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr ""
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr ""
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr ""
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr ""
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr ""
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr ""
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr ""
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr ""
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr ""
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr ""
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr ""
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr ""
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr ""
#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr ""
#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr ""
#: lazarusidestrconsts.liscfeinfile
msgid "In file %s"
msgstr ""
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr ""
#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr ""
#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr ""
#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr ""
#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr ""
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr ""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr ""
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Wijzig"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr ""
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Wijzig Class"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr ""
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr ""
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr ""
#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr ""
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr ""
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr ""
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr ""
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr ""
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Karakter tabel"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr ""
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr ""
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ""
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ""
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr ""
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr ""
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ""
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr ""
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr ""
#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Kies een andere naam"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr ""
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr ""
#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr ""
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr ""
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr ""
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr ""
#: lazarusidestrconsts.lischoosecompilerexecutable
msgid "Choose compiler executable (%s)"
msgstr ""
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr ""
#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr ""
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Kies Delphi-unit (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Kies directory"
#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr ""
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Kies FPC-directory"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Kies Lazarus-directory"
#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr ""
#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Kies een van deze items om een nieuw bestand te maken"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Kies een van deze items om een nieuw Package te maken"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Kies een van deze items om een nieuw Project te maken"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Kies programmabroncode (*.pp, *.pas, *.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Kies structuur om selectie te omsluiten"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr ""
#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr ""
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr ""
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, fuzzy
#| msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "Class \"%s\" is geen geregistreerde componentklasse.%sKan niet plakken."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Klasse niet gevonden"
#: lazarusidestrconsts.lisclassnotfoundat
msgid "Class %s not found at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class \"%s\" of method \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Maak directory schoon"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Maak sub directory schoon"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Behoud alle Tekst bestanden"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Bewaar bestanden die aan het filter voldoen"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Overeenkomende bestanden verwijderen"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Eenvoudige syntax (* i.p.v. .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr ""
#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr ""
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Maak Lazarus-broncode schoon"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr ""
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr ""
#: lazarusidestrconsts.liscleanuppackage
msgid "Clean up package \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Unit pad opschonen?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Maak schoon"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr ""
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr ""
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""
#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr ""
#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr ""
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr ""
#: lazarusidestrconsts.lisclose
#, fuzzy
#| msgid "&Close"
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "&Sluiten"
#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Sluit alles"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr ""
#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr ""
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr ""
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "LCL Interface specifieke opties:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parameter"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr ""
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr ""
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr ""
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr ""
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr ""
#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr ""
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Dubbelzinnige, extra compiler configuratie bestand"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Aanroepen bij:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, fuzzy
#| msgid "%s%sClick OK if you are sure to do that."
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sKlik op OK als je zeker weet dat je dat wilt doen."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Opdracht:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr ""
#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr ""
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr ""
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Pad toevoegen"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr ""
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr ""
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Verwijder pad"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr ""
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr ""
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Voorbeeld"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr ""
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Voeg \"code\" opmaak-tag in"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Voeg \"schuin\" opmaak-tag in"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Voeg opmerking opmaak-tag in"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Voeg \"onderstreep\" opmaak-tag in"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Voeg var opmaak-tag in"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Overerfd"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<GEEN>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Zie ook"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Kort"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr ""
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr ""
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr ""
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr ""
#: lazarusidestrconsts.liscodetempladd
#, fuzzy
#| msgid "Add"
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Toevoegen"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Codesjabloon toevoegen"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
#, fuzzy
#| msgid " A token %s%s%s already exists! "
msgid " A token \"%s\" already exists! "
msgstr " Het teken \"%s\" bestaat al !"
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr ""
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Wijzig"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Commentaar:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Bewerk code template"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Fout"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Teken:"
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Actie: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, fuzzy
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Automatisch gemaakte nodes kunnen niet bewerkt worden,%stevens kunnen ze geen automatisch gemaakte Child nodes bevatten."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, automatisch gegenereerd"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
#, fuzzy
#| msgid "Auto generated nodes can not be edited."
msgid "Auto generated nodes cannot be edited."
msgstr "Automatisch gegenereerde nodes kunnen niet bewerkt worden."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor voor codeerhulpmiddelendefinities"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
#, fuzzy
#| msgid "compiler path"
msgid "Compiler path"
msgstr "Pad naar compiler"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Converteer node"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Maak definities voor %s folder"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Maak definities voor Free Pascal Compiler"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Maak definities voor Free Pascal SVN broncode"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Maak definities voor %s Project"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Maak FPC-macro's en paden voor een fpc-projectfolder"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definieer"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definieer recursief"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Verwijder node"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "The %s hoofddirectory,%swaar Borland alle %s broncode installeert.%sBijvoorbeeld C:/Program Files/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert,%sdie worden gebruikt door dit %s project.%sBijvoorbeeld: C:/Program Files/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Beschrijving:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s directory"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Verlaat zonder Opslaan"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "FPC SVN broncode directory"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Folder"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Delphi 5 Compiler Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Delphi 5 Directorie Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Delphi 5 Project Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Delphi 6 Compiler Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Delphi 6 Directorie Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Delphi 6 Project Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Delphi 7 Compiler Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Delphi 7 Directorie Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Delphi 7 Project Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Invoegen FP Compiler Template"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Invoegen FP project Template"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Voeg Free Pascal SVN broncode template in"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Kylix 3 Compiler template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Kylix 3 Directorie template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Kylix 3 Project template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Node als \"child\" invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Node onder invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Invoegen Template"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Ongeldige parent"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Ongeldige parent node"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Vorige node is ongeldig"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert.%sBijvoorbeeld: /home/user/kylis%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert,%sdie worden gebruikt door dit %s project.%sBijvoorbeeld: /home/user/kylis%s"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Verplaats node omlaag"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Verplaats node een level omlaag"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Verplaats node een level omhoog"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Verplaats node omhoog"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Naam:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "NieuweNode"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Node is niet wijzigbaar"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "geen geselecteerd"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
#, fuzzy
#| msgid "Parent node can not contain child nodes."
msgid "Parent node cannot contain child nodes."
msgstr "Parent node kan geen child nodes bevatten."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Vorige node kan geen child nodes bevatten"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s projectdirectory"
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Leesfout"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Opslaan en Afsluiten"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Geselecteerde node:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
#, fuzzy
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "De Free Pascal SVN-broncode directory. Niet verplicht. Het verbetert het declaraties zoeken en debuggen."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "De Free Pascal project directorie."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "De Free Pascal SVN-broncode directory."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, fuzzy
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Het pad naar de Free Pascal compiler.%s Bijv: %s/usr/bin/%s -n%s of %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
#, fuzzy
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Het pad naar de free pascal compiler voor dit project. Alleen nodig als je de bron FPC SVN hieronder zet. Wordt gebuikt om automatisch macros te maken."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "De %s project directorie,%swaar de .dpr, .dpk bestanden staan."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Ondefinieer"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Ondefinieer alles"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Ondefinieer recursie"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Waarde als tekst"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variabele:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Schrijffout"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Bij"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Dubbele punt"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Komma"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identifier"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Sleutelwoord"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nieuwe regel"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Geen"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Nummer"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Punt"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Puntkomma"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Spatie"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "String constante"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbool"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Voer uit Na"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Voer uit Voor"
#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr ""
#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr ""
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr ""
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr ""
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr ""
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr ""
#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr ""
#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr ""
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Commando-uitvoer"
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Opdracht na ongeldig"
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Opdracht na publiceren module"
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr ""
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Command line parameters van het programma"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Compileren"
#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr ""
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compiler"
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr ""
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Error: ongeldige compiler: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Compilerbestandsnaam"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
#, fuzzy
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Hint: u kunt het pad naar de compiler opgeven in Omgeving -> Omgevingsopties -> Bestanden -> Compiler Pad"
#: lazarusidestrconsts.liscompilermessagesfilenotfound
msgid "Compiler messages file not found:%s%s"
msgstr ""
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Opmerking: Configuratie bestand voor code tools niet gevonden - de standaard wordt gebruikt"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Opmerking: Oude configuratie bestand voor code tools wordt geladen: "
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Compileren"
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (compileren ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a Pascal keyword."
msgstr ""
#: lazarusidestrconsts.liscomponentnameiskeyword
#, fuzzy
#| msgid "Component name %s%s%s is keyword"
msgid "Component name \"%s\" is keyword"
msgstr "Componentnaam \"%s\" is sleutelwoord"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
#, fuzzy
#| msgid "Component name %s%s%s is not a valid identifier"
msgid "Component name \"%s\" is not a valid identifier"
msgstr "Component Naam \"%s\" is geen geldige identifier"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr ""
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Open een Pakket"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Open unit"
#: lazarusidestrconsts.liscomptest
#, fuzzy
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "Test"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr ""
#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr ""
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Lazarus configuratie directorie"
#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr ""
#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr ""
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr ""
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr ""
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr ""
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Bevestig wijzigingen"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr ""
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy
#| msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Wil je Lazarus opnieuw bouwen met profiel: %s?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr ""
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr ""
#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr ""
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr ""
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "bevat"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr ""
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Doorgaan"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr ""
#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr ""
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Doorgaan zonder het form te laden"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Medewerkers"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Parent vereist voor control"
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr ""
#: lazarusidestrconsts.lisconvaddingflagforregister
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr ""
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
msgid "\")\" is missing from replacement function: %s"
msgstr ""
#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr ""
#: lazarusidestrconsts.lisconvconvertedfrom
msgid " { *Converted from %s* }"
msgstr ""
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""
#: lazarusidestrconsts.lisconvdeletedfile
msgid "Deleted file %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
msgid "Added unit \"%s\" to uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr ""
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr ""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr ""
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr ""
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""
#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
msgid "Removed unit \"%s\" from uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr ""
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Conversiefout"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr ""
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr ""
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr ""
#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr ""
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr ""
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr ""
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconvfixedunitname
msgid "Fixed unit name from %s to %s."
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr ""
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr ""
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr ""
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsfindingallunits
msgid "Problems when trying to find all units from project file %s"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
msgid "Problems when fixing include files in file %s"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
msgid "Problems when repairing form file %s"
msgstr ""
#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr ""
#: lazarusidestrconsts.lisconvreplacedcall
msgid "Replaced call %s with %s"
msgstr ""
#: lazarusidestrconsts.lisconvreplfuncparameternum
msgid "Replacement function parameter number should be >= 1: %s"
msgstr ""
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
msgid "\"$\" should be followed by a number: %s"
msgstr ""
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr ""
#: lazarusidestrconsts.lisconvthislogwassaved
msgid "This log was saved to %s"
msgstr ""
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr ""
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr ""
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
msgid "User selected to end conversion with file %s"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr ""
#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyleitem0
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Geen"
#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr ""
#: lazarusidestrconsts.liscoolbarcodeexplorer
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.liscoolbarcodetemplates
#, fuzzy
#| msgid "Code templates"
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Broncode templates"
#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr ""
#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr ""
#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr ""
#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr ""
#: lazarusidestrconsts.liscoolbarmessages
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr ""
#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr ""
#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr ""
#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr ""
#: lazarusidestrconsts.liscoolbarsourceeditor
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr ""
#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr ""
#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr ""
#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Kopiëren"
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr ""
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Kopieerfout"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Kopieerfout"
#: lazarusidestrconsts.liscopyfilename
msgid "Copy Filename %s"
msgstr ""
#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy \"%s\" to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Een geheel formulier kopiëren is niet geimplementeerd."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr ""
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
#, fuzzy
#| msgid "Copy selected messages to clipboard"
msgid "Copy Selected Messages to Clipboard"
msgstr "Kopieer de geselecteerde boodschap naar het klembord"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Zoek naar FPC meldingen"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Zoek naar Make meldingen"
#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr ""
#: lazarusidestrconsts.liscoskipcallingcompiler
#, fuzzy
#| msgid "Skip calling Compiler"
msgid "Skip calling compiler"
msgstr "Sla compiler aanroep over"
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add \"{$I %s}\" to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add \"{$R %s}\" to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add \"%s\" to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove \"%s\" from main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove \"{$I %s}\" from main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove \"{$R %s}\" from main source!"
msgstr ""
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
#, fuzzy
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Waarschuwing: Het extra compiler configuratie bestand heeft dezelfde naam als een van de standaard configuratie bestanden waar de FreePascal compiler naar zoekt. Dit kan leiden tot het alleen verwerken van het extra configuratie bestand en het overslaan van de standaard configuraite."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Open Pakket %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Open unit %s"
#: lazarusidestrconsts.liscpu
msgid ", CPU: %s"
msgstr ""
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Maak eerst een project!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr ""
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr ""
#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr ""
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr ""
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr ""
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr ""
#: lazarusidestrconsts.liscreatelocalvariable
msgid "Create local variable \"%s\""
msgstr ""
#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr ""
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr ""
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr ""
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr ""
#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Kies directory"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Codeerhulpmiddelen mappen instellingen"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definieer templates"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Geen variabele geselecteerd>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Open voorbeeld"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Hulpmiddelen"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Variabele: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Variabelenaam"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Templates"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr ""
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr ""
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "selecteer een macro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Selecteer Code Macro"
#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr ""
#: lazarusidestrconsts.liscurrentlclwidgetset
msgid "Current LCL widgetset: \"%s\""
msgstr ""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr ""
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Cursor kolom in huidige editor"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Cursor rij in huidige editor"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr ""
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "aanpasbare opties"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Aanpasbare Opties"
#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr ""
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Aanpasbaar Programma"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr ""
#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Knippen"
#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr ""
#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr ""
#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr ""
#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr ""
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr ""
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Datum"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr ""
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to Clipboard"
msgstr ""
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr ""
#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr ""
#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr ""
#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr ""
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr ""
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr ""
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Verwijder"
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr ""
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Geen debugger aangegeven"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Zet toch een breekpunt"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, fuzzy
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Er is geen debugger ingesteld.%sHet plaatsen van breakpoints heeft geen effect totdat je een debugger hebt aangegeven in de Debugger Instellingen in het menu."
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr ""
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr ""
#: lazarusidestrconsts.lisdebug
#, fuzzy
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Debugger error%sOeps, de debugger is gecrashed%sSla uw werk op!%sKies Stop, en hoop voor het beste!"
#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr ""
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Debugger ongeldig"
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (aan het debuggen ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Additioneel zoekpad"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Breekpunt"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Maak schoon log on run"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Algemene debugger opties"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Specifieke opties debugger (hangt af van het type debugger)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Negeer deze exceptions"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Taal uitzonderingen"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
#, fuzzy
#| msgid "Limit linecount to"
msgid "Limit line count to"
msgstr "Beperk regeltelling tot"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proces"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Hervat"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Ga verder"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Ga verder met overige"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Toon meldingen bij stoppen"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signalen"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Kan het bestand niet laden"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, fuzzy
#| msgid "Unable to load file %s%s%s."
msgid "Unable to load file \"%s\"."
msgstr "Kan het bestand \"%s\" niet laden."
#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr ""
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Standaard"
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr ""
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr ""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr ""
#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr ""
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr ""
#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Verwijder"
#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr ""
#: lazarusidestrconsts.lisdeleteaddition
msgid "Delete addition \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr ""
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Al deze bestanden verwijderen?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Verwijder dubbelzinnig bestand?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Verwijderen bestand mislukt"
#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdeleteoldfile
#, fuzzy
#| msgid "Delete old file %s%s%s?"
msgid "Delete old file \"%s\"?"
msgstr "Verwijder oud bestand \"%s\"?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr ""
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr ""
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr ""
#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr ""
#: lazarusidestrconsts.lisdeletingoffilefailed
#, fuzzy
#| msgid "Deleting of file %s%s%s failed."
msgid "Deleting of file \"%s\" failed."
msgstr "Verwijderen van bestand \"%s\" mislukt."
#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr ""
#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr ""
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr ""
#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Doeldirectorie"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Hoofd/kleine letter ongevoelig"
#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Negeer toevoegingen en verwijderingen van lege regels"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Negeer verschillen in regeleinden (bv. #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Aantal te negeren spaties"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Negeer spaties (regelscheiding karakters niet meegeteld)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Negeer spaties aan regeleinde"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Negeer spaties aan begin van regel"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Alleen de selectie"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
#, fuzzy
#| msgid "Open Diff in editor"
msgid "Open difference in editor"
msgstr "Toon verschillen in bewerker"
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
msgid "different unit %s found at new position \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr ""
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr ""
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr ""
#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr ""
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr ""
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr ""
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr ""
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr ""
#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr ""
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr ""
#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr ""
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr ""
#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr ""
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Wijzigingen verwerpen"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Klik op een van de bovenstaande items om het verschil te zien"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Fout bij lezen bestand: %s"
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Bepaalde bestanden zijn gewijzigd op schijf:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Maak onderscheid tussen hoofd- en kleine letters. Bijv. A en a"
#: lazarusidestrconsts.lisdlgadd
#, fuzzy
#| msgid "Add..."
msgctxt "lazarusidestrconsts.lisdlgadd"
msgid "Add ..."
msgstr "Toevoegen ..."
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr ""
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr ""
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr ""
#: lazarusidestrconsts.lisdlgedit
#, fuzzy
#| msgid "Edit..."
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Bewerken ..."
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Exporteer ..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr ""
#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr ""
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr ""
#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Opslaan ..."
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exist: %s"
msgstr ""
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr ""
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "%sDo not check if another IDE instance is already running"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Sluit project niet"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr ""
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Splashscherm niet tonen"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr ""
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr ""
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Omlaag"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr ""
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr ""
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr ""
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kopieer geselecteerde componenten naar klipbord"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Knip geselecteerde componenten naar klipbord"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Verplaats component een terug"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Verplaats component een vooruit"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Stuur component naar achteren"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Breng component naar voren"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Plak geselecteerde componenten van het klembord"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Selecteer het parent component"
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr ""
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr ""
#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr ""
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr ""
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr ""
#: lazarusidestrconsts.lisduplicateunitin
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Bewerken"
#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr ""
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr ""
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr ""
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr ""
#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr ""
#: lazarusidestrconsts.liseditormacros
msgid "Editor macros"
msgstr ""
#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr ""
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr ""
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Alle pakketten"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Huidig project"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Alle projecten"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "zet FPC DELPHI-mode aan"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "zet FPC GPC-mode aan"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "zet FPC TP-mode aan"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "zet IO-controles aan"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "zet OVERFLOW controles aan"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "zet RANGE controles aam"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "gebruik HeapTrc-unit"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "gebruik LineInfo-unit"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Een geldige Tool heeft tenminste een titel en een bestandsnaam nodig."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Bewerk Tool"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Toets"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Macros"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parameters:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Programma bestandsnaam:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
#, fuzzy
#| msgid "Scan output for Free Pascal Compiler messages"
msgid "Scan output for FPC messages"
msgstr "Doorzoek output op Free Pascal Compiler meldingen"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
#, fuzzy
#| msgid "Scan output for make messages"
msgid "Scan output for \"make\" messages"
msgstr "Doorzoek outpput op make meldingen"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titel en bestandsnaam nodig"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Werkdirectory:"
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr ""
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr ""
#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr ""
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr ""
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr ""
#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr ""
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr ""
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr ""
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr ""
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr ""
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr ""
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr ""
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr ""
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Ingeschakeld"
#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr ""
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr ""
#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr ""
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Schakel Macro's in"
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr ""
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Omsluit"
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr ""
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
msgid "Number of files failed to convert: %d"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr ""
#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr ""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr ""
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Folder niet gevonden"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Ongeldige debugger bestandsnaam"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Het debuggerbestand \"%s\" is niet uitvoerbaar."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Test directory \"%s\" niet gevonden."
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Ongeldige optie op positie %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr ""
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr ""
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Fout:"
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Fout bij maken bestand"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Fout bij verwijderen bestand"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Fout in %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr ""
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr ""
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr ""
#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "Error: (lazarus) invalid build mode \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":"
msgstr ""
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Fout bij verplaatsen component"
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Fout bij verplaatsen component %s;%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr ""
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr ""
#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr ""
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Fout bij het verwerken van de lfm componenten stream."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Error bij lezen pakket lijst uit bestand%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr ""
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file \"%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Fout bij herbenoemen bestand"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Fouten"
#: lazarusidestrconsts.liserrors2
msgid ", Errors: %s"
msgstr ""
#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr ""
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Error bij schrijven pakketlijst naar bestand%s%s%s%s"
#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr ""
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr ""
#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr ""
#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr ""
#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr ""
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number"
msgstr ""
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr ""
#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""
#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr ""
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr ""
#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr ""
#: lazarusidestrconsts.lisexcludefilter
#, fuzzy
#| msgid "Exclude Filter"
msgid "Exclude filter"
msgstr "Uitzonderingen filter"
#: lazarusidestrconsts.lisexecutableisadirectory
msgid "executable \"%s\" is a directory"
msgstr ""
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
msgid "executable \"%s\" lacks the permission to run"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Voer het commando uit Na"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Voer het commando uit Voor"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Uitvoering afgebroken"
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Verlaat"
#: lazarusidestrconsts.lisexitcode
msgid "Exit code %s"
msgstr ""
#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr ""
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr ""
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr ""
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Volledige bestandsnaam van huidige editor bestand"
#: lazarusidestrconsts.lisexport
#, fuzzy
#| msgid "Export ..."
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Exporteer ..."
#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr ""
#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr ""
#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr ""
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr ""
#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr ""
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Export lijst"
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr ""
#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr ""
#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr ""
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr ""
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
msgid "Extend include files search path of project with%s\"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisextendincludepath
msgid "Extend include path?"
msgstr ""
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Unit path uitbreiden?"
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
msgid "Extend unit search path of project with%s\"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Destilleer"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr ""
#: lazarusidestrconsts.lisexttoolexternaltools
#, fuzzy
#| msgid "External tools"
msgid "External Tools"
msgstr "Externe gereedschappen"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Maximum aantal Hulpmiddelen bereikt"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Er is een maximum van %s hulpmiddelen"
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
msgid "Failed to add %d not unique resource(s)"
msgstr ""
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr ""
#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr ""
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr ""
#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr ""
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Beperk het opnieuw tekenen"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
#, fuzzy
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Teken designer items in idle tijd (reduceert overhead voor langzame computers)"
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Bestand"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr ""
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
#, fuzzy
#| msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Bestand \"%s\"%slijkt niet op een tekst bestand.%sToch openen?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr ""
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr ""
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr ""
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File \"%s\" has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr ""
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr ""
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr ""
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Bestand is niet wijzigbaar"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr ""
#: lazarusidestrconsts.lisfileisvirtual
#, fuzzy
#| msgid "File %s%s%s is virtual."
msgid "File \"%s\" is virtual."
msgstr "Bestand \"%s\" is Virtual."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr ""
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr ""
#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Bestand niet gevonden"
#: lazarusidestrconsts.lisfilenotfound2
#, fuzzy
#| msgid "File %s%s%s not found.%s"
msgctxt "lazarusidestrconsts.lisfilenotfound2"
msgid "File \"%s\" not found."
msgstr "Bestand \"%s\" niet gevonden."
#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound5
msgid "File not found:%s%s"
msgstr ""
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, fuzzy
#| msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "Bestand \"%s\" niet gevonden.%sWilt u het bestand maken?"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Bestand niet met kleine letters"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Bestand is geen tekst"
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr ""
#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr ""
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr ""
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "bestand, waar de debug uitvoer naar geschreven wordt. Als dit niet wordt gegeven, wordt de uitvoer naar de console geschreven."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr ""
#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr ""
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr ""
#: lazarusidestrconsts.lisfilterallmessagesoftype
msgid "Filter all messages of type %s"
msgstr ""
#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr ""
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr ""
#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr ""
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr ""
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr ""
#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr ""
#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr ""
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr ""
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr ""
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr ""
#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr ""
#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr ""
#: lazarusidestrconsts.lisfinddeclarationof
msgid "Find Declaration of %s"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr ""
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr ""
#: lazarusidestrconsts.lisfindfileincludesubdirectories
#, fuzzy
#| msgid "Include sub directories"
msgid "Include &sub directories"
msgstr "Include sub directories"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Alleen tekst bestanden"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr ""
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Waar"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr ""
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr ""
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr ""
#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr ""
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Repareer .lfm-bestand"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr ""
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Hernoemen afdwingen"
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr ""
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr ""
#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr ""
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Formatteerfout"
#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr ""
#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr ""
#: lazarusidestrconsts.lisfpccfgismissing
msgid "fpc.cfg is missing."
msgstr ""
#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr ""
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr ""
#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr ""
#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr ""
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr ""
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr ""
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr ""
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr ""
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr ""
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr ""
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr ""
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr ""
#: lazarusidestrconsts.lisfreeingbufferlines
msgid "freeing buffer lines: %s"
msgstr ""
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
#, fuzzy
#| msgid "Freepascal source directory"
msgid "Free Pascal source directory"
msgstr "FreePascal bronnen directory"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr ""
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Additionele bestanden om te zoeken (d.w.z. /pad/*.pas, /pad2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Vind of hernoem identifier"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Zoek referenties"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identifier: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "in alle geopende packages en projecten"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "in huidige unit"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "in hoofd project"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "in het project/package waar de huidige unit toebehoort"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Ongeldige Identifier"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Hernoem alle referenties"
#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr ""
#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr ""
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Zoek ook in commentaar"
#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr ""
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr ""
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Algemeen"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr ""
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr ""
#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr ""
#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr ""
#: lazarusidestrconsts.lisgotoselected
msgid "Goto selected"
msgstr ""
#: lazarusidestrconsts.lisgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr ""
#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr ""
#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr ""
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr ""
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr ""
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr ""
#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr ""
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Header commentaar voor klasse"
#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Help"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr ""
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Help selecteren"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr ""
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr ""
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr ""
#: lazarusidestrconsts.lishidewindow
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr ""
#: lazarusidestrconsts.lishidewithpackageoptionvm
msgid "Hide with package option (-vm%s)"
msgstr ""
#: lazarusidestrconsts.lishidewithprojectoptionvm
msgid "Hide with project option (-vm%s)"
msgstr ""
#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr ""
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr ""
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr ""
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr ""
#: lazarusidestrconsts.lishints
msgid ", Hints: %s"
msgstr ""
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Alles Opslaan"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Step Into"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr ""
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Step Over"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr ""
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Schakel tussen Form/Unit"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Toon Forms"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Toon Units"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr ""
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Databases"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Help Opties"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Properties"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Viewers"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "FPC Doc HTML pad"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontaal"
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr ""
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr ""
#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr ""
#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr ""
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr ""
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr ""
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr ""
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr ""
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr ""
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr ""
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr ""
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr ""
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr ""
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr ""
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr ""
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr ""
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr ""
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr ""
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "IDE opties:"
#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr ""
#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr ""
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr ""
#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr ""
#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr ""
#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr ""
#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr ""
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
msgid "Error opening XML file \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr ""
#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Laad van bestand"
#: lazarusidestrconsts.lisieconocompileroptionsinfile
msgid "File \"%s\" does not contain compiler options."
msgstr ""
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Recente bestanden"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Sla bestand op"
#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr ""
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr ""
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr ""
#: lazarusidestrconsts.lisignore
#, fuzzy
msgctxt "lazarusidestrconsts.lisignore"
msgid "Ignore"
msgstr "Negeren"
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr ""
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr ""
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Negeer binaire bestanden"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr ""
#: lazarusidestrconsts.lisignoreuseasancestor
msgid "Ignore, use %s as ancestor"
msgstr ""
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr ""
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr ""
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr ""
#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr ""
#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr ""
#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr ""
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr ""
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Import lijst"
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr ""
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr ""
#: lazarusidestrconsts.lisincludefilter
#, fuzzy
#| msgid "Include Filter"
msgid "Include filter"
msgstr "Include filter"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "pad gebruiken"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Include pad"
#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr ""
#: lazarusidestrconsts.lisincompatibleppu
msgid ", incompatible ppu=%s"
msgstr ""
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr ""
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr ""
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr ""
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr ""
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informatie over %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr ""
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr ""
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr ""
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr ""
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr ""
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr ""
#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Invoegen"
#: lazarusidestrconsts.lisinsertassignment
msgid "Insert Assignment %s := ..."
msgstr ""
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr ""
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName, // extract/add ClassName.\n"
"WithoutClassName, // skip classname\n"
"WithoutName, // skip function name\n"
"WithoutParamList, // skip param list\n"
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes, // skip colon, param types and default values\n"
"WithDefaultValues, // extract default values\n"
"WithResultType, // extract colon + result type\n"
"WithOfObject, // extract 'of object'\n"
"WithCallingSpecs, // extract cdecl; inline;\n"
"WithProcModifiers, // extract forward; alias; external;\n"
"WithComments, // extract comments and spaces\n"
"InUpperCase, // turn to uppercase\n"
"CommentsToSpace, // replace comments with a single space\n"
" // (default is to skip unnecessary space,\n"
" // e.g 'Do ;' normally becomes 'Do;'\n"
" // with this option you get 'Do ;')\n"
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon, // skip semicolon at end\n"
msgstr ""
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Macro invoegen"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure."
msgstr ""
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr ""
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr ""
#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr ""
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr ""
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr ""
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr ""
#: lazarusidestrconsts.lisinspectclassinherit
msgid "%s : Class %s inherits from %s"
msgstr ""
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr ""
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr ""
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr ""
#: lazarusidestrconsts.lisinspectpointerto
msgid "Pointer to %s"
msgstr ""
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr ""
#: lazarusidestrconsts.lisinspectunavailable
msgid "%s : unavailable"
msgstr ""
#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr ""
#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr ""
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Installatie mislukt"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr ""
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Installeer selectie"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr ""
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr ""
#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr ""
#: lazarusidestrconsts.lisinternalerror
msgid "internal error: %s"
msgstr ""
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Ongeldig commando"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Ongeldige verwijdering"
#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr ""
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
msgid "The file \"%s\" is not executable."
msgstr ""
#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Ongeldige expressie.%sHint: De \"Make Resourcestring\" Functie verwacht een string in een enkel bestand. Selecteer de expressie en probeer het opnieuw."
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr ""
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrosin
msgid "Invalid macros in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr ""
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr ""
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Ongeldige meervoudige selectie"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr ""
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr ""
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Ongeldige Pascal Identifier"
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
#, fuzzy
#| msgid "The name \"%s\" is not a valid pascal identifier."
msgid "The name \"%s\" is not a valid Pascal identifier."
msgstr "De naam \"%s\" is geen geldige pascal identifier."
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Ongeldige proc naam"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Ongeldige project bestandsnaam"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Ongeldige selectie"
#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr ""
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s is al deel van het project."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, fuzzy
#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"%s\" is geen geldige projectnaam.%s(Geldig is bijvoorbeeld: project1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr ""
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr ""
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr ""
#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr ""
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr ""
#: lazarusidestrconsts.lisjumptoprocedure
msgid "Jump to procedure %s"
msgstr ""
#: lazarusidestrconsts.liskb
msgid "%s KB"
msgstr ""
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr ""
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr ""
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr ""
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Houd naam"
#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr ""
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr ""
#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr ""
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr ""
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Toets"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Aanpasbare commando's"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Designer acties"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Object Inspecteur commando's"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr ""
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr ""
#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr ""
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr ""
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klassiek"
#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Sluit project"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr ""
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr ""
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr ""
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Context gevoellige help"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Converteer Delphi pakket naar Lazarus pakket"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project"
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Converteer Delphi project naar Lazarus project"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit"
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Converteer Delphi unit naar Lazarus unit"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
#, fuzzy
#| msgid "Convert DFM file to LFM"
msgid "Convert DFM File to LFM"
msgstr "Converteer DFM bestand naar LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected components"
msgstr ""
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected components"
msgstr ""
#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to OS X"
msgstr ""
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Verwijder laatste karakter"
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr ""
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Bewerk Code Templates"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr ""
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr ""
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Evalueer/bewerk"
#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr ""
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr ""
#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker0
#, fuzzy
#| msgid "Go to marker 0"
msgid "Go to bookmark 0"
msgstr "Ga naar marker 0"
#: lazarusidestrconsts.liskmgotomarker1
#, fuzzy
#| msgid "Go to marker 1"
msgid "Go to bookmark 1"
msgstr "Ga naar marker 1"
#: lazarusidestrconsts.liskmgotomarker2
#, fuzzy
#| msgid "Go to marker 2"
msgid "Go to bookmark 2"
msgstr "Ga naar marker 2"
#: lazarusidestrconsts.liskmgotomarker3
#, fuzzy
#| msgid "Go to marker 3"
msgid "Go to bookmark 3"
msgstr "Ga naar marker 3"
#: lazarusidestrconsts.liskmgotomarker4
#, fuzzy
#| msgid "Go to marker 4"
msgid "Go to bookmark 4"
msgstr "Ga naar marker 4"
#: lazarusidestrconsts.liskmgotomarker5
#, fuzzy
#| msgid "Go to marker 5"
msgid "Go to bookmark 5"
msgstr "Ga naar marker 5"
#: lazarusidestrconsts.liskmgotomarker6
#, fuzzy
#| msgid "Go to marker 6"
msgid "Go to bookmark 6"
msgstr "Ga naar marker 6"
#: lazarusidestrconsts.liskmgotomarker7
#, fuzzy
#| msgid "Go to marker 7"
msgid "Go to bookmark 7"
msgstr "Ga naar marker 7"
#: lazarusidestrconsts.liskmgotomarker8
#, fuzzy
#| msgid "Go to marker 8"
msgid "Go to bookmark 8"
msgstr "Ga naar marker 8"
#: lazarusidestrconsts.liskmgotomarker9
#, fuzzy
#| msgid "Go to marker 9"
msgid "Go to bookmark 9"
msgstr "Ga naar marker 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr ""
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Voeg datum en tijd in"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Voeg gebruikersnaam in"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspecteer"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Toets mapping schema"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr ""
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr ""
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr ""
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr ""
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nieuw project"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nieuw project van bestand"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr ""
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr ""
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Open pakket bestand"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
#, fuzzy
#| msgid "Paste Components from clipboard"
msgid "Paste Components"
msgstr "Plak componenten van clipboard"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Pauseer programma"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publiceer project"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr ""
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Run programma"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr ""
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr ""
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Sla project op"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Sla project op als"
#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr ""
#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr ""
#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr ""
#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr ""
#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr ""
#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr ""
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker0
#, fuzzy
#| msgid "Set marker 0"
msgid "Set bookmark 0"
msgstr "Zet marker 0"
#: lazarusidestrconsts.liskmsetmarker1
#, fuzzy
#| msgid "Set marker 1"
msgid "Set bookmark 1"
msgstr "Zet marker 1"
#: lazarusidestrconsts.liskmsetmarker2
#, fuzzy
#| msgid "Set marker 2"
msgid "Set bookmark 2"
msgstr "Zet marker 2"
#: lazarusidestrconsts.liskmsetmarker3
#, fuzzy
#| msgid "Set marker 3"
msgid "Set bookmark 3"
msgstr "Zet marker 3"
#: lazarusidestrconsts.liskmsetmarker4
#, fuzzy
#| msgid "Set marker 4"
msgid "Set bookmark 4"
msgstr "Zet marker 4"
#: lazarusidestrconsts.liskmsetmarker5
#, fuzzy
#| msgid "Set marker 5"
msgid "Set bookmark 5"
msgstr "Zet marker 5"
#: lazarusidestrconsts.liskmsetmarker6
#, fuzzy
#| msgid "Set marker 6"
msgid "Set bookmark 6"
msgstr "Zet marker 6"
#: lazarusidestrconsts.liskmsetmarker7
#, fuzzy
#| msgid "Set marker 7"
msgid "Set bookmark 7"
msgstr "Zet marker 7"
#: lazarusidestrconsts.liskmsetmarker8
#, fuzzy
#| msgid "Set marker 8"
msgid "Set bookmark 8"
msgstr "Zet marker 8"
#: lazarusidestrconsts.liskmsetmarker9
#, fuzzy
#| msgid "Set marker 9"
msgid "Set bookmark 9"
msgstr "Zet marker 9"
#: lazarusidestrconsts.liskmstopprogram
#, fuzzy
#| msgid "Stop program"
msgid "Stop Program"
msgstr "Stop programma"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle bookmark 0"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle bookmark 1"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle bookmark 2"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle bookmark 3"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle bookmark 4"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle bookmark 5"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle bookmark 6"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle bookmark 7"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle bookmark 8"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle bookmark 9"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr ""
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr ""
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr ""
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr ""
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr ""
#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr ""
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Starten applicatie is ongeldig"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Commandoregel voor het starten van programma"
#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr ""
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Lazarus directory"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr ""
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr ""
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Lazarus taal ID (en, de, fi, etc.)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Lazarus taal naam (Engels, Duits, etc.)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opties] <project-bestandsnaam>"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr ""
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr ""
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr ""
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr ""
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Fout bij schrijven bestand"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opties:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr ""
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr ""
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr ""
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Doel processor"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Doel OS:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr ""
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr ""
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr ""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr ""
#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr ""
#: lazarusidestrconsts.lislclwidgettype
#, fuzzy
#| msgid "LCL Widget Type"
msgid "LCL widget type"
msgstr "LCL Widget Type"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr ""
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr ""
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Linker randruimte. Wordt opgeteld met basis randruimte en gebruikt voor de ruimte links van het control."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Linker ankering"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Dit is het verwante control waaraan de linkerzijde is verankerd. Laat het leeg voor ouders"
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Linker zijden"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Linker kant evenredig verdelen"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr ""
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Niveaus"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM bestand"
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr ""
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Corrupt LFM bestand"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr ""
#: lazarusidestrconsts.lislgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "Bibliotheek pad"
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr ""
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr ""
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr ""
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr ""
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "Linker opties"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr ""
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr ""
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr ""
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr ""
#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr ""
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
msgid "Copy &RAW Value"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr ""
#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr ""
#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr ""
#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr ""
#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr ""
#: lazarusidestrconsts.lislogmessage
msgid "Log Message"
msgstr ""
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr ""
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter."
msgstr ""
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr ""
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr ""
#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr ""
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr ""
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Voer data in"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Voer Start parameters in"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
#, fuzzy
#| msgid "Main Unit has Application.CreateForm statements"
msgid "Main unit has Application.CreateForm statements"
msgstr "De hoofd unit bevat Application.CreateFrom statements"
#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
msgid "Main unit has Application.Scaled statement"
msgstr ""
#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
msgid "Main unit has Application.Title statement"
msgstr ""
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
#, fuzzy
#| msgid "Main Unit has Uses Section containing all Units of project"
msgid "Main unit has Uses section containing all units of project"
msgstr "De hoofd unit bevat alle project units in de Uses sectie"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr ""
#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr ""
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Maak Executable"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "make niet gevonden"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Maak ResourceString"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Voeg aan einde van sectie toe"
#: lazarusidestrconsts.lismakeresstrchooseanothername
#, fuzzy
#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "De resourcestring \"%s\" bestaat al.%sKies een andere naam.%sKlik op Negeren om het toch toe te voegen."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Conversieopties"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr ""
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identifier"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Identifier lengte:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr ""
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Alfabetisch invoegen"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Context gevoelig invoegen"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Ongeldige Resourcestring sectie"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring bestaat al"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Resourcestring sectie:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Bron vooruitzicht"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "String constante in broncode"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Strings met dezelfde waarde:"
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr ""
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr ""
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
msgstr ""
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr ""
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr ""
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr ""
#: lazarusidestrconsts.lismb
msgid "%s MB"
msgstr ""
#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr ""
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Bouwen afbreken"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr ""
#: lazarusidestrconsts.lismenuaddbreakpoint
#, fuzzy
#| msgid "Add breakpoint"
msgid "Add &Breakpoint"
msgstr "Breekpunt toevoegen"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr ""
#: lazarusidestrconsts.lismenuaddjumppointtohistory
#, fuzzy
#| msgid "Add jump point to history"
msgid "Add Jump Point to History"
msgstr "Springpunt aan geschiedenis toevoegen"
#: lazarusidestrconsts.lismenuaddtoproject
#, fuzzy
#| msgid "Add editor file to Project"
msgid "Add Editor File to Project"
msgstr "Bewerker-bestand aan project toevoegen"
#: lazarusidestrconsts.lismenuaddwatch
#, fuzzy
#| msgid "Add watch ..."
msgid "Add &Watch ..."
msgstr "Watch toevoegen ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr ""
#: lazarusidestrconsts.lismenubreak
msgid "&Break"
msgstr ""
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Bouw bestand"
#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus with current profile"
msgid "Build Lazarus with Current Profile"
msgstr "Bouw Lazarus"
#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with Profile: %s"
msgstr ""
#: lazarusidestrconsts.lismenuchecklfm
#, fuzzy
#| msgid "Check LFM file in editor"
msgid "Check LFM File in Editor"
msgstr "Controleer .lfm-bestand in editor"
#: lazarusidestrconsts.lismenucleandirectory
#, fuzzy
#| msgid "Clean directory ..."
msgid "Clean Directory ..."
msgstr "Maak directory schoon ..."
#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr ""
#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close A&ll Editor Files"
msgid "Close A&ll"
msgstr "Sluit alle editorbestanden"
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr ""
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Sluit project"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
#, fuzzy
#| msgid "CodeTools defines editor ..."
msgid "CodeTools Defines Editor ..."
msgstr "CodeTools definitieseditor ..."
#: lazarusidestrconsts.lismenucommentselection
#, fuzzy
#| msgid "Comment selection"
msgid "Comment Selection"
msgstr "Commentaarselectie"
#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr ""
#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr ""
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Completeer code"
#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr ""
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configureer Bouw+Start bestand ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
#, fuzzy
#| msgid "Configure custom components ..."
msgid "Configure Custom Components ..."
msgstr "Configureer aanpasbare componenten ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configureer \"Bouw Lazarus\" ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Contextgevoelige help"
#: lazarusidestrconsts.lismenucontinue
msgid "&Continue"
msgstr ""
#: lazarusidestrconsts.lismenuconvertdelphipackage
#, fuzzy
#| msgid "Convert Delphi package to Lazarus package ..."
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Converteer Delphi pakket naar een Lazarus pakket ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project ..."
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Converteer Delphi project naar een Lazarus project ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit ..."
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Converteer Delphi-unit naar Lazarus-unit ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert binary DFM to text LFM + check syntax ..."
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "Converteer .dfm-bestand naar .lfm ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr ""
#: lazarusidestrconsts.lismenudebugwindows
#, fuzzy
#| msgid "Debug windows"
msgid "Debug Windows"
msgstr "Debug schermen"
#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr ""
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "B&ewerken"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Broncodesjablonen ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Bewerk context gevoelige Help"
#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Install/Uninstall packages ..."
msgid "Install/Uninstall Packages ..."
msgstr "Configureer geinstalleerde pakketten ..."
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditoraddiconfroms
msgid "Add icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr ""
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptioneditemss
msgid "Captioned items: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
msgid "Change conflicting accelerator \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
msgid "Change %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
msgid "Change shortcut conflict \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
msgid "Change the shortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
msgid "Change the shortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr ""
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
msgid "Conflicts found initially: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
msgid "Deepest nested menu level: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteitem
#, fuzzy
#| msgid "Delete Item"
msgid "&Delete item"
msgstr "Verwijder item"
#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr ""
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
msgid "Editing Caption of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsdots
msgid "To resolve conflict edit %s.%s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsfors
msgid "Editing %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
msgid "Editing %s.%s - no menuitem selected"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
msgid "Enter a new ShortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
msgid "Enter a new ShortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr ""
#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexd
msgid "GroupIndex: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
msgid "Values in use: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
msgid "Insert menu template into root of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr ""
#: lazarusidestrconsts.lismenueditoritemswithicons
msgid "Items with icon: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
msgid "List shortcuts and &accelerators for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
msgid "List shortcuts for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Menu editor"
#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr ""
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
msgid "Menuitem shortcut conflicts in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Beweeg omlaag (of naar rechts)"
#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Beweeg omhoog (of naar links)"
#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr ""
#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr ""
#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr ""
#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorpickaniconfroms
msgid "Pick an icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorpopupassignmentss
msgid "Popup assignments: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr ""
#: lazarusidestrconsts.lismenueditorremainingconflictss
msgid "Remaining conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolvedconflictss
msgid "Resolved conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsconflictswiths
msgid "%s conflicts with %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutitemss
msgid "Shortcut items: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsd
msgid "Shortcuts (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedins
msgid "Shortcuts used in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
msgid "Shortcuts used in %s (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
msgid "ShowMenuEditor: TMenu parameter is nil"
msgstr ""
#: lazarusidestrconsts.lismenueditorsins
msgid "\"%s\" in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut.\n"
msgstr ""
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
msgid "Some widgetsets do not allow separators in the main menubar"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcuts
msgid "%s: Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
msgid "%s: Shortcuts and accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorsssonclicks
msgid "%s.%s.%s - OnClick: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorssubmenu
msgid "%s submenu"
msgstr ""
#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr ""
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available.\n"
msgstr ""
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr ""
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict\n"
msgstr ""
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr ""
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr ""
#: lazarusidestrconsts.lismenuencloseselection
#, fuzzy
#| msgid "Enclose selection ..."
msgid "Enclose Selection ..."
msgstr "Omsluit Selectie ..."
#: lazarusidestrconsts.lismenuevaluate
#, fuzzy
#| msgid "Evaluate/Modify ..."
msgid "E&valuate/Modify ..."
msgstr "Evalueer/Wijzig ..."
#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr ""
#: lazarusidestrconsts.lismenuextractproc
#, fuzzy
#| msgid "Extract procedure ..."
msgid "Extract Procedure ..."
msgstr "Destilleer procedure ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Bestand"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Zoeken"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr ""
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
#, fuzzy
#| msgid "Find other end of code block"
msgid "Find Other End of Code Block"
msgstr "Spring naar eind code blok"
#: lazarusidestrconsts.lismenufindcodeblockstart
#, fuzzy
#| msgid "Find code block start"
msgid "Find Start of Code Block"
msgstr "Spring naar begin code blok "
#: lazarusidestrconsts.lismenufinddeclarationatcursor
#, fuzzy
#| msgid "Find Declaration at cursor"
msgid "Find Declaration at Cursor"
msgstr "Zoek Declaraties (op cursor)"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Zoek Identifier Referenties ..."
#: lazarusidestrconsts.lismenufindinfiles
#, fuzzy
#| msgid "Find &in files ..."
msgid "Find &in Files ..."
msgstr "Zoek in &Bestanden ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Zoek &Volgende"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Zoek V&orige"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr ""
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr ""
#: lazarusidestrconsts.lismenugotoincludedirective
#, fuzzy
#| msgid "Goto include directive"
msgid "Goto Include Directive"
msgstr "Ga naar include directive"
#: lazarusidestrconsts.lismenugotoline
#, fuzzy
#| msgid "Goto line ..."
msgid "Goto Line ..."
msgstr "Ga naar lijn ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced IFDEF/ENDIF"
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Corrigeer verkeerde IFDEF/ENDIF"
#: lazarusidestrconsts.lismenuguessunclosedblock
#, fuzzy
#| msgid "Guess unclosed block"
msgid "Guess Unclosed Block"
msgstr "Corrigeer open blok"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Help"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr ""
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Incrementeel Zoeken"
#: lazarusidestrconsts.lismenuindentselection
#, fuzzy
#| msgid "Indent selection"
msgid "Indent Selection"
msgstr "Selectie Inspringen"
#: lazarusidestrconsts.lismenuinsertchangelogentry
#, fuzzy
#| msgid "ChangeLog entry"
msgid "ChangeLog Entry"
msgstr "ChangeLog bericht"
#: lazarusidestrconsts.lismenuinsertcharacter
#, fuzzy
#| msgid "Insert from Character Map"
msgid "Insert from Character Map ..."
msgstr "Invoegen van Karakter Map"
#: lazarusidestrconsts.lismenuinsertcvskeyword
#, fuzzy
#| msgid "Insert CVS keyword"
msgid "Insert CVS Keyword"
msgstr "CVS-sleutelwoord"
#: lazarusidestrconsts.lismenuinsertdatetime
#, fuzzy
#| msgid "Current date and time"
msgid "Current Date and Time"
msgstr "Huidige datum en tijd"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr ""
#: lazarusidestrconsts.lismenuinsertgeneral
#, fuzzy
#| msgid "General"
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Algemeen"
#: lazarusidestrconsts.lismenuinsertgplnotice
#, fuzzy
#| msgid "GPL notice"
msgid "GPL Notice"
msgstr "GPL bericht"
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertlgplnotice
#, fuzzy
#| msgid "LGPL notice"
msgid "LGPL Notice"
msgstr "LGPL melding"
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertusername
#, fuzzy
#| msgid "Current username"
msgid "Current Username"
msgstr "Huidige username"
#: lazarusidestrconsts.lismenuinspect
#, fuzzy
#| msgid "Inspect ..."
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Inspecteer ..."
#: lazarusidestrconsts.lismenujumpback
#, fuzzy
#| msgid "Jump back"
msgid "Jump Back"
msgstr "Spring terug"
#: lazarusidestrconsts.lismenujumpforward
#, fuzzy
#| msgid "Jump forward"
msgid "Jump Forward"
msgstr "Spring voorwaarts"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Spring naar"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr ""
#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr ""
#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr ""
#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr ""
#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr ""
#: lazarusidestrconsts.lismenujumptonextbookmark
#, fuzzy
#| msgid "Jump to next bookmark"
msgid "Jump to Next Bookmark"
msgstr "Spring naar volgend bookmark"
#: lazarusidestrconsts.lismenujumptonexterror
#, fuzzy
#| msgid "Jump to next error"
msgid "Jump to Next Error"
msgstr "Spring naar volgende fout"
#: lazarusidestrconsts.lismenujumptoprevbookmark
#, fuzzy
#| msgid "Jump to previous bookmark"
msgid "Jump to Previous Bookmark"
msgstr "Spring naar vorig bookmark"
#: lazarusidestrconsts.lismenujumptopreverror
#, fuzzy
#| msgid "Jump to previous error"
msgid "Jump to Previous Error"
msgstr "Spring naar vorige fout"
#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr ""
#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr ""
#: lazarusidestrconsts.lismenulowercaseselection
#, fuzzy
#| msgid "Lowercase selection"
msgid "Lowercase Selection"
msgstr "Wijzig selectie in kleine letters"
#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr ""
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Maak Resource string ..."
#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr ""
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Nieuw Component"
#: lazarusidestrconsts.lismenunewcustom
msgid "New %s"
msgstr ""
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nieuwe Form"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nieuw ..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr ""
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nieuw Project ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
#, fuzzy
#| msgid "New Project from file ..."
msgid "New Project from File ..."
msgstr "Nieuw Project van bestand ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nieuwe Unit"
#: lazarusidestrconsts.lismenuok
#, fuzzy
#| msgid "&Ok"
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&Ok"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Online help"
#: lazarusidestrconsts.lismenuopen
#, fuzzy
#| msgid "Open ..."
msgid "&Open ..."
msgstr "Openen ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
#, fuzzy
#| msgid "Open filename at cursor"
msgid "Open Filename at Cursor"
msgstr "Open bestandsnaam (op cursor)"
#: lazarusidestrconsts.lismenuopenpackage
#, fuzzy
#| msgid "Open loaded package ..."
msgid "Open Loaded Package ..."
msgstr "Open een geladen Pakket ..."
#: lazarusidestrconsts.lismenuopenpackagefile
#, fuzzy
#| msgid "Open package file (.lpk) ..."
msgid "Open Package File (.lpk) ..."
msgstr "Open Pakket bestand (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
#, fuzzy
#| msgid "Open package of current unit"
msgid "Open Package of Current Unit"
msgstr "Open Pakket van huidige unit"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Open Project ..."
#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open &Recent ..."
msgid "Open &Recent"
msgstr "Open Recent ..."
#: lazarusidestrconsts.lismenuopenrecentpkg
#, fuzzy
#| msgid "Open recent package"
msgid "Open Recent Package"
msgstr "Open recent pakket ..."
#: lazarusidestrconsts.lismenuopenrecentproject
#, fuzzy
#| msgid "Open Recent Project ..."
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Open Recent Project ..."
#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr ""
#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr ""
#: lazarusidestrconsts.lismenupackagegraph
#, fuzzy
#| msgid "Package Graph ..."
msgid "Package Graph"
msgstr "Pakketplaatje ..."
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr ""
#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr ""
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr ""
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Procedure lijst ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Project"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Project Inspecteur"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Project Opties ..."
#: lazarusidestrconsts.lismenuprojectrun
#, fuzzy
#| msgid "Run"
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Starten"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publiceer Project ..."
#: lazarusidestrconsts.lismenuquickcompile
#, fuzzy
#| msgid "Quick compile"
msgid "Quick Compile"
msgstr "Snel-compilatie"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
#, fuzzy
#| msgid "Quick syntax check"
msgid "Quick Syntax Check"
msgstr "Snellere Syntaxcheck"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr ""
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Verwijder van Project ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Hernoem Identifier ..."
#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr ""
#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr ""
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
#, fuzzy
#| msgid "Rescan FPC source directory"
msgid "Rescan FPC Source Directory"
msgstr "Lees FPC broncode directory"
#: lazarusidestrconsts.lismenuresetdebugger
#, fuzzy
#| msgid "Reset debugger"
msgid "Reset Debugger"
msgstr "Reset debugger"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Terugzetten"
#: lazarusidestrconsts.lismenurun
#, fuzzy
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Starten"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Start bestand"
#: lazarusidestrconsts.lismenurunparameters
#, fuzzy
#| msgid "Run Parameters ..."
msgid "Run &Parameters ..."
msgstr "Start Parameter ..."
#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Run to &Cursor"
msgid "Step over to &Cursor"
msgstr "Start tot cursor"
#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr ""
#: lazarusidestrconsts.lismenusave
#, fuzzy
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Opslaan"
#: lazarusidestrconsts.lismenusaveas
#, fuzzy
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Opslaan Als ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Project Opslaan "
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Project Opslaan Als ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Zoeken"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Selecteer"
#: lazarusidestrconsts.lismenuselectall
#, fuzzy
#| msgid "Select all"
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Selecteer Alles"
#: lazarusidestrconsts.lismenuselectcodeblock
#, fuzzy
#| msgid "Select code block"
msgid "Select Code Block"
msgstr "Selecteer code blok"
#: lazarusidestrconsts.lismenuselectline
#, fuzzy
#| msgid "Select line"
msgid "Select Line"
msgstr "Selecteer lijn"
#: lazarusidestrconsts.lismenuselectparagraph
#, fuzzy
#| msgid "Select paragraph"
msgid "Select Paragraph"
msgstr "Selecteer paragraaf"
#: lazarusidestrconsts.lismenuselecttobrace
#, fuzzy
#| msgid "Select to brace"
msgid "Select to Brace"
msgstr "Selecteer tot accolade"
#: lazarusidestrconsts.lismenuselectword
#, fuzzy
#| msgid "Select word"
msgid "Select Word"
msgstr "Selecteer woord"
#: lazarusidestrconsts.lismenusetfreebookmark
#, fuzzy
#| msgid "Set a free bookmark"
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Plaats een beschikbare bookmark"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr ""
#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr ""
#: lazarusidestrconsts.lismenusortselection
#, fuzzy
#| msgid "Sort selection ..."
msgid "Sort Selection ..."
msgstr "Sorteer Selectie ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr ""
#: lazarusidestrconsts.lismenustepinto
#, fuzzy
#| msgid "Step in&to"
msgid "Step In&to"
msgstr "Step Into"
#: lazarusidestrconsts.lismenustepintocontext
msgid "Step Into (Context)"
msgstr ""
#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepout
msgid "Step O&ut"
msgstr ""
#: lazarusidestrconsts.lismenustepover
#, fuzzy
#| msgid "&Step over"
msgid "&Step Over"
msgstr "Step Over"
#: lazarusidestrconsts.lismenustepovercontext
msgid "Step Over (Context)"
msgstr ""
#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr ""
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutabstospacesselection
#, fuzzy
#| msgid "Tabs to spaces in selection"
msgid "Tabs to Spaces in Selection"
msgstr "Tabs naar Spaties"
#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "Informatie"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Inhoud"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Standaard Edit Menu"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Standaard bestand menu"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Standaard Help Menu"
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Zoeken"
#: lazarusidestrconsts.lismenutemplatefindnext
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
msgid "Find Next"
msgstr "Zoek Volgende"
#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Open Recent"
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Leerprogramma"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Hulpmiddelen"
#: lazarusidestrconsts.lismenuuncommentselection
#, fuzzy
#| msgid "Uncomment selection"
msgid "Uncomment Selection"
msgstr "Commentaar Selectie ongedaan maken"
#: lazarusidestrconsts.lismenuunindentselection
#, fuzzy
#| msgid "Unindent selection"
msgid "Unindent Selection"
msgstr "Selectie Inspringen ongedaan maken"
#: lazarusidestrconsts.lismenuuppercaseselection
#, fuzzy
#| msgid "Uppercase selection"
msgid "Uppercase Selection"
msgstr "Wijzig selectie in hoofdletters"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr ""
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Tonen"
#: lazarusidestrconsts.lismenuviewanchoreditor
#, fuzzy
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Toon Anker Bewerker"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr ""
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Breekpunten"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Call Stack"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Codeverkenner"
#: lazarusidestrconsts.lismenuviewcomponentpalette
#, fuzzy
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Toon component palette"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Componenten"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr ""
#: lazarusidestrconsts.lismenuviewdebugoutput
#, fuzzy
#| msgid "Debug output"
msgid "Debug Output"
msgstr "Debugger output"
#: lazarusidestrconsts.lismenuviewforms
#, fuzzy
#| msgid "Forms..."
msgid "Forms ..."
msgstr "Forms..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump History ..."
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Toon Springpunt geschiedenis ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Lokale Variabelen"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Berichten"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Object Inspecteur"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr ""
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgid "Terminal Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr ""
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Zoek Resultaten"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Broncode Bewerker"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr ""
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.lismenuviewtoggleformunit
#, fuzzy
#| msgid "Toggle form/unit view"
msgid "Toggle Form/Unit View"
msgstr "Schakel tussen Form/Unit zicht"
#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "Unit Dependencies ..."
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Toon Unit Afhankelijkheden"
#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "Unit Information"
msgid "Unit Information ..."
msgstr "Toon Unit informatie"
#: lazarusidestrconsts.lismenuviewunits
#, fuzzy
#| msgid "Units..."
msgid "Units ..."
msgstr "Units..."
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Watches"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr ""
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr ""
#: lazarusidestrconsts.lismeother
#, fuzzy
#| msgid "Other"
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Ander"
#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr ""
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr ""
#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr ""
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr ""
#: lazarusidestrconsts.lismissingdirectory
msgid "missing directory \"%s\""
msgstr ""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr ""
#: lazarusidestrconsts.lismissingexecutable
msgid "missing executable \"%s\""
msgstr ""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr ""
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Ontbrekende pakketten"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr ""
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr ""
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr ""
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr ""
#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr ""
#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
msgstr ""
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr ""
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr ""
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr ""
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr ""
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr ""
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr ""
#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
msgid "expected \":=\" after macro name, but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
msgid "expected macro name, but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmfromto
msgid "From %s to %s"
msgstr ""
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr ""
#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr ""
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr ""
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr ""
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr ""
#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr ""
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr ""
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr ""
#: lazarusidestrconsts.lismmusesystemencoding
msgid "Use system encoding"
msgstr ""
#: lazarusidestrconsts.lismmusesystemencodinghint
msgid "Disable support for UTF-8 default string encoding."
msgstr ""
#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmwas
msgid "(was \"%s\")"
msgstr ""
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr ""
#: lazarusidestrconsts.lismode
msgid ", Mode: %s"
msgstr ""
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr ""
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr ""
#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr ""
#: lazarusidestrconsts.lismove
msgid "Move"
msgstr ""
#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr ""
#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr ""
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr ""
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr ""
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr ""
#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr ""
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr ""
#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr ""
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr ""
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr ""
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr ""
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr ""
#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr ""
#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr ""
#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr ""
#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr ""
#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr ""
#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr ""
#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr ""
#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr ""
#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr ""
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr ""
#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr ""
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr ""
#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ""
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Berichten opslaan in bestand (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Naam"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr ""
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr ""
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Naam van nieuwe procedure"
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr ""
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Nieuw"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nieuwe klasse"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Maak een nieuw editor-bestand.%sKies een type."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Maak een nieuw leeg tekst bestand."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Maak een nieuw project.%sKies een type."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Maak een nieuw standaard pakket.%sEen pakket is een verzameling units en componenten."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Maak een nieuwe unit met een datamodule."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Maak een nieuwe unit met een LCL-formulier."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr ""
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Geen item geselecteerd"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Selecteer eerst een item"
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr ""
#: lazarusidestrconsts.lisnewmacroname
msgid "Macro %d"
msgstr ""
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr ""
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr ""
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr ""
#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr ""
#: lazarusidestrconsts.lisnewproject
#, fuzzy
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "(nieuw project)"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr ""
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr ""
#: lazarusidestrconsts.lisno
msgid "No"
msgstr ""
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Geen backup bestanden"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr ""
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Geen wijziging"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Geen code geselecteerd"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Geen compiler opties overgenomen."
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr ""
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr ""
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr ""
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr ""
#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr ""
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "geen naam"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%sgeen"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""
#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr ""
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr ""
#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr ""
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file \"%s\" found."
msgstr ""
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Geen ResourceString sectie gevonden"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
#, fuzzy
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Het filter is gewoonlijk een regular expressie. In de eenvoudige syntax betekent een . een gewoon karakter, een * staat voor alles, een ? staat voor elk willekeurig karakter. Komma's en puntkomma's zijn scheidingstekens tussen alternatieven. Bijvoorbeeld: *.pas;*.pp staat voor ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Geen string constante gevonden"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr ""
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""
#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid Pascal identifier"
msgstr ""
#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr ""
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "Opmerking: Define Template voor Free Pascal broncode kon niet gemaakt worden"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "Opmerking: Define Template voor Lazarus broncode kon niet gemaakt worden"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr ""
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
msgstr ""
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr ""
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr ""
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Niet nu"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr ""
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Maak"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Maak een nieuw project"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr ""
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr ""
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "obectpad"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr ""
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr ""
#: lazarusidestrconsts.lisofpackage
msgid " of package %s"
msgstr ""
#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisoifclassnotfound
#, fuzzy
#| msgid "Class %s%s%s not found."
msgid "Class \"%s\" not found."
msgstr "Klasse \"%s\" niet gevonden."
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "Automatisch installeren dynamisch"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "Automatisch installeren statisch"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Beschrijving: "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sBeschrijving: %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Bestandsnaam: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "dynamisch geinstalleerd"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "statisch geinstalleerd"
#: lazarusidestrconsts.lisoiplicenselicense
msgid "%sLicense: %s"
msgstr ""
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "niet aanwwezig"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "gewijzigd"
#: lazarusidestrconsts.lisoipopenloadedpackage
#, fuzzy
#| msgid "Open loaded package"
msgid "Open Loaded Package"
msgstr "Open een geladen Pakket"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Pakketnaam"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Selecteer een pakket"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "niet wijzigbaar"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Status"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sDit package was geïnstalleerd, maar het lpk-bestand was niet gevonden"
#: lazarusidestrconsts.lisok
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "Ok"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Oude Klasse"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr ""
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr ""
#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr ""
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr ""
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr ""
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr ""
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Alleen hele woorden zoeken"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr ""
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Openen"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Open als XML bestand"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr ""
#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr ""
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Open bestannd bestand"
#: lazarusidestrconsts.lisopenfile
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Open bestand"
#: lazarusidestrconsts.lisopenfile2
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Open bestand"
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Open %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Open Pakket?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr ""
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Open Pakket bestand"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Open Project?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Project openen"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Project opnieuw openen"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Open Project bestand"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr ""
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr ""
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Open het bestand als normale broncode"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Open het pakket %s?"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Open het project %s"
#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr ""
#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr ""
#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr ""
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr ""
#: lazarusidestrconsts.lisoptions
#, fuzzy
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Opties"
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr ""
#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr ""
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "of"
#: lazarusidestrconsts.lisos
msgid ", OS: %s"
msgstr ""
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
msgstr ""
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr ""
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Overrule de ingestelde taal. Bijv. --language=nl. Voor mogelijke waardes zie de bestanden in the directorie languages"
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr ""
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project or IDE build mode."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Bestand overschrijven?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Bestand op disk overschrijven"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Pakket"
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr ""
#: lazarusidestrconsts.lispackage3
msgid ", package %s"
msgstr ""
#: lazarusidestrconsts.lispackageinfo
#, fuzzy
#| msgid "Package Info"
msgid "Package info"
msgstr "Pakketinformatie"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Pakketnaam begint met ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Pakketnaam bevat ..."
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr ""
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Pakket moet geinstalleerd worden"
#: lazarusidestrconsts.lispackageoption
msgid "Package \"%s\" Option"
msgstr ""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr ""
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr ""
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr ""
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr ""
#: lazarusidestrconsts.lispage
msgid "Page"
msgstr ""
#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr ""
#: lazarusidestrconsts.lispagenamealreadyexists
msgid "Page name \"%s\" already exists. Not added."
msgstr ""
#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr ""
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""
#: lazarusidestrconsts.lisparser
msgid "parser \"%s\": %s"
msgstr ""
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr ""
#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
msgid "passing compiler define \"%s\" twice with different values"
msgstr ""
#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
msgid "passing compiler option -%s twice with different values"
msgstr ""
#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Plakken"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr ""
#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr ""
#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr ""
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr ""
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Blader"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr ""
#: lazarusidestrconsts.lispatheditmovepathdown
#, fuzzy
#| msgid "Move path down"
msgid "Move path down (Ctrl+Down)"
msgstr "Verplaats pad omlaag"
#: lazarusidestrconsts.lispatheditmovepathup
#, fuzzy
#| msgid "Move path up"
msgid "Move path up (Ctrl+Up)"
msgstr "Verplaats pad omhoog"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr ""
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr ""
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr ""
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Pad templates"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Doorzoek paden:"
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr ""
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr ""
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr ""
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Pauze"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr ""
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr ""
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr ""
#: lazarusidestrconsts.lispckeditaddotheritems
msgid "Add other items"
msgstr ""
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr ""
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Wijzigingen toepassen"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Aanroepen %sRegister%s procedure van de geselecteerde unit"
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr ""
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Alles compileeren?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compileer package"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Compileropties voor Package %s"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr ""
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Maak MakeFile"
#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr ""
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""
#: lazarusidestrconsts.lispckediteditgeneraloptions
#, fuzzy
#| msgid "Edit General Options"
msgid "Edit general options"
msgstr "Bewerk algemene opies"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Bestand eigenschappen"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Installeren"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Ongeldige maximum versie"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Ongeldige minimum versie"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maximum versie"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimum Versie:"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Gewijzigd: %s"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Verplaats afhankelijk omlaag"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Verplaats afhankelijkheid omhoog"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Pakket %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, fuzzy
#| msgid "Package %s%s%s has changed.%sSave package?"
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Pakket \"%s\" is gewijzigd.%sPakket opslaan?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "package %s niet opgeslagen"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Pagina: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Voeg afhankelijkheid opnieuw toe"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Voeg bestand opnieuw toe"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Niet wijzigbaar: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
#, fuzzy
#| msgid "Recompile all required"
msgid "Recompile All Required"
msgstr "Hercompileer wat benodigd is"
#: lazarusidestrconsts.lispckeditrecompileclean
#, fuzzy
#| msgid "Recompile clean"
msgid "Recompile Clean"
msgstr "Hercompileer opnieuw"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Compileer dit opnieuw en alle benodigde Pakketten?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Geregistreerde plugins"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registreer unit"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Verwijder afhankelijkheid"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Verwijder afhankelijkheid"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, fuzzy
#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Verwijder afhankelijkheid \"%s\"%suit pakket \"%s\"?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Benodigde pakketten verwijderd"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Verwijder bestand"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Bestand verwijderen?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, fuzzy
#| msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Verwijder bestand \"%s\"%svan pakket \"%s\"?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Verwijder geselecteerde items"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Benodigde Pakketten"
#: lazarusidestrconsts.lispckeditsavepackage
#, fuzzy
#| msgid "Save package"
msgid "Save Package"
msgstr "Pakket opslaan"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, fuzzy
#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "De maximum versie \"%s\" is geen geldige package versie.%s(Correct voorbeeld 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, fuzzy
#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "De minimum versie \"%s\" is geen geldige package versie.%s(Correct voorbeeld 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "De-installeer"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Toon Pakket Bron"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr ""
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Geinstalleerd"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Installeer bij volgende start"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sStatus: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
#, fuzzy
#| msgid "Uninstall on next start"
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "De-installeer bij volgende start"
#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr ""
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Opties aan pakketten en projecten toevoegen"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Paden aan pakketten en projecten toevoegen"
#: lazarusidestrconsts.lispckoptsauthor
#, fuzzy
#| msgid "Author:"
msgid "Author"
msgstr "Auteur:"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automatisch herbouwen wanneer nodig"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automatisch herbouwen wanneer allen herbouwd worden"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Aanpasbaar"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
#, fuzzy
#| msgid "Description/Abstract"
msgid "Description / Abstract"
msgstr "Beschrijving/Samenvatting"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
#, fuzzy
#| msgid "Designtime and Runtime"
msgid "Designtime and runtime"
msgstr "Designtime en Runtime"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "IDE Integratie"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Neem op"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Ongeldige pakket type"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Bibliotheek"
#: lazarusidestrconsts.lispckoptslicense
#, fuzzy
#| msgid "License:"
msgid "License"
msgstr "Licentie:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Major"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Handmatige compilatie (nooit automatisch)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minor"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Object"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Pakketopties"
#: lazarusidestrconsts.lispckoptspackagetype
#, fuzzy
#| msgid "PackageType"
msgid "Package type"
msgstr "Pakkettype"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr ""
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Vrijgeven"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, fuzzy
#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Het package \"%s\" heeft de \"auto install\" vlag.%sDit betekent dat het in de IDE wordt geinstalleerd. Te installeren packages%smoeten \"ontwerp\" packages zijn. "
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr ""
#: lazarusidestrconsts.lispckoptsupdaterebuild
#, fuzzy
#| msgid "Update/Rebuild"
msgid "Update / Rebuild"
msgstr "Update/Herbouwen"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Gebruik"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr ""
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr ""
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr ""
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr ""
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Afbreken"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Voortgang"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr ""
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Conflict gevonden"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr ""
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr ""
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr ""
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Ongeldige unit bestandsnaam"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Ongeldige unit naam"
#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr ""
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr ""
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr ""
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr ""
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr ""
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr ""
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr ""
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr ""
#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr ""
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr ""
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr ""
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Unitnaam:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr ""
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr ""
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr ""
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "CompiledSrcPath toevoeging"
#: lazarusidestrconsts.lispkgdefsnamespaces
msgid "Namespaces"
msgstr ""
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Uitvoer directory"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Pakketbronbestanden directory markering"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Unitpad"
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Weet u zeker dat alle wijzigingen in pakket %s geannuleerd moeten worden en het project opnieuw geladen moet worden?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "De nieuwe unit bevindt zich niet in het unit pad"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publiceer Pakket"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Pakket terugzetten?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, fuzzy
#| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "Het bestand \"%s\"%sstaat niet in het unitpad van het package.%s\"%s\" toevoegen aan het unitpad?"
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Binair"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Include bestand"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Lazarus form beschrijving"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus resource"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Virtuele Unit"
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, fuzzy
#| msgid "%sAdding new Dependency for package %s: package %s%s"
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sToevoegen nieuwe afhankelijkheid aan package %s: package %s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, fuzzy
#| msgid "%sAdding new Dependency for project %s: package %s%s"
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sToevoegen nieuwe afhankelijkheid voor project %s: package %s"
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Neem unit in the uses-sectie van package op. Units die niet altijd gecompileerd worden, hoeven niet opgenomen te worden."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Dubbelzinnige units gevonden"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automatisch geïnstalleerde packages"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sBeide packages zijn verbonden, ofwel de ene package gebruikt de andere, of een derde gebruikt deze twee."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Gebroken Dependency"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr ""
#: lazarusidestrconsts.lispkgmangcompilepackage
msgid "Compile package %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Verwijderen mislukt"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Verwijder het oude pakket-bestand?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, fuzzy
#| msgid "Delete old package file %s%s%s?"
msgid "Delete old package file \"%s\"?"
msgstr "Verwijder oud pakket bestand \"%s\"?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Afhankelijkheid zonder eigenaar: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Fout bij lezen bestand"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Fout bij Lezen Pakket"
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Fout bij schrijven bestand"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Fout bij schrijven Pakket"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Bestand is reeds aanwezig in pakket"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Bestand is in project"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Bestandsnaam verschilt van pakketnaam"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Bestandsnaam in gebruik in ander pakket"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Bestand in gebruik door project"
#: lazarusidestrconsts.lispkgmangfilenotfound
#, fuzzy
#| msgid "File %s%s%s not found."
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "Bestand \"%s\" niet gevonden."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Bestand niet bewaard"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "De installatie van pakket %s zal automatisch het volgende package installeren:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "De installatie van pakket %s zal automatisch de volgende pakket installeren:"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "ongeldige compiler bestandsnaam"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Ongeldige bestands extensie"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Ongeldige pakket bestandsextensie"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Ongeldige pakket bestandsnaam"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Ongeldige pakketnaam"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Ongeldige Pakketnaam"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, fuzzy
#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Het laden van Package %s zal package %s%s van bestand %s vervangen.%s Het oude pakket is gewijzigd. %sHet oude pakket %s opslaan?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "NieuwPakket"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Pakket: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Pakket conflicteert."
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
#, fuzzy
#| msgid "Package is no designtime package"
msgid "Package is not a designtime package"
msgstr "Pakket is geen design-time pakket"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Pakket is benodigd"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "package hoofd broncode"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Pakketnaam bestaat al"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Pakketbestanden moeten de .lpk extensie hebben"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Sla het bestand op voor het toevoegen aan een package"
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Project: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Lazarus opnieuw bouwen"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, fuzzy
#| msgid "Replace existing file %s%s%s?"
msgid "Replace existing file \"%s\"?"
msgstr "Vervang bestaand bestand \"%s\"?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Vervang bestand"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr ""
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name.\n"
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackage
#, fuzzy
#| msgid "Save Package?"
msgid "Save package?"
msgstr "Package Opslaan ?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Package Opslaan %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, fuzzy
#| msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Moet het bestand met kleine letters hernoemd worden naar%s\"%s\"?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr ""
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr " configuratiebestand statische packages"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Het compiler bestand voor package %s is geen geldige executable:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, fuzzy
#| msgid "The file %s%s%s%sis already in the package %s."
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "Het bestand \"%s\"%smaakt al deel uit van het package %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, fuzzy
#| msgid "The file %s%s%s is not a Lazarus package."
msgid "The file \"%s\" is not a Lazarus package."
msgstr "Het bestand \"%s\" is geen Lazarus package"
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, fuzzy
#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "De bestandsnaam \"%s\" correspondeert niet met de package naam \"%s\" in het bestand.%sPackage naam wijzigen in \"%s\"?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, fuzzy
#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "De bestandsnaam \"%s\" is onderdeel van het huidige project.%sProjecten en Packages mogen geen bestanden delen."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, fuzzy
#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "De bestandsnaam \"%s\" wordt gebruikt door%shet package \"%s\"%sin bestand \"%s\"."
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Het volgende pakket is niet geladen:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "De volgende pakketten zijn niet geladen:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, fuzzy
#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sDe volgende units zullen aan de uses sectie van %s%s:%s%s worden toegevoegd"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
#, fuzzy
#| msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
msgstr "Het package \"%s\" kon niet worden gecompileerd.%sHet package verwijderen uit de installatie lijst?"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, fuzzy
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "De bestandsnaam voor package \"%s\" in%s\"%s\" is geen geldige lazarus package naam."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, fuzzy
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Het package %s is alleen beschikbaar in runtime.%sDit soort packages kunnen niet geinstalleerd worden."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, fuzzy
#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Het package \"%s\" is aangemeld voor installatie, maar is niet gevonden.%sAfhankelijkheid verwijderen van de lijst te installeren packages?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Het package %s is nodig voor %s, dat geinstalleerd moet worden.%sZie package plaatje."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, fuzzy
#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Het packagenaam \"%s\" is geen geldige packagenaam%sKies een andere naam (bijv. package1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, fuzzy
#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "De package naam \"%s\" van%shet bestand \"%s\" is ongeldig."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, fuzzy
#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Het package \"%s\" is verwijderd.%sLazarus ondersteund alleen statisch gelinkte packages. Om het volledig te de-installeren moet lazarus opnieuw gebouwd en gestart worden.%sWilt u Lazarus opnieuw bouwen?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, fuzzy
#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Het package \"%s\" is aangemeld voor installatie.%sLazarus ondersteund alleen statisch gelinkte packages. Om het te installeren moet lazarus opnieuw gebouwd en gestart worden.%sWilt u Lazarus opnieuw bouwen?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, fuzzy
#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Het project heeft het pakket \"%s\" nodig.%sDit is niet gevonden. Zie Project -> Project Inspecteur"
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, fuzzy
#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Er zijn twee units met dezelfde naam:%s1. \"%s\" uit %s%s2. \"%s\" uit %s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, fuzzy
#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Er is een FPC unit met dezelfde naam als een package:%s\"%s\""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, fuzzy
#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Er is een FPC unit met dezelfde naam als:%s\"%s\" uit %s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, fuzzy
#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "There is al een ander package met de naam \"%s\".%sConflicterend package: \"%s\"%sBestand: \"%s\""
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, fuzzy
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Er is al een package \"%s\" geladen%svan bestand \"%s\".%sZie Componenten -> Package plaatje.%sVervangen is onmogelijk"
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Er is een niet opgeslagen package in the benodigde packages. Zie package plaatje."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, fuzzy
#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Er is een unit met dezelfde naam als een package:%s1. \"%s\" uit %s%s2. \"%s\""
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Dit is een viruteel pakket. Er is nog geen broncode. Sla het pakket eerst op."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Kan de directory niet maken"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
#, fuzzy
#| msgid "Unable to create output directory %s%s%s%sfor package %s."
msgid "Unable to create output directory \"%s\"%sfor package %s."
msgstr "Kan de uitvoerdirectory \"%s\"%svoor package %s niet maken."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
#, fuzzy
#| msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgid "Unable to create package source directory \"%s\"%sfor package %s."
msgstr "Kan geen package broncode directory \"%s\"%svoor package %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, fuzzy
#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Kan doel directorie for lazarus:%s\"%s\" niet maken.%sDeze directorie is nodig voor de nieuwe lazarus IDE met je packages."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
#, fuzzy
#| msgid "Unable to delete file %s%s%s."
msgid "Unable to delete file \"%s\"."
msgstr "Kan het bestand \"%s\" niet verwijderen."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Kan het bestand niet verwijderen"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
#, fuzzy
#| msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgid "Unable to delete old state file \"%s\"%sfor package %s."
msgstr "Kan het oude status bestand \"%s\"%svoor package %s niet verwijderen."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
#, fuzzy
#| msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
msgstr "Kan het package \"%s\" niet openen.%sDit package moet geinstalleerd worden."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
#, fuzzy
#| msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
msgstr "Kan het status bestand \"%s\"%svan package %s niet vinden.%sFout: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, fuzzy
#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Kan het package \"%s\"%sniet schrijven in bestand \"%s\".%sFout: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
#, fuzzy
#| msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
msgstr "Kan het status bestand \"%s\"%s van package %s niet schrijven.%sFout: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Package de-installeren"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Package %s de-installeren?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Niet opgeslagen package"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Gebruik unit"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, fuzzy
#| msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Waarschuwing: Het bestand \"%s\"%sbehoort tot het huidige project."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr ""
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr ""
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr ""
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr ""
#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "Geinstalleerd"
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
#, fuzzy
#| msgid "Can not register components without unit"
msgid "Cannot register components without unit"
msgstr "Kan componenten zonder unit niet registreren"
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
#, fuzzy
#| msgid "Component Class %s%s%s already defined"
msgid "Component Class \"%s\" already defined"
msgstr "Componentklasse \"%s\" reeds gedefinieerd"
#: lazarusidestrconsts.lispkgsysfilename
#, fuzzy
#| msgid "%s%sFile Name: %s%s%s"
msgid "%s%sFile Name: \"%s\""
msgstr "%s%sbestandsnaam: \"%s\""
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Ongeldige component Class"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Ongeldige unit naam: %s"
#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: \"%s\""
msgstr ""
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Pakketbestand niet gevonden"
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr ""
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Register proceure is nill"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RegisterUnit is aangeroepen, maar er is geen pakket geregistreerd"
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr ""
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
#, fuzzy
#| msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Het package \"%s\" is geinstalleerd, maar er is geen geldig .lpk bestand gevonden.%sEen dummy package is aangemaakt."
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Dit is het standaard pakket. Het wordt alleen gebruikt voor componenten zonder package. Deze zijn verouderd."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Het pakket is geinstalleerd, maar het lpk-bestand niet gevonden. Alle componenten hieruit zijn gedeactiveed. Herstel dit alstublieft."
#: lazarusidestrconsts.lispkgsysunitname
#, fuzzy
#| msgid "%s%sUnit Name: %s%s%s"
msgid "%s%sUnit Name: \"%s\""
msgstr "%s%sUnitnaam: \"%s\""
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr ""
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr ""
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Dit bestand is niet aanwezig in een van de geladen packages."
#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr ""
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr ""
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr ""
#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr ""
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr ""
#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr ""
#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr ""
#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr ""
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr ""
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgstr ""
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "A.u.b. een unit openen .."
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Selecteer een stuk code om in een nieuwe procedure/methode te maken"
#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Alles>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr ""
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr ""
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr ""
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr ""
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Spring naar selectie"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Geen>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objecten"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr ""
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Type"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Geen sessie info opslaan"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr ""
#: lazarusidestrconsts.lisposaveinideconfigdirectory
#, fuzzy
#| msgid "Save in IDE config directory"
msgid "Save in .lps file in IDE config directory"
msgstr "Opslaan in IDE configuratie directorie"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Opslaan in .lpi bestand"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Opslaan in .lps bestand in project directory"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Sessie informatie opslaan in"
#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ""
#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr ""
#: lazarusidestrconsts.lispositionoutsideofsource
msgid "%s (position outside of source)"
msgstr ""
#: lazarusidestrconsts.lisppuinwrongdirectory
msgid "ppu in wrong directory=%s."
msgstr ""
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr ""
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "eerste configuratie directory, waar Lazarus de configuratie bestanden opslaat. Standaard is "
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr ""
#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr ""
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr ""
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Private methode"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy
#| msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Waarschijnlijk moeten sommige pakketten geïnstalleerd voordat je door kunt gaan.%sWaarschuwing:%sHet project gebruikt de volgende design time pakketten, welke mogelijk in de form ontwerper geopend moeten worden. Als je doorgaat kun je foutmeldingen krijgen over missende componenten, en het lade van het form zal waarschijnlijk uitermate onplzierige resultaten opleveren.%sHet is aanbevolen om te annuleren en deze paketten eerts te installeren."
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedure met interface"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programma"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Programma vastgesteld"
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr ""
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
#, fuzzy
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Programma broncode dient een Pascal extensie, zoals .pas, .pp of .lpr, te hebben."
#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add Files to Project"
msgstr ""
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Afhankelijkheid bestaat al"
#: lazarusidestrconsts.lisprojaddeditorfile
#, fuzzy
#| msgid "Add editor files"
msgid "Add Editor Files"
msgstr "Bewerker-bestanden toevoegen"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Ongeldige Min-Max versie"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
#, fuzzy
#| msgid "Invalid pascal unit name"
msgid "Invalid Pascal unit name"
msgstr "Ongeldige Pascal unit naam"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Ongeldige versie"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maximum Versie (optioneel):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimum Versie (optioneel):"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nieuwe vereiste"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Pakketnaam"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Pakket niet gevonden"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, fuzzy
#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "De afhankelijkheid \"%s\" is niet gevonden.%sKies een bestaand package."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, fuzzy
#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "De Maximum Versie \"%s\" is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "De maximum versie is lager dan de minimum versie"
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, fuzzy
#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "De Minimum Versie \"%s\" is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, fuzzy
#| msgid "The project has already a dependency for the package %s%s%s."
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Het project is al afhankelijk van het pakket \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, fuzzy
#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "De unitnaam \"%s\" bestaat al in het project%smet bestand: \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, fuzzy
#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "De unitnaam \"%s\" bestaat al in de selectie%smet bestand: \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The unit name %s%s%s is not a valid Pascal identifier."
msgid "The unit name \"%s\" is not a valid Pascal identifier."
msgstr "De unitnaam \"%s\" is geen geldige pascal identifier."
#: lazarusidestrconsts.lisprojaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to Project"
msgstr "Voeg toe aan het project"
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Unitnaam bestaat al"
#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr ""
#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr ""
#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr ""
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Project is gewijzigd"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr ""
#: lazarusidestrconsts.lisprojectcount
msgid "%d projects"
msgstr ""
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Project directory"
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr ""
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Project bestandsnaam"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Project Include Path"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Project info bestand gevonden"
#: lazarusidestrconsts.lisprojectinformation
#, fuzzy
#| msgid "Project Information"
msgid "Project information"
msgstr "Project informatie"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Project is 'runnable'"
#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr ""
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Project macro eigenschappen"
#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr ""
#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr ""
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr ""
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr ""
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr ""
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr ""
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Project Src Path"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr ""
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Project Unit pad"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr ""
#: lazarusidestrconsts.lisprojfiles
msgid "Files:"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Bevestig Afhankelijkheid verwijderen"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Verwijder afhankelijkheid voor %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Project Inspecteur - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Benodigde pakketten verwijderd"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Verwijder bestand %s van het project?"
#: lazarusidestrconsts.lisprojinspremoveitemsf
msgid "Remove %s items from project?"
msgstr ""
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Kan het status bestand %s van project %s%s niet lezen. Fout: %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Kan het status bestand van project %s%s niet schrijven. Four %s"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Altijd bouwen (ook als er niks is gewijzigd)"
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr ""
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Fout"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Kan de \"Auto createlijst\" niet wijzigen in de broncode.%sLos eerst de fouten op."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Project broncode directory merk"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Vraag om een waarde"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr ""
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr ""
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Beschermde methode"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Publieke methode"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Gepubliceerde methode"
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Publiceer project directory"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr ""
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
#, fuzzy
#| msgid "Invalid Exclude filter"
msgid "Invalid exclude filter"
msgstr "Ongeldig Exclude filter"
#: lazarusidestrconsts.lispublprojinvalidincludefilter
#, fuzzy
#| msgid "Invalid Include filter"
msgid "Invalid include filter"
msgstr "Ongeldig Include filter"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ""
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr ""
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
#, fuzzy
#| msgid "A pascal unit must have the extension .pp or .pas"
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Een Pascal-unit dient op .pp of .pas te eindigen."
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Bewerk virtuele unit"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr ""
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr ""
#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr ""
#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr ""
#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent Project"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Open Recent"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr ""
#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr ""
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr ""
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr ""
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr ""
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr ""
#: lazarusidestrconsts.lisquitlazarus
#, fuzzy
#| msgid "Quit Lazarus"
msgid "&Quit Lazarus"
msgstr "Verlaat Lazarus"
#: lazarusidestrconsts.lisrange
#, fuzzy
msgctxt "lazarusidestrconsts.lisrange"
msgid "Range"
msgstr "Bereik"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Leesfout"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr ""
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr ""
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr ""
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr ""
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr ""
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Opnieuw"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr ""
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr ""
#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr ""
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Relatieve paden"
#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr ""
#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr ""
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Verwijder alle ongeldige properties"
#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr ""
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr ""
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr ""
#: lazarusidestrconsts.lisremovedependenciesfrompackage
msgid "Remove %s dependencies from package \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisremovefilesfrompackage
msgid "Remove %s files from package \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr ""
#: lazarusidestrconsts.lisremovefromproject
#, fuzzy
#| msgid "Remove from project"
msgid "Remove from Project"
msgstr "Verwijder van Project"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr ""
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr ""
#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr ""
#: lazarusidestrconsts.lisremovelocalvariable3
msgid "Remove local variable \"%s\""
msgstr ""
#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr ""
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr ""
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr ""
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Verwijder ze"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr ""
#: lazarusidestrconsts.lisremoveuses
msgid "Remove uses \"%s\""
msgstr ""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Hernoemen"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr ""
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Hernoem bestand?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Hernoemen van bestand gefaald."
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr ""
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr ""
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Hernoemen in kleine letters"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr ""
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr ""
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr ""
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr ""
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Vervangen"
#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacedtypeswiths
msgid "Replaced type \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr ""
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr ""
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr ""
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr ""
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Het vervangen van de selectie is niet gelukt."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr ""
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr ""
#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr ""
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr ""
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr ""
#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr ""
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Fout bij opslaan Resource"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr ""
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Herstart"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr ""
#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
msgstr ""
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent // the case list will be generated without extra indentation\n"
msgstr ""
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Terugzetten mislukt"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Rechter ankering"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr ""
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Dit is het verwante control waaraan de rechterzijde is verankerd. Laat het leeg voor ouders"
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Rechter kanten"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Verdeel rechter kant evenredig"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr ""
#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr ""
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Starten"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr ""
#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Starten"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr ""
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Bestand niet uitvoerbaar"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, fuzzy
#| msgid "The host application %s%s%s is not executable."
msgid "The host application \"%s\" is not executable."
msgstr "Het \"host\" programma \"%s\" is niet uitvoerbaar."
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Starten"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr ""
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr ""
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgstr ""
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Uitvoeren to mislukte"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr ""
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr ""
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr ""
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr ""
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr ""
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr ""
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""
#: lazarusidestrconsts.lissave
#, fuzzy
#| msgid "Save ..."
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Opslaan ..."
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Alles Opslaan"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr ""
#: lazarusidestrconsts.lissaveallmodified
#, fuzzy
#| msgid "save all modified files"
msgid "Save all modified files"
msgstr "alle gewijzigde bestanden opslaan"
#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr ""
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Opslaan en dialoog sluiten"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Opslaan and IDE opnieuw bouwen"
#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Opslaan Als"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr ""
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Wijzigingen opslaan?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Wijzigingen in project %s opslaan?"
#: lazarusidestrconsts.lissavecurrenteditorfile
#, fuzzy
#| msgid "save current editor file"
msgid "Save current editor file"
msgstr "huidige bestanden in de bewerker opslaan"
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr ""
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr ""
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Bewaar bewerker info voor bestanden buiten het project"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Sla bestand op als"
#: lazarusidestrconsts.lissavefilebeforeclosingform
#, fuzzy
#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Bestand \"%s\"%sopslaan voor het sluiten van form \"%s\"?"
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Bewaar info gesloten bewerker bestanden"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr ""
#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr ""
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr ""
#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr ""
#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr ""
#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr ""
#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr ""
#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr ""
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Sla instelling op"
#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr ""
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Opslaan "
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr ""
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Schaal:"
#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr ""
#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr ""
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr ""
#: lazarusidestrconsts.lisscanning2
msgid "%s. Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr ""
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr ""
#: lazarusidestrconsts.lissearchunit
msgid "Search Unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "tweede configuratie directory, waar Lazarus zoekt voor configuratie template bestanden. Standaard is "
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr ""
#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr ""
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Zie meldingen."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sZie project -> Project Inspecteur"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Selecteer een help item:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Selecteer een node"
#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr ""
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Selecteer Delphi form bestanden (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr ""
#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr ""
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr ""
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr ""
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr ""
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr ""
#: lazarusidestrconsts.lisselectedmodeswerebuilt
msgid "Selected %d modes were successfully built."
msgstr ""
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr ""
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Selectie overschrijdt string constante"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Selectie tool"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr ""
#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr ""
#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr ""
#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr ""
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr ""
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr ""
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr ""
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr ""
#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr ""
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr ""
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts.lisshowabstractmethodsof
msgid "Show abstract methods of \"%s\""
msgstr ""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr ""
#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr ""
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr ""
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr ""
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr ""
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr ""
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr ""
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr ""
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr ""
#: lazarusidestrconsts.lisshowhintsinobjectinspector
#, fuzzy
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Toon hints in Object Inspecteur"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr ""
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr ""
#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr ""
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr ""
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr ""
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview Gutter"
msgstr ""
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Toon paketten"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr ""
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr ""
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr ""
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr ""
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr ""
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr ""
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr ""
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr ""
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Toon units"
#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr ""
#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr ""
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr ""
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr ""
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr ""
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Nakomeling"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr ""
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr ""
#: lazarusidestrconsts.lissimplesyntax
#, fuzzy
#| msgid "Simple Syntax"
msgid "Simple syntax"
msgstr "Eenvoudige syntax"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr ""
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr ""
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Sla bestand over en vervolg het laden"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Sla het laden van het laatste project over"
#: lazarusidestrconsts.lisskipthesewarnings
msgid "Skip these warnings"
msgstr ""
#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr ""
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr ""
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Komt overeen"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Excuses, dit type is nog niet geimplementeerd."
#: lazarusidestrconsts.lissortforscope
msgid "Sort for scope"
msgstr ""
#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr ""
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Neerwaarts"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr ""
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Neerwaarts"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domein"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Negeer Space"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Regels"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opties"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragrafen"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Voorbeeld"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Accepteer"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Sorteer Selectie"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Woorden"
#: lazarusidestrconsts.lissortunicoderangelistalphabetically
msgid "Sort Unicode range list alphabetically"
msgstr ""
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Bron en doel zijn het zelfde:%s%s"
#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it."
msgstr ""
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, fuzzy
#| msgid "Source directory %s%s%s does not exist."
msgid "Source directory \"%s\" does not exist."
msgstr "Bron directory \"%s\" bestaat niet"
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr ""
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Bron gewijzigd"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, fuzzy
#| msgid "Source of page %s%s%s has changed. Save?"
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Bron van pagina \"%s\" is gewijzigd. Opslaan?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr ""
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Bron paden"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Gelijkmatige verdeling"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr ""
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Bezig met zoeken"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Zoek tekst"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr ""
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Met een nieuw project starten"
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr ""
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Stoppen"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Stop huidige debugsessie en het project opnieuw bouwen?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Stoppen met debuggen?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Stop debugsessie"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr ""
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Stoppen met debuggen?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr ""
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr ""
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Fout in streaming"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr ""
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr ""
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Subprocedure"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Subprocedure op hetzelfde niveau"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Succes!"
#: lazarusidestrconsts.lissuccessfullyexported
msgid "Successfully exported to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
msgid "Successfully exported compiler options to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimported
msgid "Successfully imported from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
msgid "Successfully imported compiler options from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr ""
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr ""
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr ""
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "SVN revisie: "
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Ongeldige variabele naam"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, fuzzy
#| msgid "%s%s%s is not a valid identifier."
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" is geen geldige identifier."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Overrule the systeem variabele"
#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr ""
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr ""
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr ""
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr ""
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr ""
#: lazarusidestrconsts.listaborderof
#, fuzzy
#| msgid "Tab Order of"
msgid "Tab Order of %s"
msgstr "Tab volgorde van %s"
#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr ""
#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr ""
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr ""
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr ""
#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr ""
#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr ""
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr ""
#: lazarusidestrconsts.listarget2
msgid ", Target: %s"
msgstr ""
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Doel processor"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr ""
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr ""
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Doelbestandsnaam van het projekt"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""
#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr ""
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Doel OS"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ""
#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr ""
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Testdirectorie"
#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr ""
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr ""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, fuzzy
#| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "De klasse \"%s\" is een TControl en kan niet op een niet control geplaatst worden.%sPlakken mislukt."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The Codetools found an error:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecommandafterisnotexecutable
#, fuzzy
#| msgid "The command after %s%s%s is not executable."
msgid "The command after \"%s\" is not executable."
msgstr "Het commando na \"%s\" kan niet worden uitgevoerd."
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
#, fuzzy
#| msgid "The command after publishing is invalid:%s%s%s%s"
msgid "The command after publishing is invalid:%s\"%s\""
msgstr "Het commando na publicatie is ongeldig:%s\"%s\""
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, fuzzy
#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "De component bewerker van klasse \"%s\"%saangeroepen met #%s \"%s\"%sveroorzaakte de fout:%s\"%s\""
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr ""
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr ""
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
msgid "The %s contains a nonexistent directory:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr ""
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr ""
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, fuzzy
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "De debugger \"%s\"%sbestaat niet of is niet uitvoerbaar.%sZie Instellingen -> Debugger opties"
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr ""
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, fuzzy
#| msgid "The destination directory%s%s%s%s does not exist."
msgid "The destination directory%s\"%s\" does not exist."
msgstr "De doel directorie%s\"%s\" bestaat niet."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr ""
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, fuzzy
#| msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "De directory \"%s\" is overbodig in het unit pad.%sDirectory verwijderen?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory \"%s\" is not writable."
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
#, fuzzy
#| msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?"
msgstr "De directory \"%s\" is nog niet in het unit path.%sDirectory toevoegen?"
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr ""
#: lazarusidestrconsts.listhefile
#, fuzzy
#| msgid "The file %s%s%s"
msgid "The file \"%s\""
msgstr "Het bestand \"%s\""
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr ""
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
msgstr ""
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr ""
#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, fuzzy
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "het bestand \"%s\" lijkt een programma te zijn. %sHet huidige project sluiten, en een nieuw Lazarus project voor dit programma maken?%s\"Nee\" zal het bestand als een normale bron laden."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, fuzzy
#| msgid "The file %s seems to be the program file of an existing lazarus Project."
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Het bestand %s lijkt het programma bestand te zijn van een bestaand Lazarus project."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, fuzzy
#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "Het bestand \"%s\" is niet gevonden.%sWilt u het zelf zoeken?"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, fuzzy
#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Het bestand \"%s\" is niet gevonden.%sIgnore gaat door met het laden,%sAbort stopt het laden van het project."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, fuzzy
#| msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "De volgende methoden gebruikt door %s zijn niet in de bron%s%s%s%s%sVerwijder deze referenties?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr ""
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, fuzzy
#| msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "Het startende programma \"%s\"%sbestaat niet of is niet uitvoerbaar.%sZie Starten -> Start paramaters -> Lokaal"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "Het LFM (Lazarus form) bestand bevat ongeldige properties. Dit kan betekenen dat het properties/klassen bevat, die niet in de huidige LCL voorkomen. De manier om dit te repareren is deze properties te verwijderen uit de lfm en de pascal handmatig aan te passen."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr ""
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory \"%s\" is missing."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr ""
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr ""
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""
#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr ""
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr ""
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, fuzzy
#| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "Het programma \"make\" is niet gevonden.%sDit is nodig om lazarus te bouwen."
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr ""
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr ""
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, fuzzy
#| msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "Het project info bestand \"%s\"%sis gelijk aan het hoofd bronbestand van het project!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file \"%s\"%shas changed on disk."
msgstr ""
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, fuzzy
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Het project moet worden opgeslagen voor het bouwen%sAls je de Test Directory invuld bij de Omgeving Opties,%skun je nieuwe projecten maken en deze gelijk bouwen.%sPorject opslaan?"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr ""
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr ""
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr ""
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
msgid "%sThere are additional notes for this message on%s"
msgstr ""
#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr ""
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Er zijn andere bestanden in de directory met dezelfde naam,%salleen met andere hoofdletters:%s%s%sDeze verwijderen?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, fuzzy
#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "Er is een bestand met dezelfde naam en een gelijke extensie op disk%sBestand%s%sDubbel bestand %s%s verwijderen?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyafilein
msgid "There is already a file%s%s%sin %s"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, fuzzy
#| msgid "There is already a form with the name %s%s%s"
msgid "There is already a form with the name \"%s\""
msgstr "Er is al een form net de naam \"%s\""
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr ""
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, fuzzy
#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Er is al een unit met de naam \"%s\". Pascal identifiers moeten uniek zijn."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, fuzzy
#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Er is een unit met de naam \"%s\" in het project.%sKies een andere naam"
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr ""
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr ""
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr ""
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Er is een fout opgetreden tijdens het opslaan van het geselecteerde component %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Er is een fout opgetreden tijdens het converteren van de binaire stream van het geselecteerde component %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Er is een fout opgetreden tijdens het kopiëren van de component stream naar het klembord:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
#, fuzzy
#| msgid "The root component can not be deleted."
msgid "The root component cannot be deleted."
msgstr "Het root component kan niet verwijderd worden."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr ""
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr ""
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr ""
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhetargetisnotwritable
msgid "The target %s is not writable."
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr ""
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr ""
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr ""
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr ""
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr ""
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr ""
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, fuzzy
#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "De unit heeft zelf al de naam \"%s\". Pascal identifiers moeten uniek zijn."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr ""
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr ""
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "Dit Help bericht"
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr ""
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, fuzzy
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Dit lijkt op een pascal bestand.%sAangeraden wordt om alleen kleine letters te gebruiken in de bestandnaam, om problemen te voorkomen.%sHernoemen naar kleine letters?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr ""
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr ""
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Dit statement kan niet worden gedistilleerd.%sSelecteer meer code om een nieuwe procedure te distilleren."
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr ""
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr ""
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr ""
#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr ""
#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr ""
#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr ""
#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Regel"
#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr ""
#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr ""
#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Status"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr ""
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr ""
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""
#: lazarusidestrconsts.listitleopencomponenticon24x24
msgid "Choose a component icon 24x24"
msgstr ""
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Functie: toevoegen pad scheidingsteken"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
#, fuzzy
#| msgid "Function: chomp path delimiter"
msgid "Function: remove trailing path delimiter"
msgstr "Functie: afhakken pad scheidingsteken"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Functie: destilleer bestandsextensie"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Functie: destilleer bestandsnaam+extensie"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Functie: destilleer alleen bestandsnaam"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Functie: destilleer pad naar bestand"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(onbekende macro: %s)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Pad:"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr ""
#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr ""
#: lazarusidestrconsts.listoolbaroptions
msgid "Toolbar"
msgstr ""
#: lazarusidestrconsts.listoolbaroptionshighlight
msgid "Highlight toolbars buttons"
msgstr ""
#: lazarusidestrconsts.listoolbaroptionsraise
msgid "Raise toolbars"
msgstr ""
#: lazarusidestrconsts.listoolhasnoexecutable
msgid "tool \"%s\" has no executable"
msgstr ""
#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr ""
#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr ""
#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr ""
#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr ""
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr ""
#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Top verankering"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Top randruimte."
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Tops"
#: lazarusidestrconsts.listopsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Dit is het verwante control waaraan de bovenzijde is verankerd. Laat het leeg voor ouders"
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Top evenredig verdelen"
#: lazarusidestrconsts.listotalpages
msgid "Total Pages: %s"
msgstr ""
#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr ""
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr ""
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr ""
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr ""
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr ""
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr ""
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr ""
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr ""
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr ""
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr ""
#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr ""
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr ""
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr ""
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr ""
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr ""
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr ""
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr ""
#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Toon dit bericht niet meer."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Fout in reguliere expressie"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Lettertype zonder UTF-8"
#: lazarusidestrconsts.lisuegotoline
#, fuzzy
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Ga naar regel :"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr ""
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Niet gevonden."
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, fuzzy
#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Vervang dit exemplaar van \"%s\"%s met \"%s\"?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Zoek naar: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Zoekstring '%s' niet gevonden"
#: lazarusidestrconsts.lisuethecurre
#, fuzzy
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Het huidige lettertype van de editor ondersteunt geen UTF-8, maar uw systeem schijnt het te gebruiken.%sNiet-ASCII karakters zullen waarschijnlijk incorrect afgebeeld worden.%sU kunt een ander lettertype in de editor-opties selecteren."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr ""
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s bytes"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Opgenomen door"
#: lazarusidestrconsts.lisuidinproject
#, fuzzy
#| msgid "in Project:"
msgid "In project:"
msgstr "in Project:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Regels:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Naam:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "nee"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Grootte"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Type:"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "Ja"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Toon waarde van CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Kan binaire stream niet omzetten naar tekst"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Kan component niet naar het klembord kopiëren"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, fuzzy
#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Kan het resourceheader commentaar niet toeogen aan resource bestand %s\"%s\".%sWaarschijnlijk een syntax fout."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, fuzzy
#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Kan resource T%s:FORMDATA niet toevoegen aan resource bestand %s\"%s\".%sWaarschijnlijk een syntax fout."
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Kan %s niet toevoegen aan het project omdat er al een unit met dezelfde naam in het project is."
#: lazarusidestrconsts.lisunabletobackupfileto
#, fuzzy
#| msgid "Unable to backup file %s%s%s to %s%s%s!"
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Kan het bestand \"%s\" niet backup-en naar \"%s\"!"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sKan de klasse van %s niet wijzigen in %s"
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
msgid "Unable to change project scaled in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Kan doel directory niet opschonen"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, fuzzy
#| msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Kan \"%s\" niet opschonen.%sControleer de rechten."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Kan de component tekst niet omzetten in binair formaat:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
#, fuzzy
#| msgid "Unable to convert file %s%s%s%sError: %s"
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Kan het bestand \"%s\" niet convertere%sFout: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, fuzzy
#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Kan de tekst form data van bestand %s\"%s\"%sniet wijzigen in een binaire stream. (%s)."
#: lazarusidestrconsts.lisunabletoconverttoencoding
msgid "Unable to convert to encoding \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Kan het bestand niet kopiëren"
#: lazarusidestrconsts.lisunabletocopyfileto
#, fuzzy
#| msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgid "Unable to copy file \"%s\"%sto \"%s\""
msgstr "Kan het bestand \"%s\"%s niet kopiëren naar \"%s\""
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
#, fuzzy
#| msgid "Unable to create backup directory %s%s%s."
msgid "Unable to create backup directory \"%s\"."
msgstr "Kan geen backup directory maken \"%s\"."
#: lazarusidestrconsts.lisunabletocreatedirectory
#, fuzzy
#| msgid "Unable to create directory %s%s%s."
msgid "Unable to create directory \"%s\"."
msgstr "Kan de directory \"%s\" niet maken."
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Kan het bestand niet maken"
#: lazarusidestrconsts.lisunabletocreatefile2
#, fuzzy
#| msgid "Unable to create file %s%s%s"
msgid "Unable to create file \"%s\""
msgstr "Kan het bestand \"%s\" niet maken"
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s\"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link \"%s\" with target \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file, because there is already a directory with this name."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Lan geen tijdelijk lfm buffer maken."
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr ""
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, fuzzy
#| msgid "Unable to delete ambiguous file %s%s%s"
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Kan het dubbele bestand \"%s\" niet verwijderen"
#: lazarusidestrconsts.lisunabletoexecute
msgid "unable to execute: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, fuzzy
#| msgid "Unable to find a valid classname in %s%s%s"
msgid "Unable to find a valid classname in \"%s\""
msgstr "Kan geen geldige klassenaam vinden in \"%s\""
#: lazarusidestrconsts.lisunabletofindfile
#, fuzzy
#| msgid "Unable to find file %s%s%s."
msgid "Unable to find file \"%s\"."
msgstr "Kan het bestand \"%s\" niet vinden."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr ""
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Kan %s niet vinden in LFM stream."
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr ""
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Kan de bewerker-wijzigingen niet verzamelen."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Kan de broncode niet vinden voor de \"designer\"."
#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class \"%s\", because it depends on itself."
msgstr ""
#: lazarusidestrconsts.lisunabletoopen
msgid "Unable to open \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr ""
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Kan het bestand niet lezen"
#: lazarusidestrconsts.lisunabletoreadfile2
#, fuzzy
#| msgid "Unable to read file %s%s%s!"
msgid "Unable to read file \"%s\"."
msgstr "Kan het bestand \"%s\" niet lezen"
#: lazarusidestrconsts.lisunabletoreadfileerror
#, fuzzy
#| msgid "Unable to read file %s%s%s%sError: %s"
msgid "Unable to read file \"%s\"%sError: %s"
msgstr "Kan het bestand \"%s\" niet lezen%sFout: %s"
#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s\"%s\"."
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, fuzzy
#| msgid "Unable to remove old backup file %s%s%s!"
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Kan het oude backup bestand \"%s\" niet verwijderen!"
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
msgid "Unable to remove project scaled from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, fuzzy
#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Kan het dubbele bestand \"%s\"%sniet hernoemen in \"%s\""
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Kan het bestand niet hernoemen"
#: lazarusidestrconsts.lisunabletorenamefileto
#, fuzzy
#| msgid "Unable to rename file %s%s%s to %s%s%s!"
msgid "Unable to rename file \"%s\" to \"%s\"!"
msgstr "Kan het bestand \"%s\" niet hernoemen naar \"%s\"!"
#: lazarusidestrconsts.lisunabletorenamefileto2
#, fuzzy
#| msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgid "Unable to rename file \"%s\"%sto \"%s\"."
msgstr "Kan het bestand \"%s\"%sniet hernoemen in \"%s\"."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Kan het form niet in de broncode hernoemen."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Kan de methode niet hernoemen. Herstel de fout in het mededelingen scherm."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Kan de variabele niet hernoemen in de broncode."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr ""
#: lazarusidestrconsts.lisunabletorun2
msgid "Unable to run \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr ""
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr ""
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Kan geselecteerde componenten niet in stream opslaan"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Kan geselecteerde componenten niet in stream opslaan."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Kan %s:T%s niet in stream opslaan."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Kan de binaire stream met componenten van %s:T%s niet omzetten in tekst."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Kan het CreateForm statement niet wijzigen in de project broncode"
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Kan het bestand niet schrijven"
#: lazarusidestrconsts.lisunabletowritefile2
msgid "Unable to write file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisunabletowritefileerror
#, fuzzy
#| msgid "Unable to write file %s%s%s%sError: %s"
msgid "Unable to write file \"%s\"%sError: %s"
msgstr "Kan het bestand \"%s\" niet schrijven%sFout: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr ""
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr ""
#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr ""
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "De-installeer Selectie"
#: lazarusidestrconsts.lisunit
#, fuzzy
msgctxt "lazarusidestrconsts.lisunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit \"%s\" has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Unit identifier bestaat al"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Unitname existiert bereits im Projekt"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Unit naam begint met ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Unit naam bevat ..."
#: lazarusidestrconsts.lisunitnotfound
msgid "unit %s not found"
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundatnewposition
msgid "unit %s not found at new position \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Unit uitvoer directorie"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "Unitpad"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Unit paden"
#: lazarusidestrconsts.lisunitrequirespackage
msgid "unit %s requires package %s"
msgstr ""
#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr ""
#: lazarusidestrconsts.lisunusedunitsof
msgid "Unused units of %s"
msgstr ""
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr ""
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Naar boven"
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr ""
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr ""
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr ""
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
msgid "Updating PO files failed for package %s"
msgstr ""
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr ""
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr ""
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter."
msgstr ""
#: lazarusidestrconsts.lisurlonwikithebaseurlis
msgid "URL on wiki (the base url is %s)"
msgstr ""
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr ""
#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr ""
#: lazarusidestrconsts.lisuseansistrings
#, fuzzy
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Gebruik ANSI strings"
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr ""
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr ""
#: lazarusidestrconsts.lisusedby
msgid " used by %s"
msgstr ""
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr ""
#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr ""
#: lazarusidestrconsts.lisuseexcludefilter
#, fuzzy
#| msgid "Use Exclude Filter"
msgid "Use exclude filter"
msgstr "Gebruik \"uitsluit\" filter"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr ""
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr ""
#: lazarusidestrconsts.lisuseincludefilter
#, fuzzy
#| msgid "Use Include Filter"
msgid "Use include filter"
msgstr "Gebruik \"bevat\" filter"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Applicatie wordt gestart"
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr ""
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr ""
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr ""
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr ""
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr ""
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr ""
#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Waarde"
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr ""
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr ""
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr ""
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr ""
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Variabele"
#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr ""
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr ""
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versie"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr ""
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Verticaal"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr ""
#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr ""
#: lazarusidestrconsts.lisviewbreakpointproperties
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr ""
#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr ""
#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr ""
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Toon bron (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr ""
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
#, fuzzy
#| msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
msgstr "Waarschuwing: dubbel bestand gevonden: \"%s\". Broncode bestand is: \"%s\""
#: lazarusidestrconsts.liswarnings
msgid ", Warnings: %s"
msgstr ""
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr ""
#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr ""
#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr ""
#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr ""
#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr ""
#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr ""
#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr ""
#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr ""
#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr ""
#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr ""
#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr ""
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr ""
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr ""
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr ""
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr ""
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr ""
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr ""
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr ""
#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr ""
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr ""
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr ""
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Met benodigde paketten"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr ""
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr ""
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr ""
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Expressie"
#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr ""
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Eigenschappen"
#: lazarusidestrconsts.liswlwatchlist
msgid "Watch List"
msgstr ""
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Woord bij de huidige bewerker positie"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr ""
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr ""
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Schrijffout"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr ""
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr ""
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisyes
msgid "Yes"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr ""
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
#, fuzzy
#| msgid "You can not build lazarus while debugging or compiling."
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Je kunt lazarus niet bouwen tijdens het debuggen of compileren."
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr ""
#: lazarusidestrconsts.lis_all_
#, fuzzy
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Alles>"
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Broncode Bewerker"
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr ""
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldunabletodeletefile
msgid "Unable to delete file \"%s\""
msgstr ""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr ""
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr ""
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""
#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Binair"
#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr ""
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr ""
#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr ""
#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr ""
#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr ""
#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr ""
#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr ""
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr ""
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr ""
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr ""
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr ""
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr ""
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr ""
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr ""
#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr ""
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr ""
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr ""
#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr ""
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextcompile
msgid "Force update PO files on next compile"
msgstr ""
#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr ""
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr ""
#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnnameshint
msgid "Column Names"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
msgid "Strategy for saving Columns"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnwidthhint
msgid "Column Width"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomgeometry
msgid "Custom geometry"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomgeometryhint
msgid "User can define window's position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
msgid "Fixed default geometry"
msgstr ""
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
msgid "Always the same fixed position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
msgid "Let windowmanager decide"
msgstr ""
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
msgid "System windowmanagers have different strategies for positioning windows"
msgstr ""
#: lazarusidestrconsts.rsiwppositionwindowlisthint
msgid "Windows that have been open. They may be closed now."
msgstr ""
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Herstel window plaatsing"
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
msgid "Use previous position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplittercustomposition
msgid "Custom Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterdefault
msgid "Default Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
msgid "Restore with window"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
msgid "Restore Size"
msgstr ""
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr ""
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabisch"
#: lazarusidestrconsts.rslanguageautomatic
#, fuzzy
#| msgid "Automatic (or english)"
msgid "Automatic (or English)"
msgstr "Automatisch (of Engels)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalaans"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Chinees"
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr ""
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Nederlands"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Engels"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Fins"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Frans"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Duits"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebreeuws"
#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr ""
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonesisch"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Itiliaans"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japans"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr ""
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr ""
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Pools"
#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr ""
#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr ""
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Russisch"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr ""
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr ""
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Spaans"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr ""
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Oekraiens"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr ""
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr ""
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr ""
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr ""
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr ""
#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr ""
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Type"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr ""
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr ""
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr ""
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr ""
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Help menu acties"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Opdrachtopdrachten"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "CodeToolscommando's"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Cursor beweeg commando's"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Tekstverwerkingsopdrachten"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Bestandsmenu acties"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr ""
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Macros"
#: lazarusidestrconsts.srkmcatmarker
#, fuzzy
#| msgid "Text marker commands"
msgid "Text bookmark commands"
msgstr "Tekstmarkering opdrachten"
#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr ""
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Project menu commandos"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Start menu commando's"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Tekstzoek- en vervangopdrachten"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Tekstselectieopdrachten"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Bron notitieblok opdrachten"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Hulpmiddelen menu commando's"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Toon Menu commando's"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Opdracht:"
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Conflict "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "Bouw afbreken"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
#, fuzzy
#| msgid "Add jump point"
msgid "Add Jump Point"
msgstr "Springpunt toevoegen"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "Watch toevoegen"
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr ""
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Broncodesjablooncompletering"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Blok Inspringen"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr ""
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Unindent Blok"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Bouw programma/project"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Bouw bestand"
#: lazarusidestrconsts.srkmecbuildlazarus
#, fuzzy
#| msgid "Build lazarus"
msgid "Build Lazarus"
msgstr "Bouw Lazarus"
#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr ""
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Karakter"
#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr ""
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Verwijder gehele tekst"
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr ""
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr ""
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr ""
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Kolom selectie methode"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr ""
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "Configureer bouwbestand"
#: lazarusidestrconsts.srkmeccopy
#, fuzzy
#| msgid "Copy selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Kopieer selectie naar klembord"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr ""
#: lazarusidestrconsts.srkmeccut
#, fuzzy
#| msgid "Cut selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Knip selectie naar klembord"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Verwijder tot het begin van de regel"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Verwijder karakter bij cursor"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Verwijder tot het eind van de regel"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Verwijder laatste karakter"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Verwijder tot het begin van het woord"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Verwijder huidige regel"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Verwijder tot het eind van het woord"
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr ""
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Verschil"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr ""
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Verplaats cursor naar het absolute eind"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Verplaats cursor naar het absolute begin"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr ""
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "bereken/wijzig"
#: lazarusidestrconsts.srkmecextractproc
#, fuzzy
#| msgid "Extract procedure"
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Destilleer procedure"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Extern gereedschap %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Externe hulpmiddelen instellingen"
#: lazarusidestrconsts.srkmecfind
#, fuzzy
#| msgid "Find text"
msgid "Find Text"
msgstr "Zoek tekst"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Zoek blok Einde"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Zoek blok Start"
#: lazarusidestrconsts.srkmecfinddeclaration
#, fuzzy
#| msgid "Find declaration"
msgid "Find Declaration"
msgstr "Zoek Declaratie"
#: lazarusidestrconsts.srkmecfindidentifierrefs
#, fuzzy
#| msgid "Find identifier references"
msgid "Find Identifier References"
msgstr "Vind identifier referenties"
#: lazarusidestrconsts.srkmecfindinfiles
#, fuzzy
#| msgid "Find in files"
msgid "Find in Files"
msgstr "Vind in bestanden"
#: lazarusidestrconsts.srkmecfindnext
#, fuzzy
#| msgid "Find next"
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Vind volgende"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr ""
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr ""
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
#, fuzzy
#| msgid "Find previous"
msgid "Find Previous"
msgstr "Vind vorige"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr ""
#: lazarusidestrconsts.srkmecfindproceduredefinition
#, fuzzy
#| msgid "Find procedure definiton"
msgid "Find Procedure Definiton"
msgstr "Vind procedure definitie"
#: lazarusidestrconsts.srkmecfindproceduremethod
#, fuzzy
#| msgid "Find procedure method"
msgid "Find Procedure Method"
msgstr "Vind procedure methode"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr ""
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Ga naar tekstverwerker %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
#, fuzzy
#| msgid "Go to to include directive of current include file"
msgid "Go to include directive of current include file"
msgstr "Ga naar include opdracht van huidig include bestand"
#: lazarusidestrconsts.srkmecgotolinenumber
#, fuzzy
#| msgid "Go to line number"
msgid "Go to Line Number"
msgstr "Ga naar lijn nummer"
#: lazarusidestrconsts.srkmecgotomarker
#, fuzzy
#| msgid "Go to Marker %d"
msgid "Go to bookmark %d"
msgstr "Ga naar Marker %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Ga naar XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced $IFDEF"
msgid "Guess Misplaced $IFDEF"
msgstr "Corrigeer verkeerde $IFDEF"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "ChangeLog item toevoegen"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Invoegen vanaf de karaktermap"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Invoegen CVS Keyword Auteur"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Invoegen CVS keyword Datum"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Invoegen CVS keyword Header"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Invoegen CVS keyword ID"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Invoegen CVS keyword Log"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Invoegen CVS keyword Naam"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Invoegen CVS keyword Revisie"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Invoegen CVS keyword Broncode"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Huidige datum tijd invoegen"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr ""
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Invoegen GPL notice"
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr ""
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "LGPL melding invoegen"
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Breek lijn, verlaat cursor"
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Invoeg mode"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Huidige gebruikers naam invoegen"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspecteer"
#: lazarusidestrconsts.srkmecinvertassignment
#, fuzzy
#| msgid "Invert assignment"
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Draai toekenning om"
#: lazarusidestrconsts.srkmeckeymapleft
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.srkmeckeymapright
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr ""
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Breek lijn, en verplaats cursor"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Verplaats cursor naar regeleinde"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Regelselectie mode"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Verplaats cursor naar regelbegin"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr ""
#: lazarusidestrconsts.srkmecmakeresourcestring
#, fuzzy
#| msgid "Make resource string"
msgid "Make Resource String"
msgstr "Maak resource string"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Ga naar bijpassende haak"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Editor naar links"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Editor naar rechts"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""
#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr ""
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Volgend bookmark"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Ga naar volgende tekstverwerker"
#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr ""
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr ""
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr ""
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normale selectie modus"
#: lazarusidestrconsts.srkmecopenfileatcursor
#, fuzzy
#| msgid "Open file at cursor"
msgid "Open File at Cursor"
msgstr "Open bestand (op cursor)"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Overschrijf mode"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Verplaats cursor naar de onderkant van de pagina"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Verplaats cursor een pagina omlaag"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Verplaats cursor een pagina naar links"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Verplaats cursor een pagina naar rechts"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Verplaats cursor naar de top van de pagina"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Verplaats cursor een pagina omhoog"
#: lazarusidestrconsts.srkmecpaste
#, fuzzy
#| msgid "Paste clipboard to current position"
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Plak klembord op de huidige positie"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pauzeer programma"
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Vorig Bookmark"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Ga naar vorige tekstverwerker"
#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr ""
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr ""
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr ""
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "Snel-compilatie, geen linking"
#: lazarusidestrconsts.srkmecremovebreakpoint
#, fuzzy
#| msgid "remove break point"
msgid "remove breakpoint"
msgstr "verwijder breekpunt"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr ""
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr ""
#: lazarusidestrconsts.srkmecrenameidentifier
#, fuzzy
#| msgid "Rename identifier"
msgid "Rename Identifier"
msgstr "Hernoem identifier"
#: lazarusidestrconsts.srkmecreplace
#, fuzzy
#| msgid "Replace text"
msgid "Replace Text"
msgstr "Vervang tekst"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr ""
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "reset debugger"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr ""
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "voer programma uit"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "voer bestand uit"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "uitvoer parameters"
#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr ""
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Scroll een regel naar beneden"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Scroll een karakter naar links"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Scroll een karakter naar rechts"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Scroll een regel omhoog"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Selecteer naar beneden"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Selecteer Alles"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Converteer tabs naar spaties in selectie"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Selecteer tot eind"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Selecteer tot begin"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Selecteer Goto XY"
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecselleft
#, fuzzy
#| msgid "SelLeft"
msgid "Select Left"
msgstr "SelLinks"
#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Selecteer regel einde"
#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Selecteer regel begin"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Selecteer onderkant Pagina"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Selecteer pagina naar beneden"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Selecteer pagina Links"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Selecteer pagina rechts"
#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Select bovenkant pagina"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Selecteer pagina omhoog"
#: lazarusidestrconsts.srkmecselright
#, fuzzy
#| msgid "SelRight"
msgid "Select Right"
msgstr "SelRechts"
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Selecteer omhoog"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Selecteer linker woord"
#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Selecteer rechter woord"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecsetmarker
#, fuzzy
#| msgid "Set Marker %d"
msgid "Set bookmark %d"
msgstr "Zet markering %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr ""
#: lazarusidestrconsts.srkmecshowcodecontext
#, fuzzy
#| msgid "Show code context"
msgid "Show Code Context"
msgstr "Toon code samenhang"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr ""
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "Stop programma"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsyntaxcheck
#, fuzzy
#| msgid "Syntax check"
msgid "Syntax Check"
msgstr "Syntax controleren"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Toon Breekpunten"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Toon Call Stack"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Toon Code Verkenner"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Toon component palette"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Toon Debugger output "
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Schakel tussen form en unit"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr ""
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Toon IDE speed buttons"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Toon lokale variabelen"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle bookmark %d"
msgstr ""
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr ""
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Toon Berichten"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Wissel mode"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Toon Object Inspecteur"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr ""
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Toon zoek resultaten"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Toon Broncode Bewerker"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Toon Watches"
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "Onbekend bewerker-commando"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr ""
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr ""
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Toon anker bewerker"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr ""
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr ""
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Toon Forms"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr ""
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Toon Unit Afhankelijkheden"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Toon Unit informatie"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Toon Units"
#: lazarusidestrconsts.srkmecwordcompletion
#, fuzzy
#| msgid "Word completion"
msgid "Word Completion"
msgstr "Woord completering"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Verplaats cursor een woord naar links"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Verplaats cursor een woord naar rechts"
#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr ""
#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr ""
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr ""
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr ""
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr ""
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr ""
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr ""
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr ""
#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr ""
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Bestand is alleen-lezen"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Het bestand \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" is niet beschrijfbaar."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr ""
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr ""
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr ""
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "&Kijk op positie cursor toevoegen"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr ""
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Bookmark"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr ""
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Sluit Pagina"
#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Kopieer bestandsnaam"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr ""
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr ""
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr ""
#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr ""
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr ""
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Zoek declaratie"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr ""
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Ga naar bladwijzer"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr ""
#: lazarusidestrconsts.ueminspect
#, fuzzy
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "Inspecteer ..."
#: lazarusidestrconsts.ueminvertassignment
#, fuzzy
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Draai toekenning om"
#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr ""
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr ""
#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr ""
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr ""
#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr ""
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr ""
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr ""
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr ""
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr ""
#: lazarusidestrconsts.uemnextbookmark
#, fuzzy
#| msgid "Goto next Bookmark"
msgid "Goto Next Bookmark"
msgstr "Ga naar volgend Bookmark"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Gewijzigd"
#: lazarusidestrconsts.uemopenfileatcursor
#, fuzzy
#| msgid "&Open file at cursor"
msgid "&Open File at Cursor"
msgstr "&Open bestand op positie van cursor"
#: lazarusidestrconsts.uemprevbookmark
#, fuzzy
#| msgid "Goto previous Bookmark"
msgid "Goto Previous Bookmark"
msgstr "Ga naar vorig Bookmark"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Procedure sprong"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Niet wijzigbaar"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Start tot cursor"
#: lazarusidestrconsts.uemsetfreebookmark
#, fuzzy
#| msgid "Set a free Bookmark"
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Plaats een beschikbaar Bookmark"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Toon regelnummers"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr ""
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr ""
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr ""
#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Toon Call Stack"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Nog niet geimplementeerd"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Niet wijzigbaar"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Versie informatie"