mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2026-02-04 08:44:48 +01:00
15197 lines
471 KiB
Plaintext
15197 lines
471 KiB
Plaintext
msgid ""
|
||
msgstr ""
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Project-Id-Version: Lazarus\n"
|
||
"POT-Creation-Date: \n"
|
||
"PO-Revision-Date: \n"
|
||
"Last-Translator: Marcelo Borges de Paula\n"
|
||
"Language-Team: \n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Poedit-Language: Portuguese\n"
|
||
"X-Poedit-Country: BRAZIL\n"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetall
|
||
msgid "Reset all settings"
|
||
msgstr "Reajustar todas configurações"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetgutter
|
||
msgid "Reset all gutter settings"
|
||
msgstr "Reajustar todas configurações medianiz"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresettext
|
||
msgid "Reset all text settings"
|
||
msgstr "Reajustar todas configurações texto"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplediff
|
||
#| msgid "This page does not represent your current settings. See advandced page. Use this page to reset any advanced changes"
|
||
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
||
msgstr "Esta página não representa suas configurações atuais. Veja página avançada. Use esta página para reajustar quaisquer alterações avançadas."
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
||
msgid "General"
|
||
msgstr "Geral"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
||
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
|
||
msgstr "Padrão, Todas ações (ponto parada, retração) no Mouse abaixo"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
||
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
|
||
msgstr "Extendido, Ações (ponto parada, retração) no Mouse acima. Seleção no Mouse abaixo e movimento"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
||
msgid "Gutter"
|
||
msgstr "Medianiz"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
||
msgid "Right mouse includes caret move"
|
||
msgstr "Mouse direita inclui movimento marca"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
||
msgid "Text"
|
||
msgstr "Texto"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectalt
|
||
msgid "Alt-Key sets column mode"
|
||
msgstr "Tecla Alt ajusta modo coluna"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
|
||
msgid "Ctrl Left Button"
|
||
msgstr "Ctrl Botão Esquerdo"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
|
||
msgid "jumps to implementation"
|
||
msgstr "salta para implementação"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
|
||
msgid "jumps to implementation/other block end"
|
||
msgstr "salta para implementação/outro final bloco"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
|
||
msgid "nothing"
|
||
msgstr "nada"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
|
||
msgid "Double Click selects line"
|
||
msgstr "Duplo Clique seleciona linha"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
||
msgid "Drag Selection (copy/paste)"
|
||
msgstr "Arrastar Seleção (copiar/colar)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
|
||
msgid "jumps to implementation"
|
||
msgstr "salta para implementação"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
||
msgid "Middle Button"
|
||
msgstr "Botão Central"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
|
||
msgid "nothing"
|
||
msgstr "nada"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
|
||
msgid "paste selection"
|
||
msgstr "colar seleção"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewarning
|
||
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
||
msgstr "Você tem alterações não salvas. Ao usar esta página, todas alterações feitas na página avançado serão desfeitas"
|
||
|
||
#: lazarusidestrconsts.dlfreadonlycolor
|
||
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
||
msgid "Read Only"
|
||
msgstr "Somente Leitura"
|
||
|
||
#: lazarusidestrconsts.dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr "Minúscula, primeira letra maiúscula"
|
||
|
||
#: lazarusidestrconsts.dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr "Adicionar operador de atribuição :="
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
||
msgid "Brackets highlight"
|
||
msgstr "Realçar parênteses"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
||
msgid "Code folding tree"
|
||
msgstr "Árvore código retrátil"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
||
msgid "Disabled breakpoint"
|
||
msgstr "Ponto de parada desabilitado"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
||
msgid "Enabled breakpoint"
|
||
msgstr "Ponto de parada habilitado"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
||
msgid "Error line"
|
||
msgstr "Linha erro"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
||
msgid "Execution point"
|
||
msgstr "Ponto execução"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
||
#| msgid "Folded code"
|
||
msgid "Folded code marker"
|
||
msgstr "Marcador código retraído"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
||
msgid "Gutter"
|
||
msgstr "Medianiz"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
||
msgid "Line"
|
||
msgstr "Linha"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
||
msgid "Syncron Edit"
|
||
msgstr "Edição Síncrona"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
||
msgid "Template Edit"
|
||
msgstr "Edição Modelo"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
||
msgid "Text"
|
||
msgstr "Texto"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
||
msgid "Gutter Separator"
|
||
msgstr "Separador Medianiz"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
||
#| msgid "Highlight all"
|
||
msgid "Incremental others"
|
||
msgstr "Outros Incrementais"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
||
msgid "Highlight current word"
|
||
msgstr "Realçar palavra atual"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
||
#| msgid "Incremental search match"
|
||
msgid "Incremental search"
|
||
msgstr "Busca incremental"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
||
msgid "Invalid breakpoint"
|
||
msgstr "Ponto de parada inválido"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
||
#| msgid "Line highlight"
|
||
msgid "Current line highlight"
|
||
msgstr "Realce linha atual"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
||
msgid "Line number"
|
||
msgstr "Número linha"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
||
msgid "Modified line"
|
||
msgstr "Linha modificada"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
||
msgid "Mouse link"
|
||
msgstr "Vínculo \"mouse\""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
||
#| msgid "SyncronEdit Range"
|
||
msgid "Selected Area"
|
||
msgstr "Área selecionada"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
||
#| msgid "SyncronEdit Current Cells"
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
||
msgid "Active Cell"
|
||
msgstr "Célula Ativa"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
||
#| msgid "SyncronEdit Other Cells"
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
||
msgid "Other Cells"
|
||
msgstr "Outras Células"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
||
#| msgid "SyncronEdit Syncron Cells"
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr "Células sincronizadas"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
||
#| msgid "TemplateEdit Current"
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
||
msgid "Active Cell"
|
||
msgstr "Célula Ativa"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
||
#| msgid "TemplateEdit Cells"
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
||
msgid "Other Cells"
|
||
msgstr "Outras Células"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
||
#| msgid "TemplateEdit Sync"
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr "Células Sincronizadas"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
||
msgid "Text block"
|
||
msgstr "Bloco texto"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
||
msgid "Unknown breakpoint"
|
||
msgstr "Ponto de parada desconhecido"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
||
msgid "Word-Brackets"
|
||
msgstr "Palavra entre Parênteses"
|
||
|
||
#: lazarusidestrconsts.dlgadditionalsrcpath
|
||
msgid "Additional Source search path for all projects (.pp;.pas)"
|
||
msgstr "Caminho de Busca de fonte adicional para todos os projetos (.pp;.pas)"
|
||
|
||
#: lazarusidestrconsts.dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "Adicionar ponto e vírgula"
|
||
|
||
#: lazarusidestrconsts.dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "Ajustar linha superior devido ao comentário em frente"
|
||
|
||
#: lazarusidestrconsts.dlgallfiles
|
||
msgid "All files"
|
||
msgstr "Todos os arquivos"
|
||
|
||
#: lazarusidestrconsts.dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "Alfabeticamente"
|
||
|
||
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
||
msgid "Always visible cursor"
|
||
msgstr "Cursor sempre visível"
|
||
|
||
#: lazarusidestrconsts.dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr "Ação ambígua de arquivos:"
|
||
|
||
#: lazarusidestrconsts.dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr "Aviso ao compilar"
|
||
|
||
#: lazarusidestrconsts.dlgapplicationsettings
|
||
msgid "Application Settings"
|
||
msgstr "Configuração da Aplicação"
|
||
|
||
#: lazarusidestrconsts.dlgassemblerdefault
|
||
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
|
||
msgid "Default"
|
||
msgstr "Padrão"
|
||
|
||
#: lazarusidestrconsts.dlgassertcode
|
||
msgid "Include Assertion Code"
|
||
msgstr "Incluir Código de Afirmação"
|
||
|
||
#: lazarusidestrconsts.dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr "Formulários auto. criados"
|
||
|
||
#: lazarusidestrconsts.dlgautocreatenewforms
|
||
msgid "When creating new forms, add them to auto-created forms"
|
||
msgstr "Quando criar novos formulários, adicioná-los a formulários auto. criados"
|
||
|
||
#: lazarusidestrconsts.dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "Auto excluir arquivos"
|
||
|
||
#: lazarusidestrconsts.dlgautohidecursor
|
||
msgid "Hide mouse when typing"
|
||
msgstr "Ocultar \"mouse\" ao digitar"
|
||
|
||
#: lazarusidestrconsts.dlgautoindent
|
||
msgid "Auto indent"
|
||
msgstr "Recuo automático"
|
||
|
||
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
||
msgid "Auto remove empty methods"
|
||
msgstr "Remover automaticamente métodos vazios"
|
||
|
||
#: lazarusidestrconsts.dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr "Auto renomear em minúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgautosave
|
||
msgid "Auto save"
|
||
msgstr "Auto-Salvar"
|
||
|
||
#: lazarusidestrconsts.dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr "Formulários disponíveis:"
|
||
|
||
#: lazarusidestrconsts.dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "Plano de fundo"
|
||
|
||
#: lazarusidestrconsts.dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(sem subdiretório)"
|
||
|
||
#: lazarusidestrconsts.dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr "Mesmo nome (no subdiretório)"
|
||
|
||
#: lazarusidestrconsts.dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr "Por trás dos métodos"
|
||
|
||
#: lazarusidestrconsts.dlgblockgroupoptions
|
||
msgid "Selection:"
|
||
msgstr "Seleção:"
|
||
|
||
#: lazarusidestrconsts.dlgblockindent
|
||
msgid "Block indent"
|
||
msgstr "Recuo bloco"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttype
|
||
msgid "Indent method"
|
||
msgstr "Recuar método"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypecopy
|
||
msgid "Space/tab as prev Line"
|
||
msgstr "Espaço/Tab. como linha anterior"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypepos
|
||
msgid "Position only"
|
||
msgstr "Posicionar somente"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypespace
|
||
msgid "Spaces"
|
||
msgstr "Espaços"
|
||
|
||
#: lazarusidestrconsts.dlgbp7cptb
|
||
msgid "TP/BP 7.0 Compatible"
|
||
msgstr "Compatibilidade com TP/BP 7.0"
|
||
|
||
#: lazarusidestrconsts.dlgbrackethighlight
|
||
msgid "Bracket highlight"
|
||
msgstr "Realçar parênteses"
|
||
|
||
#: lazarusidestrconsts.dlgbrowsemsgfilter
|
||
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
|
||
msgstr "Arquivo de mensagens do compilador Free Pascal (*.msg)|*.msg|Todos (*.*)|*.*"
|
||
|
||
#: lazarusidestrconsts.dlgbutapply
|
||
msgid "Apply"
|
||
msgstr "Aplicar"
|
||
|
||
#: lazarusidestrconsts.dlgcancel
|
||
msgctxt "lazarusidestrconsts.dlgcancel"
|
||
msgid "Cancel"
|
||
msgstr "Cancelar"
|
||
|
||
#: lazarusidestrconsts.dlgcasesensitive
|
||
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
||
msgid "&Case Sensitive"
|
||
msgstr "&Sensível maiúsc./minúsc."
|
||
|
||
#: lazarusidestrconsts.dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr "Verificando opções do compilador"
|
||
|
||
#: lazarusidestrconsts.dlgccoresults
|
||
msgid "Results"
|
||
msgstr "Resultados"
|
||
|
||
#: lazarusidestrconsts.dlgccotest
|
||
msgctxt "lazarusidestrconsts.dlgccotest"
|
||
msgid "Test"
|
||
msgstr "Testar"
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr "Teste: Verificando compilador ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr "Teste: Verificando configurações compilador ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
|
||
msgid "Test: Checking fpc configs ..."
|
||
msgstr "Teste: Verificando config. fpc ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr "Teste: Verificando data compilador ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr "Teste: Compilando um arquivo vazio ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestmissingppu
|
||
msgid "Test: Checking missing fpc ppu ..."
|
||
msgstr "Teste: Verificando falta fpc ppu ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr "Teste: Verificando fontes no caminho de busca ppu fpc ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr "Teste: Compilando um arquivo vazio"
|
||
|
||
#: lazarusidestrconsts.dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr "Ordem da Classe"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "Último"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr "minúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgcdtpreview
|
||
msgid "Preview (Max line length = 1)"
|
||
msgstr "Visualizar (Tam. máximo linha=1)"
|
||
|
||
#: lazarusidestrconsts.dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr "Prefixo Ler"
|
||
|
||
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr "Sufixo Armazenar"
|
||
|
||
#: lazarusidestrconsts.dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr "MAIÚSCULAS"
|
||
|
||
#: lazarusidestrconsts.dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr "Prefixo Variável"
|
||
|
||
#: lazarusidestrconsts.dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr "Prefixo Escrever"
|
||
|
||
#: lazarusidestrconsts.dlgcentercursorline
|
||
msgid "Center Cursor Line"
|
||
msgstr "Centralizar linha do cursor"
|
||
|
||
#: lazarusidestrconsts.dlgcharcasefileact
|
||
msgid "Save As - auto rename pascal files lower case"
|
||
msgstr "Salvar Como - Auto renomear arquivos Pascal em minúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgcheckconsistency
|
||
msgid "Check consistency"
|
||
msgstr "Verificar consistência"
|
||
|
||
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
||
msgid "Check packages on form create"
|
||
msgstr "Verificar pacotes na criação formulário"
|
||
|
||
#: lazarusidestrconsts.dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr "Escolha o arquivo do modelo de código (*.dci)"
|
||
|
||
#: lazarusidestrconsts.dlgclassinsertpolicy
|
||
msgid "Class part insert policy"
|
||
msgstr "Política de inserção de parte da Classe"
|
||
|
||
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr "Mostrar botões de fechar no \"notebook\""
|
||
|
||
#: lazarusidestrconsts.dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr "Esquema de cores"
|
||
|
||
#: lazarusidestrconsts.dlgcmacro
|
||
msgid "C Style Macros (global)"
|
||
msgstr "Estilo de Macros C (global)"
|
||
|
||
#: lazarusidestrconsts.dlgcoansistr
|
||
msgid "Use Ansi Strings"
|
||
msgstr "Usar Sequências de Caracteres Ansi"
|
||
|
||
#: lazarusidestrconsts.dlgcoasis
|
||
msgid "As-Is"
|
||
msgstr "Como está"
|
||
|
||
#: lazarusidestrconsts.dlgcoasmstyle
|
||
msgid "Assembler style:"
|
||
msgstr "Estilo assembler:"
|
||
|
||
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
||
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
||
msgid "Messages"
|
||
msgstr "Mensagens"
|
||
|
||
#: lazarusidestrconsts.dlgcochecks
|
||
msgid "Checks:"
|
||
msgstr "Verificações:"
|
||
|
||
#: lazarusidestrconsts.dlgcocompilation
|
||
msgid "Compilation"
|
||
msgstr "Compilação"
|
||
|
||
#: lazarusidestrconsts.dlgcoconditionals
|
||
msgid "Conditionals"
|
||
msgstr "Condicionais"
|
||
|
||
#: lazarusidestrconsts.dlgcocops
|
||
msgid "C Style Operators (*=, +=, /= and -=)"
|
||
msgstr "Estilo de Operadores C (*=, +=, /= and -=)"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatechildnode
|
||
msgid "Create child node"
|
||
msgstr "Criar ramo filho"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatemakefile
|
||
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Criar Makefile"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatenodeabove
|
||
msgid "Create node above"
|
||
msgstr "Criar ramo acima"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatenodebelow
|
||
msgid "Create node below"
|
||
msgstr "Criar ramo abaixo"
|
||
|
||
#: lazarusidestrconsts.dlgcodbx
|
||
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
||
msgstr "Gerar Informações de Depuração para DBX (Retarda a compilação)"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugging
|
||
msgid "Debugging:"
|
||
msgstr "Depuração:"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "Caminho adicional do Depurador (nenhum):"
|
||
|
||
#: lazarusidestrconsts.dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr "Criação de código"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldingmouse
|
||
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
|
||
msgid "Mouse"
|
||
msgstr "Mouse"
|
||
|
||
#: lazarusidestrconsts.dlgcodegeneration
|
||
msgid "Code"
|
||
msgstr "Código"
|
||
|
||
#: lazarusidestrconsts.dlgcodetoolsopts
|
||
msgid "CodeTools Options"
|
||
msgstr "Opções das Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.dlgcofast
|
||
msgid "Faster Code"
|
||
msgstr "Código mais rápido"
|
||
|
||
#: lazarusidestrconsts.dlgcogdb
|
||
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
||
msgstr "Gerar Informações de depuração para GDB (Retarda a compilação)"
|
||
|
||
#: lazarusidestrconsts.dlgcogenerate
|
||
msgid "Generate:"
|
||
msgstr "Gerar:"
|
||
|
||
#: lazarusidestrconsts.dlgcoheaptrc
|
||
msgid "Use Heaptrc Unit"
|
||
msgstr "Usar a unidade Heaptrc"
|
||
|
||
#: lazarusidestrconsts.dlgcoincfiles
|
||
msgid "Include Files (-Fi):"
|
||
msgstr "Arquivos de Inclusão (-Fi)"
|
||
|
||
#: lazarusidestrconsts.dlgcoinherited
|
||
msgctxt "lazarusidestrconsts.dlgcoinherited"
|
||
msgid "Inherited"
|
||
msgstr "Herança"
|
||
|
||
#: lazarusidestrconsts.dlgcokeepvarsreg
|
||
msgid "Keep certain variables in registers"
|
||
msgstr "Manter certas variáveis nos registradores"
|
||
|
||
#: lazarusidestrconsts.dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr "Bibliotecas (-Fl):"
|
||
|
||
#: lazarusidestrconsts.dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "Vinculando"
|
||
|
||
#: lazarusidestrconsts.dlgcoloadsave
|
||
msgid "Load/Save"
|
||
msgstr "Carregar/Salvar"
|
||
|
||
#: lazarusidestrconsts.dlgcolor
|
||
msgid "Color"
|
||
msgstr "Cor"
|
||
|
||
#: lazarusidestrconsts.dlgcolorlink
|
||
msgid "(Edit Color)"
|
||
msgstr "(Editar Cor)"
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparameters
|
||
msgid "Command line parameters"
|
||
msgstr "Parâmetros linha de comando"
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr "Parâmetros linha de comando (sem nome da aplicação)"
|
||
|
||
#: lazarusidestrconsts.dlgcomovedown
|
||
msgid "Move down"
|
||
msgstr "Mover abaixo"
|
||
|
||
#: lazarusidestrconsts.dlgcomoveleveldown
|
||
msgid "Move level down"
|
||
msgstr "Mover nível abaixo"
|
||
|
||
#: lazarusidestrconsts.dlgcomovelevelup
|
||
msgid "Move level up"
|
||
msgstr "Mover nível acima"
|
||
|
||
#: lazarusidestrconsts.dlgcomoveup
|
||
msgid "Move up"
|
||
msgstr "Move acima"
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessage
|
||
msgid "Compiler Messages"
|
||
msgstr "Mensagens do compilador"
|
||
|
||
#: lazarusidestrconsts.dlgcompileroptions
|
||
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
||
msgid "Compiler Options"
|
||
msgstr "Opções do Compilador"
|
||
|
||
#: lazarusidestrconsts.dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr "Completar Propriedades"
|
||
|
||
#: lazarusidestrconsts.dlgconfigfiles
|
||
msgid "Config Files:"
|
||
msgstr "Arquivos de configuração:"
|
||
|
||
#: lazarusidestrconsts.dlgconormal
|
||
msgid "Normal Code"
|
||
msgstr "Código Normal"
|
||
|
||
#: lazarusidestrconsts.dlgcoopts
|
||
msgid "Options: "
|
||
msgstr "Opções: "
|
||
|
||
#: lazarusidestrconsts.dlgcoother
|
||
msgctxt "lazarusidestrconsts.dlgcoother"
|
||
msgid "Other"
|
||
msgstr "Outros"
|
||
|
||
#: lazarusidestrconsts.dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr "Transbordamento (Overflow)"
|
||
|
||
#: lazarusidestrconsts.dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr "Analisando sintaxe"
|
||
|
||
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
||
msgid "Copy/Paste with fold info"
|
||
msgstr "Copiar/Colar com info. retração"
|
||
|
||
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr "Copiar palavra sobre copia nenhuma"
|
||
|
||
#: lazarusidestrconsts.dlgcorange
|
||
msgid "Range"
|
||
msgstr "Faixa"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowerr
|
||
msgid "Show Errors"
|
||
msgstr "Mostrar Erros"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowoptions
|
||
#| msgid "Show Options"
|
||
msgid "&Show Options"
|
||
msgstr "Mostrar Opções"
|
||
|
||
#: lazarusidestrconsts.dlgcosmaller
|
||
msgid "Smaller Code"
|
||
msgstr "Código menor"
|
||
|
||
#: lazarusidestrconsts.dlgcosmartlinkable
|
||
msgid "Smart Linkable"
|
||
msgstr "Vinculação inteligente"
|
||
|
||
#: lazarusidestrconsts.dlgcosources
|
||
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr "Outros Fontes (arquivos .pp/.pas, usado somente pela IDE não pelo Compilador)"
|
||
|
||
#: lazarusidestrconsts.dlgcostack
|
||
msgid "Stack"
|
||
msgstr "Pilha (Stack)"
|
||
|
||
#: lazarusidestrconsts.dlgcostrip
|
||
msgid "Strip Symbols From Executable"
|
||
msgstr "Remover símbolos do executável (STRIP)"
|
||
|
||
#: lazarusidestrconsts.dlgcounitstyle
|
||
msgid "Unit Style:"
|
||
msgstr "Estilo de unidade:"
|
||
|
||
#: lazarusidestrconsts.dlgcouseasdefault
|
||
#| msgid "Use these settings as default for new projects"
|
||
msgid "Use these compiler options as default for new projects"
|
||
msgstr "Usar estes ajustes como padrão para novos projetos"
|
||
|
||
#: lazarusidestrconsts.dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr "Gerar código para valgrind"
|
||
|
||
#: lazarusidestrconsts.dlgcoverbosity
|
||
msgid "Verbosity"
|
||
msgstr "Detalhes"
|
||
|
||
#: lazarusidestrconsts.dlgcppinline
|
||
msgid "C++ Styled INLINE"
|
||
msgstr "INLINE Estilo C++"
|
||
|
||
#: lazarusidestrconsts.dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr "Cursor além fim de linha (EOL)"
|
||
|
||
#: lazarusidestrconsts.dlgcursorgroupoptions
|
||
msgid "Cursor:"
|
||
msgstr "Cursor:"
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipsselection
|
||
msgid "Cursor skips selection"
|
||
msgstr "Cursor salta seleção"
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipstab
|
||
msgid "Cursor skips tabs"
|
||
msgstr "Cursor salta tabulações"
|
||
|
||
#: lazarusidestrconsts.dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr "Extensão definida pelo usuário (.pp.xxx)"
|
||
|
||
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr "Editor caminhos"
|
||
|
||
#: lazarusidestrconsts.dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr "Caminho e tipo de depurador"
|
||
|
||
#: lazarusidestrconsts.dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr "Fonte padrão do Editor"
|
||
|
||
#: lazarusidestrconsts.dlgdefvaluecolor
|
||
msgid "Default Value"
|
||
msgstr "Valor padrão"
|
||
|
||
#: lazarusidestrconsts.dlgdelphi2ext
|
||
msgid "Delphi 2 Extensions"
|
||
msgstr "Extensões Delphi 2"
|
||
|
||
#: lazarusidestrconsts.dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr "Excluir modelo "
|
||
|
||
#: lazarusidestrconsts.dlgdeplhicomp
|
||
msgid "Delphi Compatible"
|
||
msgstr "Compatível com o Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgdesktop
|
||
msgid "Desktop"
|
||
msgstr "Área de Trabalho"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopbuttons
|
||
msgid "Buttons - "
|
||
msgstr "Botões -"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopfiles
|
||
msgid "Desktop files"
|
||
msgstr "Arquivos da Área de Trabalho"
|
||
|
||
#: lazarusidestrconsts.dlgdesktophints
|
||
msgid "Hints"
|
||
msgstr "Dicas"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmenus
|
||
msgid "Menus - "
|
||
msgstr "Menus - "
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmisc
|
||
msgid "Misc Options"
|
||
msgstr "Opções diversas"
|
||
|
||
#: lazarusidestrconsts.dlgdirection
|
||
msgid "Direction"
|
||
msgstr "Direção"
|
||
|
||
#: lazarusidestrconsts.dlgdirectorydoesnotexist
|
||
msgid "Directory does not exist"
|
||
msgstr "Diretório não existe"
|
||
|
||
#: lazarusidestrconsts.dlgdisableantialiasing
|
||
msgid "Disable anti-aliasing"
|
||
msgstr "Desabilitar \"anti-aliasing\""
|
||
|
||
#: lazarusidestrconsts.dlgdividercolordefault
|
||
msgid "Use right margin color"
|
||
msgstr "Usar cor margem direita"
|
||
|
||
#: lazarusidestrconsts.dlgdividerdrawdepth
|
||
msgid "Draw divider level"
|
||
msgstr "Desenhar nível divisor"
|
||
|
||
#: lazarusidestrconsts.dlgdividernestcolor
|
||
msgid "Nested line color"
|
||
msgstr "Cor linha aninhada"
|
||
|
||
#: lazarusidestrconsts.dlgdivideronoff
|
||
msgid "Draw divider"
|
||
msgstr "Desenhar divisor"
|
||
|
||
#: lazarusidestrconsts.dlgdividertopcolor
|
||
msgid "Line color"
|
||
msgstr "Cor linha"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasbeginendname
|
||
msgid "Begin/End"
|
||
msgstr "Begin/End"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasprocedurename
|
||
msgid "Procedure/Function"
|
||
msgstr "Procedimento/Função"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
||
msgid "Class/Struct"
|
||
msgstr "Classe/Estrutura"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
||
msgid "Class/Struct (local)"
|
||
msgstr "Classe/Estrutura (local)"
|
||
|
||
#: lazarusidestrconsts.dlgdivpastryname
|
||
msgid "Try/Except"
|
||
msgstr "Try/Except"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
||
msgid "Unit sections"
|
||
msgstr "Seções unidade"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasusesname
|
||
msgid "Uses clause"
|
||
msgstr "Cláusula \"Uses\""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
||
msgid "Var/Type"
|
||
msgstr "Var/Type"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
||
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
||
msgid "Var/Type (local)"
|
||
msgstr "Var/Type (local)"
|
||
|
||
#: lazarusidestrconsts.dlgdownword
|
||
msgctxt "lazarusidestrconsts.dlgdownword"
|
||
msgid "Down"
|
||
msgstr "Abaixo"
|
||
|
||
#: lazarusidestrconsts.dlgedadd
|
||
msgid "Add..."
|
||
msgstr "Adicionar..."
|
||
|
||
#: lazarusidestrconsts.dlgedback
|
||
msgid "Back"
|
||
msgstr "Voltar"
|
||
|
||
#: lazarusidestrconsts.dlgedbold
|
||
msgid "Bold"
|
||
msgstr "Negrito"
|
||
|
||
#: lazarusidestrconsts.dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr "Subdiretório"
|
||
|
||
#: lazarusidestrconsts.dlgedcodetempl
|
||
msgid "Code templates"
|
||
msgstr "Modelos de Código"
|
||
|
||
#: lazarusidestrconsts.dlgedcolor
|
||
#| msgid "Syntax highlight"
|
||
msgctxt "lazarusidestrconsts.dlgedcolor"
|
||
msgid "Colors"
|
||
msgstr "Cores"
|
||
|
||
#: lazarusidestrconsts.dlgedcompleteblocks
|
||
msgid "Complete blocks"
|
||
msgstr "Blocos completos"
|
||
|
||
#: lazarusidestrconsts.dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr "Extensão definida pelo usuário"
|
||
|
||
#: lazarusidestrconsts.dlgeddelay
|
||
msgid "Delay"
|
||
msgstr "Espera"
|
||
|
||
#: lazarusidestrconsts.dlgeddelete
|
||
msgctxt "lazarusidestrconsts.dlgeddelete"
|
||
msgid "Delete"
|
||
msgstr "Excluir"
|
||
|
||
#: lazarusidestrconsts.dlgeddisplay
|
||
msgid "Display"
|
||
msgstr "Mostrar"
|
||
|
||
#: lazarusidestrconsts.dlgededit
|
||
msgid "Edit..."
|
||
msgstr "Editar..."
|
||
|
||
#: lazarusidestrconsts.dlgedfiles
|
||
msgid "Editor files"
|
||
msgstr "Editor de arquivos"
|
||
|
||
#: lazarusidestrconsts.dlgedhintcommand
|
||
msgid "Hint: click on the command you want to edit"
|
||
msgstr "Dica: clique no comando que você deseja editar"
|
||
|
||
#: lazarusidestrconsts.dlgedidcomlet
|
||
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
||
msgid "Identifier completion"
|
||
msgstr "Complemento identificador"
|
||
|
||
#: lazarusidestrconsts.dlgedinvert
|
||
msgid "Invert"
|
||
msgstr "Inverter"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
||
msgid "Ignore Locks, longest unused editor"
|
||
msgstr "Ignorar Bloqueios, editor não usado por mais tempo"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
||
msgid "Ignore Locks, if editor is current"
|
||
msgstr "Ignorar Bloqueios, se o editor for o atual"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
||
msgid "Ignore Locks, if editor in current window"
|
||
msgstr "Ignorar Bloqueios, se o editor estiver na janela atual"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
||
msgid "Locked, if text in view"
|
||
msgstr "Bloqueado, se o texto estiver em exibição"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
||
msgid "Unlocked"
|
||
msgstr "Desbloqueado"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
||
msgid "Unlocked, if text in centered view"
|
||
msgstr "Desbloqueado, se o texto estiver em exibição centralizada"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
||
msgid "New tab, existing or new window"
|
||
msgstr "Nova aba, existente ou nova janela"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
||
msgid "New tab in new window"
|
||
msgstr "Nova aba em nova janela"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
||
msgid "New tab in existing window"
|
||
msgstr "Nova aba em janela existente"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
||
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. This always looks at the editor, never the window, to find the longest unused. This option will always succeed, further options are never tested."
|
||
msgstr "Esta opção usará o editor não usado por mais tempo para o arquivo, mesmo se estiver bloqueado e/ou precise de deslocamento. Isto sempre olha para o editor, nunca a janela, para encontrar o não usado por mais tempo. Esta opção será sempre bem-sucedida, demais opções nunca serão testadas."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
||
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
||
msgstr "Esta opção irá verificar se o atual editor ativo tem o arquivo alvo e em caso positivo, irá usar o editor atual, mesmo se ele estiver bloqueado e/ou precise de deslocamento."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
||
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
||
msgstr "Esta opção irá verificar se existe um editor para o arquivo alvo na janela atual e se existir, irá usar este editor, mesmo se ele estiver bloqueado e/ou precise de deslocamento."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
||
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
||
msgstr "Esta opção ira usar um editor bloqueado (e somente um bloqueado), que não precise se deslocar a fim de mostrar o ponto se salto alvo (ponto de salto alvo já está na área visível da tela)."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
||
msgid "This option will use any not locked Editor."
|
||
msgstr "Esta opção irá usar qualquer Editor não bloqueado."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
||
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
||
msgstr "Esta opção irá usar um Editor não bloqueado, que não precise se deslocar a fim de mostrar o ponto de salto alvo (ponto de salto alvo já está na área visível da tela, excluindo 2-5 linhas no topo/fundo)."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
||
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
||
msgstr "Esta opção irá abrir uma nova Aba em uma Janela existente ou nova, se nenhuma aba bloqueada for encontrada. Esta opção será sempre bem-sucedida, demais opções nunca serão testadas."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
||
msgid "This option will open a new Tab in a new (and always in a new) Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
||
msgstr "Esta opção irá abrir uma nova Aba em uma nova (e sempre em uma nova) Janela, se nenhuma aba bloqueada for encontrada. Esta opção será sempre bem-sucedida, demais opções nunca serão testadas."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
||
msgid "This option will open a new Tab in an existing (and only in an existing) Window, if no unlocked tab is found. A tab is only opened if a window exists, that has not yet an editor for the target file."
|
||
msgstr "Esta opção irá abrir uma nova Aba em uma Janela existente (e somente em uma existente), se nenhuma aba bloqueada for encontrada. Uma aba é aberta somente se a janela existir, que ainda não tenha um editor para o arquivo alvo."
|
||
|
||
#: lazarusidestrconsts.dlgedital
|
||
msgid "Italic"
|
||
msgstr "Itálico"
|
||
|
||
#: lazarusidestrconsts.dlgeditorfont
|
||
msgid "Editor font"
|
||
msgstr "Fonte do Editor"
|
||
|
||
#: lazarusidestrconsts.dlgeditorfontheight
|
||
msgid "Editor font height"
|
||
msgstr "Altura da fonte do Editor"
|
||
|
||
#: lazarusidestrconsts.dlgeditoroptions
|
||
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
||
msgid "Editor options"
|
||
msgstr "Opções do editor"
|
||
|
||
#: lazarusidestrconsts.dlgedmisc
|
||
msgid "Misc"
|
||
msgstr "Misc."
|
||
|
||
#: lazarusidestrconsts.dlgednoerr
|
||
msgid "No errors in key mapping found."
|
||
msgstr "Não foram encontrados erros nos acessos rápidos."
|
||
|
||
#: lazarusidestrconsts.dlgedoff
|
||
msgid "Off"
|
||
msgstr "Desligado"
|
||
|
||
#: lazarusidestrconsts.dlgedon
|
||
msgid "On"
|
||
msgstr "Ligado"
|
||
|
||
#: lazarusidestrconsts.dlgedunder
|
||
msgid "Underline"
|
||
msgstr "Sublinhado"
|
||
|
||
#: lazarusidestrconsts.dlgedusedefcolor
|
||
msgid "Use default color"
|
||
msgstr "Usar cor padrão"
|
||
|
||
#: lazarusidestrconsts.dlgelementattributes
|
||
msgid "Element Attributes"
|
||
msgstr "Atributos elemento"
|
||
|
||
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
||
msgid "End key jumps to nearest end"
|
||
msgstr "Tecla \"End\" salta para final mais próximo"
|
||
|
||
#: lazarusidestrconsts.dlgentirescope
|
||
msgid "&Entire Scope"
|
||
msgstr "&Escopo inteiro"
|
||
|
||
#: lazarusidestrconsts.dlgenvask
|
||
msgid "Ask"
|
||
msgstr "Perguntar"
|
||
|
||
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr "Notas: Arquivos de projetos são todos os arquivos no diretório de projeto"
|
||
|
||
#: lazarusidestrconsts.dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "Cópia de segurança"
|
||
|
||
#: lazarusidestrconsts.dlgenvcolors
|
||
msgctxt "lazarusidestrconsts.dlgenvcolors"
|
||
msgid "Colors"
|
||
msgstr "Cores"
|
||
|
||
#: lazarusidestrconsts.dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "Arquivos"
|
||
|
||
#: lazarusidestrconsts.dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "Grade"
|
||
|
||
#: lazarusidestrconsts.dlgenvlanguage
|
||
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
||
msgid "Language"
|
||
msgstr "Idioma"
|
||
|
||
#: lazarusidestrconsts.dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr "Guias de alinhamento componentes"
|
||
|
||
#: lazarusidestrconsts.dlgenvmisc
|
||
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Miscelânea"
|
||
|
||
#: lazarusidestrconsts.dlgenvnone
|
||
msgctxt "lazarusidestrconsts.dlgenvnone"
|
||
msgid "None"
|
||
msgstr "Nenhum"
|
||
|
||
#: lazarusidestrconsts.dlgenvotherfiles
|
||
msgid "Other files"
|
||
msgstr "Outros arquivos"
|
||
|
||
#: lazarusidestrconsts.dlgenvproject
|
||
msgid "Project"
|
||
msgstr "Projeto"
|
||
|
||
#: lazarusidestrconsts.dlgenvtype
|
||
msgctxt "lazarusidestrconsts.dlgenvtype"
|
||
msgid "Type"
|
||
msgstr "Tipo"
|
||
|
||
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
|
||
msgid "Focus messages after compilation"
|
||
msgstr "Focar mensagens após compilação"
|
||
|
||
#: lazarusidestrconsts.dlgextracharspacing
|
||
msgid "Extra char spacing"
|
||
msgstr "Espaço extra carac."
|
||
|
||
#: lazarusidestrconsts.dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr "Espaços extra linhas"
|
||
|
||
#: lazarusidestrconsts.dlgextsymb
|
||
msgid "Use external gdb debug symbols file"
|
||
msgstr "Usar arquivo depuração externo gdb"
|
||
|
||
#: lazarusidestrconsts.dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr "Extensões de arquivo"
|
||
|
||
#: lazarusidestrconsts.dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr "Localizar texto sob o cursor"
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunk
|
||
msgid "Chunk"
|
||
msgstr "Pedaço"
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunksect
|
||
msgid "Chunk section"
|
||
msgstr "Pedaço seção"
|
||
|
||
#: lazarusidestrconsts.dlgfolddifffile
|
||
msgctxt "lazarusidestrconsts.dlgfolddifffile"
|
||
msgid "File"
|
||
msgstr "Arquivo"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlasp
|
||
msgid "ASP"
|
||
msgstr "ASP"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
||
msgid "Comment"
|
||
msgstr "Comentário"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
||
msgid "Node"
|
||
msgstr "Nó"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmitem
|
||
msgid "Item"
|
||
msgstr "Item"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmlist
|
||
msgid "List <>"
|
||
msgstr "Lista <>"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmobject
|
||
msgid "Object (inherited, inline)"
|
||
msgstr "Objeto (herdado, em linha)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
||
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
||
msgid "Var/Type (local)"
|
||
msgstr "Var/Type (local)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasasm
|
||
msgid "Asm"
|
||
msgstr "Asm"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasbeginend
|
||
msgid "Begin/End (nested)"
|
||
msgstr "Begin/End (aninhado)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpascase
|
||
msgid "Case"
|
||
msgstr "Case"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclass
|
||
msgid "Class/Object"
|
||
msgstr "Classe/Objeto"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclasssection
|
||
msgid "public/private"
|
||
msgstr "público/privado"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasexcept
|
||
msgid "Except/Finally"
|
||
msgstr "Except/Finally"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifdef
|
||
msgid "{$IfDef}"
|
||
msgstr "{$IfDef}"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
||
msgid "Nested Comment"
|
||
msgstr "Comentário aninhado"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
||
msgid "Begin/End (procedure)"
|
||
msgstr "Begin/End (procedimento)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocedure
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Procedimento"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprogram
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
||
msgid "Program"
|
||
msgstr "Programa"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrecord
|
||
msgid "Record"
|
||
msgstr "Record"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrepeat
|
||
msgid "Repeat"
|
||
msgstr "Repeat"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpastry
|
||
msgid "Try"
|
||
msgstr "Try"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunit
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
||
msgid "Unit"
|
||
msgstr "Unidade"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunitsection
|
||
msgid "Unit section"
|
||
msgstr "Seção unidade"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuserregion
|
||
msgid "{%Region}"
|
||
msgstr "{%Region}"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuses
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
||
msgid "Uses"
|
||
msgstr "Uses"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasvartype
|
||
msgid "Var/Type (global)"
|
||
msgstr "Var/Type (global)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcdata
|
||
msgid "CData"
|
||
msgstr "CData"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
||
msgid "Comment"
|
||
msgstr "Comentário"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmldoctype
|
||
msgid "DocType"
|
||
msgstr "TipoDoc"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
||
msgid "Node"
|
||
msgstr "Nó"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlprocess
|
||
msgid "Processing Instruction"
|
||
msgstr "Processando Instrução"
|
||
|
||
#: lazarusidestrconsts.dlgforecolor
|
||
msgid "Foreground"
|
||
msgstr "Primeiro plano"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr "Política de inserção de procedimento"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr "Manter a ordem dos procedimentos"
|
||
|
||
#: lazarusidestrconsts.dlgfpcpath
|
||
msgid "Compiler path (e.g. %s)"
|
||
msgstr "Caminho do Compilador (ex. %s)"
|
||
|
||
#: lazarusidestrconsts.dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr "Diretório Fonte FPC"
|
||
|
||
#: lazarusidestrconsts.dlgframecolor
|
||
msgid "Frame color"
|
||
msgstr "Cor borda"
|
||
|
||
#: lazarusidestrconsts.dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "Editor de Formulário"
|
||
|
||
#: lazarusidestrconsts.dlgfromcursor
|
||
msgid "&From Cursor"
|
||
msgstr "&Do cursor"
|
||
|
||
#: lazarusidestrconsts.dlgfropts
|
||
msgctxt "lazarusidestrconsts.dlgfropts"
|
||
msgid "Options"
|
||
msgstr "Opções"
|
||
|
||
#: lazarusidestrconsts.dlggeneratedwarf
|
||
msgid "Generate dwarf debug information"
|
||
msgstr "Gerar pequena informação depuração"
|
||
|
||
#: lazarusidestrconsts.dlggetposition
|
||
msgid "Get position"
|
||
msgstr "Obter Posição"
|
||
|
||
#: lazarusidestrconsts.dlgglobal
|
||
msgid "&Global"
|
||
msgstr "&Global"
|
||
|
||
#: lazarusidestrconsts.dlggpccomp
|
||
msgid "GPC (GNU Pascal Compiler) Compatible"
|
||
msgstr "Compatível com GPC (Compilador Pascal GNU)"
|
||
|
||
#: lazarusidestrconsts.dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr "Gerar código para gprof"
|
||
|
||
#: lazarusidestrconsts.dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr "Cor dos esticadores"
|
||
|
||
#: lazarusidestrconsts.dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr "Cor da Grade"
|
||
|
||
#: lazarusidestrconsts.dlggridx
|
||
msgid "Grid size X"
|
||
msgstr "Tamanho X da Grade"
|
||
|
||
#: lazarusidestrconsts.dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr "Tamanho do passo horizontal da grade"
|
||
|
||
#: lazarusidestrconsts.dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr "Tamanho Y da Grade"
|
||
|
||
#: lazarusidestrconsts.dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr "Tamanho do passo vertical da grade"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodeexplorer
|
||
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorador Código"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodetools
|
||
msgid "Codetools"
|
||
msgstr "Ferramentas de código"
|
||
|
||
#: lazarusidestrconsts.dlggroupdebugger
|
||
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Depurador"
|
||
|
||
#: lazarusidestrconsts.dlggroupeditor
|
||
msgid "Editor"
|
||
msgstr "Editor"
|
||
|
||
#: lazarusidestrconsts.dlggroupenvironment
|
||
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
||
msgid "Environment"
|
||
msgstr "Ambiente"
|
||
|
||
#: lazarusidestrconsts.dlggrouphelp
|
||
msgctxt "lazarusidestrconsts.dlggrouphelp"
|
||
msgid "Help"
|
||
msgstr "Ajuda"
|
||
|
||
#: lazarusidestrconsts.dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr "Desfazer Grupo"
|
||
|
||
#: lazarusidestrconsts.dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr "Mostrar Guias de Alinhamento"
|
||
|
||
#: lazarusidestrconsts.dlggutter
|
||
msgctxt "lazarusidestrconsts.dlggutter"
|
||
msgid "Gutter"
|
||
msgstr "Medianiz"
|
||
|
||
#: lazarusidestrconsts.dlgguttercolor
|
||
msgid "Gutter Color"
|
||
msgstr "Cor da Medianiz"
|
||
|
||
#: lazarusidestrconsts.dlggutteredgecolor
|
||
msgid "Gutter Edge Color"
|
||
msgstr "Cor borda medianiz"
|
||
|
||
#: lazarusidestrconsts.dlggutterseparatorindex
|
||
msgid "Gutter separator index"
|
||
msgstr "Índice separador medianiz"
|
||
|
||
#: lazarusidestrconsts.dlggutterwidth
|
||
msgid "Gutter width"
|
||
msgstr "Largura da Medianiz"
|
||
|
||
#: lazarusidestrconsts.dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr "Rolar meia-página"
|
||
|
||
#: lazarusidestrconsts.dlgheapsize
|
||
msgid "Heap Size"
|
||
msgstr "Tamanho do Heap"
|
||
|
||
#: lazarusidestrconsts.dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "Altura:"
|
||
|
||
#: lazarusidestrconsts.dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr "Esconder a janela da IDE ao executar"
|
||
|
||
#: lazarusidestrconsts.dlghidemessagesicons
|
||
msgid "Hide Messages Icons"
|
||
msgstr "Ocultar ícones mensagens"
|
||
|
||
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
||
msgid "Hide tab in single page windows"
|
||
msgstr "Ocultar aba de janelas em páginas únicas"
|
||
|
||
#: lazarusidestrconsts.dlghighlightcolor
|
||
msgid "Highlight Color"
|
||
msgstr "Realçar Cor"
|
||
|
||
#: lazarusidestrconsts.dlghighlightfontcolor
|
||
msgid "Highlight Font Color"
|
||
msgstr "Realçar Cor Fonte"
|
||
|
||
#: lazarusidestrconsts.dlghighlightleftofcursor
|
||
msgid "Left Of Cursor"
|
||
msgstr "Esquerda do Cursor"
|
||
|
||
#: lazarusidestrconsts.dlghighlightrightofcursor
|
||
msgid "Right Of Cursor"
|
||
msgstr "Direita do Cursos"
|
||
|
||
#: lazarusidestrconsts.dlghintsparametersendernotused
|
||
msgid "Show Hints for parameter \"Sender\" not used"
|
||
msgstr "Mostrar dica parâmetro \"Sender\" não usado"
|
||
|
||
#: lazarusidestrconsts.dlghintsunused
|
||
msgid "Show Hints for unused units in main source"
|
||
msgstr "Mostrar dicas unidades não utilizadas"
|
||
|
||
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr "Tecla \"Home\" salta para ínicio mais próximo"
|
||
|
||
#: lazarusidestrconsts.dlghostapplication
|
||
msgid "Host application"
|
||
msgstr "Aplicação servidora"
|
||
|
||
#: lazarusidestrconsts.dlgidentifiercompletion
|
||
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
||
msgid "Identifier completion"
|
||
msgstr "Complemento identificador"
|
||
|
||
#: lazarusidestrconsts.dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr "Política de Identificador"
|
||
|
||
#: lazarusidestrconsts.dlgideoptions
|
||
msgid "IDE Options"
|
||
msgstr "Opções IDE"
|
||
|
||
#: lazarusidestrconsts.dlgignoreverb
|
||
msgid "Ignore"
|
||
msgstr "Ignorar"
|
||
|
||
#: lazarusidestrconsts.dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr "Incluir variáveis de sistema"
|
||
|
||
#: lazarusidestrconsts.dlgindentcodeto
|
||
msgid "Indent code to"
|
||
msgstr "Recuar código para"
|
||
|
||
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
||
msgid "Indent and Tabs:"
|
||
msgstr "Recuos e Tabulações:"
|
||
|
||
#: lazarusidestrconsts.dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr "Na frente dos métodos"
|
||
|
||
#: lazarusidestrconsts.dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr "Nome do construtor precisa ser \"init\" (e o destrutor precisa ser \"done\")"
|
||
|
||
#: lazarusidestrconsts.dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr "Inserir espaço depois"
|
||
|
||
#: lazarusidestrconsts.dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr "Inserir espaço na frente de"
|
||
|
||
#: lazarusidestrconsts.dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr "Invervalo em segundos"
|
||
|
||
#: lazarusidestrconsts.dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr "Saltando (ex. Saltando Métodos)"
|
||
|
||
#: lazarusidestrconsts.dlgkeepcursorx
|
||
msgid "Keep cursor X position"
|
||
msgstr "Manter posição X cursor"
|
||
|
||
#: lazarusidestrconsts.dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr "Teclas de acesso rápido"
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr "Erros nas teclas de acesso rápido"
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingscheme
|
||
msgid "Key Mapping Scheme"
|
||
msgstr "Esquema de teclas de acesso rápido"
|
||
|
||
#: lazarusidestrconsts.dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr "Política de Palavras-Chave"
|
||
|
||
#: lazarusidestrconsts.dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "Permitir LABEL e GOTO"
|
||
|
||
#: lazarusidestrconsts.dlglang
|
||
msgctxt "lazarusidestrconsts.dlglang"
|
||
msgid "Language"
|
||
msgstr "Idioma"
|
||
|
||
#: lazarusidestrconsts.dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr "Último (ex. no final do fonte)"
|
||
|
||
#: lazarusidestrconsts.dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr "Diretório Lazarus (padrão para todos os projetos)"
|
||
|
||
#: lazarusidestrconsts.dlgleftpos
|
||
msgid "Left:"
|
||
msgstr "Esquerda:"
|
||
|
||
#: lazarusidestrconsts.dlglefttopclr
|
||
#| msgid "color for left, top"
|
||
msgid "Guid lines Left,Top"
|
||
msgstr "Linhas guia esquerda, topo"
|
||
|
||
#: lazarusidestrconsts.dlglevel1opt
|
||
msgid "Level 1 (quick and debugger friendly)"
|
||
msgstr "Nível 1 (rápido e amigável ao depurador)"
|
||
|
||
#: lazarusidestrconsts.dlglevel2opt
|
||
msgid "Level 2 (Level 1 + quick optimizations)"
|
||
msgstr "Nível 2 (Nível 1 + otimizações rápidas)"
|
||
|
||
#: lazarusidestrconsts.dlglevel3opt
|
||
msgid "Level 3 (Level 2 + slow optimizations)"
|
||
msgstr "Nível 3 (Nível 2 + otimizações lentas)"
|
||
|
||
#: lazarusidestrconsts.dlglevelnoneopt
|
||
msgid "Level 0 (no extra Optimizations)"
|
||
msgstr "Nível 0 (nenhuma Otimização extra)"
|
||
|
||
#: lazarusidestrconsts.dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr "Separação de Linha"
|
||
|
||
#: lazarusidestrconsts.dlglinklibraries
|
||
msgid "Link Style:"
|
||
msgstr "Estilo de Vínculo:"
|
||
|
||
#: lazarusidestrconsts.dlglinksmart
|
||
msgid "Link Smart"
|
||
msgstr "Vínculo inteligente"
|
||
|
||
#: lazarusidestrconsts.dlglnumsbct
|
||
msgid "Display Line Numbers in Run-time Error Backtraces"
|
||
msgstr "Mostrar número de linhas nos erros de Tempo de Execução ao rastreá-los"
|
||
|
||
#: lazarusidestrconsts.dlgloaddfile
|
||
msgid "Load desktop settings from file"
|
||
msgstr "Carregar configurações do arquivo"
|
||
|
||
#: lazarusidestrconsts.dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr "Menu Principal"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewforms
|
||
msgid "View project forms"
|
||
msgstr "Exibir formulários do projeto"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewframes
|
||
msgid "View project frames"
|
||
msgstr "Exibir bordas projeto"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewunits
|
||
msgid "View project units"
|
||
msgstr "Exibir unidades do projeto"
|
||
|
||
#: lazarusidestrconsts.dlgmakepath
|
||
msgid "Make path"
|
||
msgstr "Caminho Make"
|
||
|
||
#: lazarusidestrconsts.dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr "Margem e medianiz"
|
||
|
||
#: lazarusidestrconsts.dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr "Cor dos marcadores"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupgroup
|
||
msgid "Word under Caret Highlight"
|
||
msgstr "Realçar Palavra sob Marca"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
||
#| msgid "Ignore bounds for words longer than"
|
||
msgid "Match word boundaries for words up to this length:"
|
||
msgstr "Comparar limite palavra para palavras até este comprimento:"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
||
msgid "Ignore Keywords"
|
||
msgstr "Ignorar Palavras-Chave"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
||
msgid "Disable Timer for Markup Current Word"
|
||
msgstr "Desabilite cronômetro para remarcar palavra atual"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordtrim
|
||
#| msgid "Trim Spaces"
|
||
msgid "Trim Spaces (when highlighting current selection)"
|
||
msgstr "Remover espaços (enquanto realçar seleção atual)"
|
||
|
||
#: lazarusidestrconsts.dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr "Contador Máximo"
|
||
|
||
#: lazarusidestrconsts.dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr "Comprimento máximo da linha:"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr "Máximo de arquivos recentes"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr "Máximo de arquivos de projeto recentes"
|
||
|
||
#: lazarusidestrconsts.dlgmethodinspolicy
|
||
msgid "Method insert policy"
|
||
msgstr "Política de inserção de métodos"
|
||
|
||
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr "Mesclar métodos e propriedades"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbutton
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
|
||
msgid "Button"
|
||
msgstr "Botão"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonleft
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
|
||
msgid "Left"
|
||
msgstr "Esquerda"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
|
||
msgid "Middle"
|
||
msgstr "Meio"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonright
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
|
||
msgid "Right"
|
||
msgstr "Direita"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolfoldall
|
||
msgid "Fold All (Some Colapsed)"
|
||
msgstr "Dobre Tudo (Alguns retraídos)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolfoldone
|
||
msgid "Fold One (Some Colapsed)"
|
||
msgstr "Dobre Um (Alguns retraídos)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolunfoldall
|
||
msgid "Unfold All (Some Colapsed)"
|
||
msgstr "Desdobre Todos (Alguns retraídos)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolunfoldone
|
||
msgid "Unfold One (Some Colapsed)"
|
||
msgstr "Desdobre Um (Alguns retraídos)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldenabled
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
|
||
msgid "Enabled"
|
||
msgstr "Ativado"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldexpfoldall
|
||
msgid "Fold All (All Expanded)"
|
||
msgstr "Dobre Todos (Todos expandidos)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldexpfoldone
|
||
msgid "Fold One (All Expanded)"
|
||
msgstr "Dobre Um (Todos expandidos)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldgroup1
|
||
msgid "Setting 1"
|
||
msgstr "Ajuste 1"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldgroup2
|
||
msgid "Setting 2"
|
||
msgstr "Ajuste 2"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifieralt
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifierctrl
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifiershift
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmousegroupoptions
|
||
msgid "Mouse:"
|
||
msgstr "Mouse:"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn1
|
||
msgid "Single"
|
||
msgstr "Único"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn2
|
||
msgid "Double"
|
||
msgstr "Duplo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn3
|
||
msgid "Triple"
|
||
msgstr "Triplo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn4
|
||
msgid "Quad"
|
||
msgstr "Quádruplo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnadd
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
|
||
msgid "Add"
|
||
msgstr "Adicionar"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnany
|
||
msgid "Any"
|
||
msgstr "Qualquer"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtncancel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
|
||
msgid "Cancel"
|
||
msgstr "Cancelar"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtndel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
|
||
msgid "Delete"
|
||
msgstr "Excluir"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtndown
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
|
||
msgid "Down"
|
||
msgstr "Abaixo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnexport
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
|
||
msgid "Export"
|
||
msgstr "Exportar"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
||
msgid "Extra 1"
|
||
msgstr "Extra 1"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
||
msgid "Extra 2"
|
||
msgstr "Extra 2"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnimport
|
||
msgid "Import"
|
||
msgstr "Importar"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
||
msgid "Left"
|
||
msgstr "Esquerda"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
||
msgid "Middle"
|
||
msgstr "Meio"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
||
msgid "Make Fallback"
|
||
msgstr "Retroceder"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnok
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
|
||
msgid "Ok"
|
||
msgstr "Ok"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnright
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
||
msgid "Right"
|
||
msgstr "Direita"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnudp
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
|
||
msgid "Change"
|
||
msgstr "Alterar"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnup
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
|
||
msgid "Up"
|
||
msgstr "Acima"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcapture
|
||
msgid "Capture"
|
||
msgstr "Capturar"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
||
msgid "Move Caret (extra)"
|
||
msgstr "Mover Marca (extra)"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
||
msgid "Act on Mouse up"
|
||
msgstr "Atuar no Mouse acima"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescaction
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
||
msgid "Action"
|
||
msgstr "Ação"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
||
msgid "Click"
|
||
msgstr "Clique"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
||
msgid "Edit Mouse"
|
||
msgstr "Editar Mouse"
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrordup
|
||
msgid "Duplicate Entry"
|
||
msgstr "Entrada Duplicada"
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
||
msgid "This entry conflicts with an existing entry"
|
||
msgstr "Esta entrada conflita com uma entrada existente"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
||
msgid "Button"
|
||
msgstr "Botão"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
||
msgid "Caret"
|
||
msgstr "Marca"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
||
msgid "Context"
|
||
msgstr "Contexto"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcount
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
||
msgid "Click"
|
||
msgstr "Clique"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
||
msgid "Action"
|
||
msgstr "Ação"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddir
|
||
msgid "Up/Down"
|
||
msgstr "Acima/Abaixo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadopt
|
||
msgid "Option"
|
||
msgstr "Opção"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadorder
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
||
msgid "Order"
|
||
msgstr "Odernação"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
||
msgid "Priority"
|
||
msgstr "Prioridade"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptions
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
||
msgid "Mouse"
|
||
msgstr "Mouse"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsadv
|
||
msgid "Advanced"
|
||
msgstr "Avançado"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
||
msgid "IDE-Command"
|
||
msgstr "Comando IDE"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
||
msgid "n"
|
||
msgstr "n"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
||
msgid "Y"
|
||
msgstr "Y"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
||
msgid "Y"
|
||
msgstr "Y"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
||
msgid "Gutter"
|
||
msgstr "Medianiz"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
||
msgid "Fold Tree"
|
||
msgstr "Árvore retrátil"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
||
msgid "Collapsed [+]"
|
||
msgstr "Retraído [+]"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
||
msgid "Expanded [-]"
|
||
msgstr "Expandido [-]"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
||
msgid "Line Numbers"
|
||
msgstr "Números de linha"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodemain
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
||
msgid "Text"
|
||
msgstr "Texto"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
||
msgid "Selection"
|
||
msgstr "Seleção"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheract
|
||
msgid "Other actions using the same button"
|
||
msgstr "Outras ações usando o mesmo botão"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
||
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
|
||
msgstr "Eles podem ser executados dependendo das teclas modificadores, ajustes \"Falltrough\", Simples/Duplo, Acima/Abaixo..."
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
||
msgid "Filter Mod-Keys"
|
||
msgstr "Filtro Teclas-Mod."
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
||
msgid "Priority"
|
||
msgstr "Prioridade"
|
||
|
||
#: lazarusidestrconsts.dlgmsgs
|
||
msgctxt "lazarusidestrconsts.dlgmsgs"
|
||
msgid "Messages"
|
||
msgstr "Mensagens"
|
||
|
||
#: lazarusidestrconsts.dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "Seleção múltipla"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
||
msgid "Find editor for jump targets:"
|
||
msgstr "Localizar editor para os alvos do salto:"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
||
msgid "Order to use for editors matching the same criteria"
|
||
msgstr "Ordem à usar para editores correspondentes ao mesmo critério"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
||
msgid "Most recent focused editor for this file"
|
||
msgstr "Mais recente editor focado para este arquivo"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
||
msgid "Editor (for file) in most recent focused window"
|
||
msgstr "Editor (para arquivo) na mais recente janela focada"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
||
msgid "Priority list of criteria to choose an editor:"
|
||
msgstr "Lista de critérios prioritária para escolher um editor:"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinoptions
|
||
msgid "Pages and Windows"
|
||
msgstr "Páginas e Janelas"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwintabgroup
|
||
msgid "Notebook Tabs:"
|
||
msgstr "Abas \"Notebook\":"
|
||
|
||
#: lazarusidestrconsts.dlgnaming
|
||
msgid "Naming"
|
||
msgstr "Nomeação"
|
||
|
||
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
||
#| msgid "no automatic renaming"
|
||
msgid "No automatic renaming"
|
||
msgstr "Sem renomeação automática"
|
||
|
||
#: lazarusidestrconsts.dlgnobrackethighlight
|
||
msgid "No Highlight"
|
||
msgstr "Sem realce"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabpos
|
||
msgid "Source notebook tabs position"
|
||
msgstr "Posição abas \"notebook\" fonte"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabposbottom
|
||
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
|
||
msgid "Bottom"
|
||
msgstr "Fundo"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabposleft
|
||
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
|
||
msgid "Left"
|
||
msgstr "Esquerda"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabposright
|
||
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
|
||
msgid "Right"
|
||
msgstr "Direita"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabpostop
|
||
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
|
||
msgid "Top"
|
||
msgstr "Topo"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlineafter
|
||
msgid "Do not split line after:"
|
||
msgstr "Não dividir a linha depois:"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlinefront
|
||
msgid "Do not split line In front of:"
|
||
msgstr "Não dividir linha na frente de:"
|
||
|
||
#: lazarusidestrconsts.dlgobjinsp
|
||
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
||
msgid "Object Inspector"
|
||
msgstr "Inspetor de Objetos"
|
||
|
||
#: lazarusidestrconsts.dlgoiitemheight
|
||
msgid "Item height"
|
||
msgstr "Altura do Item"
|
||
|
||
#: lazarusidestrconsts.dlgoimiscellaneous
|
||
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Miscelânea"
|
||
|
||
#: lazarusidestrconsts.dlgoioptions
|
||
msgctxt "lazarusidestrconsts.dlgoioptions"
|
||
msgid "Options"
|
||
msgstr "Opções"
|
||
|
||
#: lazarusidestrconsts.dlgoispeedsettings
|
||
msgid "Speed settings"
|
||
msgstr "Configurações velocidade"
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
||
msgid "Use default Delphi settings"
|
||
msgstr "Usar configurações Delphi padrão"
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
||
msgid "Use default Lazarus settings"
|
||
msgstr "Usar configurações Lazarus padrão"
|
||
|
||
#: lazarusidestrconsts.dlgoptimiz
|
||
msgid "Optimizations:"
|
||
msgstr "Otimizações"
|
||
|
||
#: lazarusidestrconsts.dlgotherunitfiles
|
||
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
||
msgstr "Outros arquivos de unidade (-Fu) (ponto e vírgula como delimitador)"
|
||
|
||
#: lazarusidestrconsts.dlgoverwriteblock
|
||
msgid "Overwrite Block"
|
||
msgstr "Sobrescrever Bloco"
|
||
|
||
#: lazarusidestrconsts.dlgpackagegraph
|
||
msgid "Package Graph"
|
||
msgstr "Gráfico Pacote"
|
||
|
||
#: lazarusidestrconsts.dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr "Dicas para a paleta de componentes"
|
||
|
||
#: lazarusidestrconsts.dlgpasext
|
||
msgid "Default pascal extension"
|
||
msgstr "Extensão Pascal padrão"
|
||
|
||
#: lazarusidestrconsts.dlgpassoptslinker
|
||
msgid "Pass Options To The Linker (Delimiter is space)"
|
||
msgstr "Enviar opções ao vinculador (espaço como delimitador)"
|
||
|
||
#: lazarusidestrconsts.dlgpersistentblock
|
||
msgid "Persistent Block"
|
||
msgstr "Persistir Bloco"
|
||
|
||
#: lazarusidestrconsts.dlgpersistentcursor
|
||
msgid "Persistent cursor"
|
||
msgstr "Cursor persistente"
|
||
|
||
#: lazarusidestrconsts.dlgpldpackagegroup
|
||
msgid "Package group"
|
||
msgstr "Grupo pacotes"
|
||
|
||
#: lazarusidestrconsts.dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "Aplicação"
|
||
|
||
#: lazarusidestrconsts.dlgpoclearicon
|
||
msgid "Clear Icon"
|
||
msgstr "Limpar ícone"
|
||
|
||
#: lazarusidestrconsts.dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr "Criar Aplicação Encartada"
|
||
|
||
#: lazarusidestrconsts.dlgpofroms
|
||
msgid "Forms"
|
||
msgstr "Formulários"
|
||
|
||
#: lazarusidestrconsts.dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr "i18n"
|
||
|
||
#: lazarusidestrconsts.dlgpoicon
|
||
msgid "Icon:"
|
||
msgstr "Ícone:"
|
||
|
||
#: lazarusidestrconsts.dlgpoicondesc
|
||
msgid "(size: %d:%d, bpp: %d)"
|
||
msgstr "(tamanho: %d:%d, bpp: %d)"
|
||
|
||
#: lazarusidestrconsts.dlgpoicondescnone
|
||
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
||
msgid "(none)"
|
||
msgstr "(nenhum)"
|
||
|
||
#: lazarusidestrconsts.dlgpoloadicon
|
||
msgid "Load Icon"
|
||
msgstr "Carregar Ícone"
|
||
|
||
#: lazarusidestrconsts.dlgpomisc
|
||
msgctxt "lazarusidestrconsts.dlgpomisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Miscelânea"
|
||
|
||
#: lazarusidestrconsts.dlgpooutputsettings
|
||
msgid "Output Settings"
|
||
msgstr "Configurações de saída"
|
||
|
||
#: lazarusidestrconsts.dlgposaveicon
|
||
msgid "Save Icon"
|
||
msgstr "Salvar Ícone"
|
||
|
||
#: lazarusidestrconsts.dlgposavesession
|
||
msgid "Session"
|
||
msgstr "Sessão"
|
||
|
||
#: lazarusidestrconsts.dlgpotargetfilename
|
||
msgid "Target file name:"
|
||
msgstr "Nome do arquivo alvo:"
|
||
|
||
#: lazarusidestrconsts.dlgpotitle
|
||
msgid "Title:"
|
||
msgstr "Título:"
|
||
|
||
#: lazarusidestrconsts.dlgpouseappbundle
|
||
msgid "Use Application Bundle for running and debugging (darwin only)"
|
||
msgstr "Usar Aplicação encartada para execução e depuração (somente darwin)"
|
||
|
||
#: lazarusidestrconsts.dlgpousemanifest
|
||
msgid "Use manifest file to enable themes (windows only)"
|
||
msgstr "Usar arquivo de manifesto para habilitar temas (somente windows)"
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr "Opções de Projeto"
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptionsfor
|
||
msgid "Options for Project: %s"
|
||
msgstr "Opções do Projeto: %s"
|
||
|
||
#: lazarusidestrconsts.dlgprojfiles
|
||
msgid "Project files"
|
||
msgstr "Arquivos do Projeto"
|
||
|
||
#: lazarusidestrconsts.dlgpromptonreplace
|
||
msgid "&Prompt On Replace"
|
||
msgstr "&Perguntar para substituir"
|
||
|
||
#: lazarusidestrconsts.dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr "Complemento propriedade"
|
||
|
||
#: lazarusidestrconsts.dlgpropnamecolor
|
||
msgid "Property Name"
|
||
msgstr "Nome da propriedade"
|
||
|
||
#: lazarusidestrconsts.dlgqautoclosecompiledialog
|
||
msgid "Auto close compile dialog"
|
||
msgstr "Fechar automaticamente o diálogo compilação"
|
||
|
||
#: lazarusidestrconsts.dlgqopenlastprj
|
||
msgid "Open last project at start"
|
||
msgstr "Abrir o último projeto ao iniciar"
|
||
|
||
#: lazarusidestrconsts.dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr "Mostrar espaçamento da borda"
|
||
|
||
#: lazarusidestrconsts.dlgqshowcompiledialog
|
||
msgid "Show compile dialog"
|
||
msgstr "Mostrar diálogo compilação"
|
||
|
||
#: lazarusidestrconsts.dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr "Mostrar grade"
|
||
|
||
#: lazarusidestrconsts.dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr "Ajustar à grade"
|
||
|
||
#: lazarusidestrconsts.dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr "Referência"
|
||
|
||
#: lazarusidestrconsts.dlgregularexpressions
|
||
msgid "&Regular Expressions"
|
||
msgstr "Expressões &Regulares"
|
||
|
||
#: lazarusidestrconsts.dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr "Substituir &Tudo"
|
||
|
||
#: lazarusidestrconsts.dlgreplacewith
|
||
msgid "&Replace With"
|
||
msgstr "&Substituir por"
|
||
|
||
#: lazarusidestrconsts.dlgreport
|
||
msgid "Report"
|
||
msgstr "Relatório"
|
||
|
||
#: lazarusidestrconsts.dlgrightbottomclr
|
||
#| msgid "color for right, bottom"
|
||
msgid "Guide lines Right,Bottom"
|
||
msgstr "Linhas guia direita, inferior"
|
||
|
||
#: lazarusidestrconsts.dlgrightclickselects
|
||
msgid "Right Click selects"
|
||
msgstr "Clique direito seleciona"
|
||
|
||
#: lazarusidestrconsts.dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr "Margem Direita"
|
||
|
||
#: lazarusidestrconsts.dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr "Diretório de trabalho"
|
||
|
||
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
||
msgid "Select grandchildren"
|
||
msgstr "Selecionar netos"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
||
#| msgid "Creation"
|
||
msgid "Rubberband Creation"
|
||
msgstr "Criação Banda elástica"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
||
#| msgid "Selection"
|
||
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
||
msgid "Rubberband Selection"
|
||
msgstr "Seleção Banda elástica"
|
||
|
||
#: lazarusidestrconsts.dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr "Tela (não para win32, ex: 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
|
||
#: lazarusidestrconsts.dlgrunoenvironment
|
||
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
||
msgid "Environment"
|
||
msgstr "Ambiente"
|
||
|
||
#: lazarusidestrconsts.dlgrunolocal
|
||
msgid "Local"
|
||
msgstr "Local"
|
||
|
||
#: lazarusidestrconsts.dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr "Variáveis de sistema"
|
||
|
||
#: lazarusidestrconsts.dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr "Usar tela"
|
||
|
||
#: lazarusidestrconsts.dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr "Sobreposições de usuário"
|
||
|
||
#: lazarusidestrconsts.dlgrunovalue
|
||
msgctxt "lazarusidestrconsts.dlgrunovalue"
|
||
msgid "Value"
|
||
msgstr "Valor"
|
||
|
||
#: lazarusidestrconsts.dlgrunovariable
|
||
msgid "Variable"
|
||
msgstr "Variável"
|
||
|
||
#: lazarusidestrconsts.dlgrunparameters
|
||
msgid "Run parameters"
|
||
msgstr "Parâmetros de execução"
|
||
|
||
#: lazarusidestrconsts.dlgsavedfile
|
||
msgid "Save desktop settings to file"
|
||
msgstr "Salvar configurações para arquivo"
|
||
|
||
#: lazarusidestrconsts.dlgsavedlinecolor
|
||
msgid "Saved line"
|
||
msgstr "Linha salva"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr "Salvar informações do editor para arquivos fechados"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr "Salvar informações do editor somente para arquivos de projeto"
|
||
|
||
#: lazarusidestrconsts.dlgscope
|
||
msgid "Scope"
|
||
msgstr "Escopo"
|
||
|
||
#: lazarusidestrconsts.dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr "Deslizar por um ou menos"
|
||
|
||
#: lazarusidestrconsts.dlgscrollgroupoptions
|
||
msgid "Scrolling:"
|
||
msgstr "Deslizamento:"
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr "Deslizar para o final do arquivo"
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendline
|
||
#| msgid "Scroll past end of line"
|
||
msgid "Caret past end of line"
|
||
msgstr "Marca após final da linha"
|
||
|
||
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
||
msgid "Search directory \"%s\" not found."
|
||
msgstr "Diretório de busca \"%s\" não encontrado."
|
||
|
||
#: lazarusidestrconsts.dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr "Procura terminada pelo usuário."
|
||
|
||
#: lazarusidestrconsts.dlgsearchcaption
|
||
msgid "Searching..."
|
||
msgstr "Procurando..."
|
||
|
||
#: lazarusidestrconsts.dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr "Caminhos"
|
||
|
||
#: lazarusidestrconsts.dlgselectedtext
|
||
msgid "&Selected Text"
|
||
msgstr "Texto &Selecionado"
|
||
|
||
#: lazarusidestrconsts.dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr "Redefinir para o padrão"
|
||
|
||
#: lazarusidestrconsts.dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr "Ajustar elemento para padrão"
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr "Variável da propriedade"
|
||
|
||
#: lazarusidestrconsts.dlgshowcaps
|
||
msgid "Show component captions"
|
||
msgstr "Mostrar rótulo componentes"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr "Mostrar procedimentos compilados"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompileroptions
|
||
msgid "Show compiler options"
|
||
msgstr "Mostrar opções do compilador"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Mostrar números de linha"
|
||
|
||
#: lazarusidestrconsts.dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "Mostrar condicionais"
|
||
|
||
#: lazarusidestrconsts.dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr "Mostrar Informações de depuração"
|
||
|
||
#: lazarusidestrconsts.dlgshowdefinedmacros
|
||
msgid "Show defined macros"
|
||
msgstr "Mostrar macros definidas"
|
||
|
||
#: lazarusidestrconsts.dlgshowedrhints
|
||
msgid "Show editor hints"
|
||
msgstr "Mostrar dicas do editor"
|
||
|
||
#: lazarusidestrconsts.dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr "Mostrar tudo"
|
||
|
||
#: lazarusidestrconsts.dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr "Mostrar info. executável (só Win32)"
|
||
|
||
#: lazarusidestrconsts.dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr "Mostrar informações gerais"
|
||
|
||
#: lazarusidestrconsts.dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr "Mostrar dicas medianiz"
|
||
|
||
#: lazarusidestrconsts.dlgshowhint
|
||
msgid "Show Hints"
|
||
msgstr "Mostrar Dicas"
|
||
|
||
#: lazarusidestrconsts.dlgshowlinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Mostrar número de linhas"
|
||
|
||
#: lazarusidestrconsts.dlgshownotes
|
||
msgid "Show Notes"
|
||
msgstr "Mostrar Notas"
|
||
|
||
#: lazarusidestrconsts.dlgshownothing
|
||
msgid "Show nothing (only errors)"
|
||
msgstr "Não mostrar nada (somente erros)"
|
||
|
||
#: lazarusidestrconsts.dlgshowprocserror
|
||
msgid "Show all procs on error"
|
||
msgstr "Mostrar todos \"procs\" no erro"
|
||
|
||
#: lazarusidestrconsts.dlgshowscrollhint
|
||
msgid "Show scroll hint"
|
||
msgstr "Mostrar dicas de deslizamento"
|
||
|
||
#: lazarusidestrconsts.dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr "Mostrar sumário"
|
||
|
||
#: lazarusidestrconsts.dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr "Mostrar arquivos provados"
|
||
|
||
#: lazarusidestrconsts.dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr "Mostrar arquivos usados"
|
||
|
||
#: lazarusidestrconsts.dlgshowwarnings
|
||
msgid "Show Warnings"
|
||
msgstr "Mostrar Avisos"
|
||
|
||
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
||
msgid "Show single button in TaskBar"
|
||
msgstr "Mostrar um único botão na Barra de Tarefas"
|
||
|
||
#: lazarusidestrconsts.dlgskipforwarddeclarations
|
||
msgid "Skip forward declarations"
|
||
msgstr "Saltar declarações seguintes"
|
||
|
||
#: lazarusidestrconsts.dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr "Abas inteligentes"
|
||
|
||
#: lazarusidestrconsts.dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr "Símbolo no final (.pp~)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr "Contador (.pp;1)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr "Símbolo na frente (.~pp)"
|
||
|
||
#: lazarusidestrconsts.dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr "Ajustar às Guias de Alinhamento"
|
||
|
||
#: lazarusidestrconsts.dlgspacenotcosmos
|
||
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
||
msgid "Space"
|
||
msgstr "Espaço"
|
||
|
||
#: lazarusidestrconsts.dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr "Dicas para botões principais (abrir, salvar, ...)"
|
||
|
||
#: lazarusidestrconsts.dlgsrcedit
|
||
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
||
msgid "Source Editor"
|
||
msgstr "Editor de Código"
|
||
|
||
#: lazarusidestrconsts.dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr "Origem"
|
||
|
||
#: lazarusidestrconsts.dlgstatickeyword
|
||
msgid "Static Keyword in Objects"
|
||
msgstr "Palavra-Chave estática nos objetos"
|
||
|
||
#: lazarusidestrconsts.dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr "Parar depois de números de erros:"
|
||
|
||
#: lazarusidestrconsts.dlgsubpropcolor
|
||
msgid "SubProperties"
|
||
msgstr "Sub propriedades"
|
||
|
||
#: lazarusidestrconsts.dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr "Opções de sintaxe"
|
||
|
||
#: lazarusidestrconsts.dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr "Tabulações recuam blocos"
|
||
|
||
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
||
msgid "Show tab numbers in notebook"
|
||
msgstr "Mostrar números abas no \"notebook\""
|
||
|
||
#: lazarusidestrconsts.dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr "Tabulações para espaços"
|
||
|
||
#: lazarusidestrconsts.dlgtabwidths
|
||
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
||
msgid "Tab widths"
|
||
msgstr "Largura tabulações"
|
||
|
||
#: lazarusidestrconsts.dlgtargetcpufamily
|
||
msgid "Target CPU family"
|
||
msgstr "Família CPU alvo"
|
||
|
||
#: lazarusidestrconsts.dlgtargetos
|
||
msgctxt "lazarusidestrconsts.dlgtargetos"
|
||
msgid "Target OS"
|
||
msgstr "SO Alvo"
|
||
|
||
#: lazarusidestrconsts.dlgtargetplatform
|
||
msgid "Target Platform:"
|
||
msgstr "Plataforma Alvo:"
|
||
|
||
#: lazarusidestrconsts.dlgtargetproc
|
||
msgid "Target processor"
|
||
msgstr "Processador Alvo"
|
||
|
||
#: lazarusidestrconsts.dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr "Diretório para criação de projetos de teste"
|
||
|
||
#: lazarusidestrconsts.dlgtexttofing
|
||
msgid "&Text to Find"
|
||
msgstr "&Texto a Localizar"
|
||
|
||
#: lazarusidestrconsts.dlgthedirectory
|
||
msgid "The directory \""
|
||
msgstr "O diretório \""
|
||
|
||
#: lazarusidestrconsts.dlgtimesecondunit
|
||
msgid "sec"
|
||
msgstr "seg"
|
||
|
||
#: lazarusidestrconsts.dlgtooltipeval
|
||
msgid "Tooltip expression evaluation"
|
||
msgstr "Avaliação da expressão apontada pela ferramenta"
|
||
|
||
#: lazarusidestrconsts.dlgtooltiptools
|
||
msgid "Tooltip symbol Tools"
|
||
msgstr "Símbolos de ferramentas apontada pela ferramenta"
|
||
|
||
#: lazarusidestrconsts.dlgtoppos
|
||
msgid "Top:"
|
||
msgstr "Topo:"
|
||
|
||
#: lazarusidestrconsts.dlgtplfname
|
||
msgid "Template file name"
|
||
msgstr "Nome de arquivo de modelo"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
||
msgid "Trim Spaces Style"
|
||
msgstr "Estilo remoção espaços"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
||
msgid "Caret or Edit"
|
||
msgstr "Marca ou Edita"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
||
msgid "Line Edited"
|
||
msgstr "Linha editada"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
||
msgid "Leave line"
|
||
msgstr "Deixar linha"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
||
msgid "Position Only"
|
||
msgstr "Somente posicionar"
|
||
|
||
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr "Eliminar espaços no final"
|
||
|
||
#: lazarusidestrconsts.dlguncertopt
|
||
msgid "Uncertain Optimizations"
|
||
msgstr "Otimizações Incertas"
|
||
|
||
#: lazarusidestrconsts.dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "Desfazer depois de salvar"
|
||
|
||
#: lazarusidestrconsts.dlgundogroupoptions
|
||
msgid "Undo / Redo:"
|
||
msgstr "Desfazer / Refazer:"
|
||
|
||
#: lazarusidestrconsts.dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "Limite de Desfazer"
|
||
|
||
#: lazarusidestrconsts.dlgunitdepbrowse
|
||
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
|
||
msgid "Open"
|
||
msgstr "Abrir"
|
||
|
||
#: lazarusidestrconsts.dlgunitdepcaption
|
||
msgid "Unit dependencies"
|
||
msgstr "Dependências da unidade"
|
||
|
||
#: lazarusidestrconsts.dlgunitdeprefresh
|
||
msgid "Refresh"
|
||
msgstr "Atualizar"
|
||
|
||
#: lazarusidestrconsts.dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr "Diretório de saída das unidades (-FU):"
|
||
|
||
#: lazarusidestrconsts.dlgunsavedlinecolor
|
||
msgid "Unsaved line"
|
||
msgstr "Linha não salva"
|
||
|
||
#: lazarusidestrconsts.dlgupword
|
||
msgctxt "lazarusidestrconsts.dlgupword"
|
||
msgid "Up"
|
||
msgstr "Acima"
|
||
|
||
#: lazarusidestrconsts.dlgusecodefolding
|
||
msgid "Code folding"
|
||
msgstr "Retração código"
|
||
|
||
#: lazarusidestrconsts.dlgusecustomconfig
|
||
msgid "Use additional Compiler Config File"
|
||
msgstr "Usar arquivo adicional de configurações do Compilador"
|
||
|
||
#: lazarusidestrconsts.dlgusedividerdraw
|
||
msgid "Divider drawing"
|
||
msgstr "Desenho do Divisor"
|
||
|
||
#: lazarusidestrconsts.dlgusefpccfg
|
||
msgid "Use standard Compiler Config File (fpc.cfg)"
|
||
msgstr "Usar arquivo padrão de configuração do compilador (fpc.cfg)"
|
||
|
||
#: lazarusidestrconsts.dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr "Usar inicialização de aplicação"
|
||
|
||
#: lazarusidestrconsts.dlgusemsgfile
|
||
msgid "Use messages file"
|
||
msgstr "Usar arquivo mensagens"
|
||
|
||
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr "Usar realce de sintaxe"
|
||
|
||
#: lazarusidestrconsts.dlgvaluecolor
|
||
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
||
msgid "Value"
|
||
msgstr "Valor"
|
||
|
||
#: lazarusidestrconsts.dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr "Detalhes durante a compilação:"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr "Medianiz visível"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr "Margem direita visível"
|
||
|
||
#: lazarusidestrconsts.dlgwholewordsonly
|
||
msgid "&Whole Words Only"
|
||
msgstr "&Somente Palavras Completas"
|
||
|
||
#: lazarusidestrconsts.dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr "Largura:"
|
||
|
||
#: lazarusidestrconsts.dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr "Aplicação gráfica Win32"
|
||
|
||
#: lazarusidestrconsts.dlgwindow
|
||
msgctxt "lazarusidestrconsts.dlgwindow"
|
||
msgid "Window"
|
||
msgstr "Janela"
|
||
|
||
#: lazarusidestrconsts.dlgwinpos
|
||
msgid "Window Positions"
|
||
msgstr "Posições da Janela"
|
||
|
||
#: lazarusidestrconsts.dlgwordspolicies
|
||
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
||
msgid "Words"
|
||
msgstr "Palavras"
|
||
|
||
#: lazarusidestrconsts.dlgwrdpreview
|
||
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
||
msgid "Preview"
|
||
msgstr "Visualizar"
|
||
|
||
#: lazarusidestrconsts.dlgwritefpclogo
|
||
msgid "Write an FPC logo"
|
||
msgstr "Escrever logotipo FPC"
|
||
|
||
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr "Componentes multi-selecionados deverm estar num formulário único."
|
||
|
||
#: lazarusidestrconsts.fdmalignword
|
||
msgid "Align"
|
||
msgstr "Alinhamento"
|
||
|
||
#: lazarusidestrconsts.fdmdeleteselection
|
||
#| msgid "Delete selection"
|
||
msgid "Delete Selection"
|
||
msgstr "Excluir seleção"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorhorizontal
|
||
#| msgid "Mirror horizontal"
|
||
msgid "Mirror Horizontal"
|
||
msgstr "Espelho horizontal"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorvertical
|
||
#| msgid "Mirror vertical"
|
||
msgid "Mirror Vertical"
|
||
msgstr "Espelho vertical"
|
||
|
||
#: lazarusidestrconsts.fdmorder
|
||
msgctxt "lazarusidestrconsts.fdmorder"
|
||
msgid "Order"
|
||
msgstr "Odernação"
|
||
|
||
#: lazarusidestrconsts.fdmorderbackone
|
||
#| msgid "Back one"
|
||
msgid "Back One"
|
||
msgstr "Um atrás"
|
||
|
||
#: lazarusidestrconsts.fdmorderforwardone
|
||
#| msgid "Forward one"
|
||
msgid "Forward One"
|
||
msgstr "Um à frente"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetoback
|
||
#| msgid "Move to back"
|
||
msgid "Move to Back"
|
||
msgstr "Mover para trás"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetofront
|
||
#| msgid "Move to front"
|
||
msgid "Move to Front"
|
||
msgstr "Mover para frente"
|
||
|
||
#: lazarusidestrconsts.fdmsaveformasxml
|
||
#| msgid "Save form as xml"
|
||
msgid "Save form as XML"
|
||
msgstr "Salvar formulário como XML"
|
||
|
||
#: lazarusidestrconsts.fdmscaleword
|
||
msgid "Scale"
|
||
msgstr "Escala"
|
||
|
||
#: lazarusidestrconsts.fdmselectall
|
||
msgctxt "lazarusidestrconsts.fdmselectall"
|
||
msgid "Select All"
|
||
msgstr "Selecionar Tudo"
|
||
|
||
#: lazarusidestrconsts.fdmsizeword
|
||
msgid "Size"
|
||
msgstr "Tamanho"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr "Opção: Ajustar à grade"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr "Opção: Ajustar para linhas guias"
|
||
|
||
#: lazarusidestrconsts.fdmtaborder
|
||
#| msgid "Tab order..."
|
||
msgid "Tab Order..."
|
||
msgstr "Ordem da Tabulação..."
|
||
|
||
#: lazarusidestrconsts.fdmzorder
|
||
msgid "Z-order"
|
||
msgstr "Ordem-Z"
|
||
|
||
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
||
msgid "On Both Sides"
|
||
msgstr "Em ambos os lados"
|
||
|
||
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
||
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
||
msgstr "0 = não, 1 = desenha linhas divisórias apenas para níveis altos, 2 = desenha linhas primeiros dois níveis, ..."
|
||
|
||
#: lazarusidestrconsts.lisa2paddfile
|
||
msgid "Add File"
|
||
msgstr "Adicionar Arquivo"
|
||
|
||
#: lazarusidestrconsts.lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "Adicionar Arquivos"
|
||
|
||
#: lazarusidestrconsts.lisa2paddfilestopackage
|
||
msgid "Add files to package"
|
||
msgstr "Adicionar arquivos ao pacote"
|
||
|
||
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
|
||
msgid "Add LFM, LRS files, if they exist"
|
||
msgstr "Adicionar arquivos LFM, LRS, se eles existirem"
|
||
|
||
#: lazarusidestrconsts.lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "Adicionar ao pacote"
|
||
|
||
#: lazarusidestrconsts.lisa2paddunit
|
||
msgid "Add Unit"
|
||
msgstr "Adicionar unidade"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr "Tipo Ancestral ambíguo"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr "Nome da Classe ambíguo"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr "Nome da Unidade Ambíguo"
|
||
|
||
#: lazarusidestrconsts.lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "Tipo Ancestral"
|
||
|
||
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Uma unidade Pascal deve ter extensão .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr "Dependências Quebradas"
|
||
|
||
#: lazarusidestrconsts.lisa2pchooseanexistingfile
|
||
msgid "<choose an existing file>"
|
||
msgstr "<escolha um arquivo existente>"
|
||
|
||
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr "Nome da Classe já existe"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewfile
|
||
msgid "Create new file"
|
||
msgstr "Criar novo arquivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr "Dependência"
|
||
|
||
#: lazarusidestrconsts.lisa2pexistingfile
|
||
msgid "%sExisting file: %s%s%s"
|
||
msgstr "%sArquivo Existente: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr "Arquivo já existe"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
|
||
msgid "File %s%s%s already exists in the project."
|
||
msgstr "Arquivo %s%s%s já existe neste projeto."
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
|
||
msgid "File already in package"
|
||
msgstr "Arquivo já existe no pacote"
|
||
|
||
#: lazarusidestrconsts.lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr "Arquivo está em uso"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename
|
||
msgid "File name:"
|
||
msgstr "Nome do arquivo:"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr "Nome do Arquivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr "Arquivo nao é uma unidade"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr "Tipo Ancestral inválido"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidcircle
|
||
msgid "Invalid Circle"
|
||
msgstr "Referência circular inválida"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr "Nome da Classe inválido"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr "Arquivo inválido"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Nome de Arquivo Inválido"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr "Nome de unidade inválido"
|
||
|
||
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
||
msgid "%s%s%s is not a valid unit name."
|
||
msgstr "%s%s%s não é um nome de unidade válido."
|
||
|
||
#: lazarusidestrconsts.lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr "Novo nome de classe:"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewcomponent
|
||
msgid "New Component"
|
||
msgstr "Novo Componente"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr "Novo Arquivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
||
msgstr "Pacote não encontrado para a dependência %s%s%s.%sFavor escolher um pacote existente."
|
||
|
||
#: lazarusidestrconsts.lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr "Nome da Página muito longo"
|
||
|
||
#: lazarusidestrconsts.lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr "Página da Paleta:"
|
||
|
||
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr "Unidades Pascal devem ter extensão .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr "Diálogo Salvar arquivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr "Encolher ou expandir nome de arquivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pshowall
|
||
msgid "Show all"
|
||
msgstr "Mostrar tudo"
|
||
|
||
#: lazarusidestrconsts.lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr "Alternar Caminhos"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "O tipo ancestral %s%s%s tem o mesmo nome que%sa unidade%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
||
msgstr "O tipo ancestral %s%s%s não é um identificador Pascal válido."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
||
msgstr "O nome da classe %s%s%s e tipo ancestral %s%s%s são os mesmos."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
||
msgstr "O nome da classe %s%s%s já existe no %sPacote %s%sArquivo: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "O nome da classe %s%s%s tem o mesmo nome %sa unidade %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
||
msgid "The class name %s%s%s is not a valid pascal identifier."
|
||
msgstr "O nome da classe %s%s%s não é um identificador Pascal válido."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s is already in the package."
|
||
msgstr "O arquivo %s%s%s já existe no pacote."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr "O arquivo %s%s%s faz parte do projeto atual.%sNão é uma boa ideia compartilhar arquivos entre projetos e pacotes."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr "O nome de arquivo %s%s%s é ambíguo, porque o pacote ainda não tem diretório padrão.%sFavor especificar um nome de arquivo com caminho completo."
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "A Versão Máxima %s%s%s é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "A Versão Máxima é menor que a Versão Mínima."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "A Versão Mínima %s%s%s é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
||
msgid "The package has already a dependency for the package %s%s%s."
|
||
msgstr "O pacote já tem uma dependência para o pacote %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
|
||
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
||
msgstr "O nome do pacote %s%s%s é inválido.%sFavor escolher um pacote existente."
|
||
|
||
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name %s%s%s is too long (max 100 chars)."
|
||
msgstr "O nome da página %s%s%s é muito longo (max 100 caracteres)."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
||
msgstr "O nome da unidade %s%s%s já existe no pacote:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname %s%s%s already exists in this package."
|
||
msgstr "O nome da unidade %s%s%s já existe neste pacote."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
||
msgstr "O nome da unidade %s%s%s%se nome do arquivo %s%s%s diferem."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name %s%s%s does not correspond to the filename."
|
||
msgstr "O nome da unidade %s%s%s não corresponde ao nome do arquivo."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
||
msgstr "O nome da unidade %s%s%s é o mesmo de um componente registrado.%sUsá-lo pode causar estranhas mensagens de erro."
|
||
|
||
#: lazarusidestrconsts.lisa2punitfilename
|
||
msgid "Unit file name:"
|
||
msgstr "Nome de arquivo da unidade:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr "Nome de Arquivo da Unidade:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr "Nome da Unidade:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr "Nome da unidade já existe"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr "Nome da Unidade Inválido"
|
||
|
||
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
|
||
msgid "Scan Unit for Unit Name and Register procedure"
|
||
msgstr "Examinar unidade em busca do nome de unidade e procedimento de registro"
|
||
|
||
#: lazarusidestrconsts.lisabandonchanges
|
||
msgid "Abandon changes?"
|
||
msgstr "Abandonar alterações?"
|
||
|
||
#: lazarusidestrconsts.lisabcreationfailed
|
||
msgid "Error occured during Application Bundle creation: "
|
||
msgstr "Ocorreu um erro durante a criação do encarte da Aplicação:"
|
||
|
||
#: lazarusidestrconsts.lisabortall
|
||
msgid "Abort all"
|
||
msgstr "Abortar tudo"
|
||
|
||
#: lazarusidestrconsts.lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "Abortar todo o carregamento"
|
||
|
||
#: lazarusidestrconsts.lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "Abortar carregamento do projeto"
|
||
|
||
#: lazarusidestrconsts.lisabortwholeloading
|
||
msgid "Abort whole loading"
|
||
msgstr "Abortar carregamento por completo"
|
||
|
||
#: lazarusidestrconsts.lisaboutdocumentation
|
||
msgid "Documentation:"
|
||
msgstr "Documentação:"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "Sobre o Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarusmsg
|
||
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgstr "Licença: GPL/LGPL%sLazarus é uma IDE para criar aplicações (gráficas ou console) com o Free Pascal. Free Pascal é um compilador Pascal (L)GPL e Object Pascal que roda em Windows, Linux, Mac OS X, FreeBSD e mais.%sLazarus é a peça que falta no quebra-cabeças que irá permitir a você desenvolver programas para todas as plataformas citadas em um ambiente semelhante ao Delphi. A IDE é uma ferramenta RAD que inclui um editor de formulários.%sNa medida que o Lazarus evolui nós precisamos de mais desenvolvedores."
|
||
|
||
#: lazarusidestrconsts.lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr "Não foi possível encontrar a lista de colaboradores."
|
||
|
||
#: lazarusidestrconsts.lisaboutofficial
|
||
msgid "Official:"
|
||
msgstr "Oficial:"
|
||
|
||
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
||
msgstr "Um %s não pode conter TControls.%sVocê somente pode colocar componentes não-visuais nele"
|
||
|
||
#: lazarusidestrconsts.lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr "Agradecimentos"
|
||
|
||
#: lazarusidestrconsts.lisaction
|
||
msgid "Action:"
|
||
msgstr "Ação:"
|
||
|
||
#: lazarusidestrconsts.lisactions
|
||
msgid "Actions:"
|
||
msgstr "Ações:"
|
||
|
||
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr "Ativar a sintaxe de expressões regulares para texto e substituição (bem parecido com perl)"
|
||
|
||
#: lazarusidestrconsts.lisactivefilter
|
||
msgid "Active Filter"
|
||
msgstr "Filtro Ativo"
|
||
|
||
#: lazarusidestrconsts.lisadddirectory
|
||
msgid "Add directory"
|
||
msgstr "Adicionar diretório"
|
||
|
||
#: lazarusidestrconsts.lisaddfilesofdirectory
|
||
msgid "Add files of directory"
|
||
msgstr "Adicionar arquivos do diretório"
|
||
|
||
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
|
||
msgid "Additional compiler options inherited from packages"
|
||
msgstr "Opções adicionais do compilador herdadas dos pacotes"
|
||
|
||
#: lazarusidestrconsts.lisaddnewset
|
||
msgid "Add new set"
|
||
msgstr "Adicionar novo conjunto"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagerequirement
|
||
msgid "Add package requirement?"
|
||
msgstr "Adicionar requisito pacote?"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject
|
||
msgid "Add package %s to project?"
|
||
msgstr "Adicionar pacote %s ao projeto?"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject2
|
||
msgid "Add package to project"
|
||
msgstr "Adicionar pacote ao projeto"
|
||
|
||
#: lazarusidestrconsts.lisaddparameterbrackets
|
||
msgid "Add parameter brackets"
|
||
msgstr "Adicionar parênteses parâmetros"
|
||
|
||
#: lazarusidestrconsts.lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "Adicionar %s ao projeto?"
|
||
|
||
#: lazarusidestrconsts.lisaddtounitsearchpath
|
||
msgid "Add to unit search path?"
|
||
msgstr "Adicionar ao caminho de busca das unidades?"
|
||
|
||
#: lazarusidestrconsts.lisaddunitinterfaces
|
||
msgid "Add unit interfaces"
|
||
msgstr "Adicionar interfaces unidade"
|
||
|
||
#: lazarusidestrconsts.lisaddunitnotrecommended
|
||
msgid "Add unit (not recommended)"
|
||
msgstr "Adicionar unidade (não recomendado)"
|
||
|
||
#: lazarusidestrconsts.lisaddvalue
|
||
msgid "Add value:"
|
||
msgstr "Adicionar valor:"
|
||
|
||
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
||
msgid "Add file to a package"
|
||
msgstr "Adicionar arquivo a um pacote"
|
||
|
||
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
||
msgid "Destination Package"
|
||
msgstr "Pacote de Destino"
|
||
|
||
#: lazarusidestrconsts.lisaf2pfiletype
|
||
msgid "File Type"
|
||
msgstr "Tipo de Arquivo"
|
||
|
||
#: lazarusidestrconsts.lisaf2phasregisterprocedure
|
||
msgid "Has Register procedure"
|
||
msgstr "Tem procedimento Registro"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr "Pacote Inválido"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: %s%s%s"
|
||
msgstr "ID de Pacote inválida: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisaf2pisvirtualunit
|
||
msgid "Virtual unit (source is not in package)"
|
||
msgstr "Unidade Virtual (fonte não está no pacote)"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr "Pacote é somente leitura"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
||
msgid "Package %s%s%s not found."
|
||
msgstr "Pacote %s%s%s não encontrado."
|
||
|
||
#: lazarusidestrconsts.lisaf2pshowall
|
||
msgid "Show All"
|
||
msgstr "Mostrar tudo"
|
||
|
||
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "O arquivo %s%s%s%sjá está no pacote %s."
|
||
|
||
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr "O Pacote %s é somente leitura."
|
||
|
||
#: lazarusidestrconsts.lisaf2punitname
|
||
msgid "Unit Name: "
|
||
msgstr "Nome da Unidade:"
|
||
|
||
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
||
msgid "A file %s%s%s already exists.%sReplace it?"
|
||
msgstr "Um arquivo %s%s%s já existe.%sSubstituí-lo?"
|
||
|
||
#: lazarusidestrconsts.lisalignment
|
||
msgid "Alignment"
|
||
msgstr "Alinhamento"
|
||
|
||
#: lazarusidestrconsts.lisallblockslooksok
|
||
msgid "All blocks looks ok."
|
||
msgstr "Todos os blocos parecem OK."
|
||
|
||
#: lazarusidestrconsts.lisallfiles
|
||
msgid "All Files"
|
||
msgstr "Todos os arquivos"
|
||
|
||
#: lazarusidestrconsts.lisallinheritedoptions
|
||
msgid "All inherited options"
|
||
msgstr "Todas opções herdadas"
|
||
|
||
#: lazarusidestrconsts.lisallowfunctio
|
||
msgid "Allow Function Calls"
|
||
msgstr "Permitir Chamadas de Funções"
|
||
|
||
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr "Permitir busca por múltiplas linhas"
|
||
|
||
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
||
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
||
msgstr "Todas as modificações para %s%s%s%sserão perdidas e o arquivo reaberto."
|
||
|
||
#: lazarusidestrconsts.lisalternativekey
|
||
msgid "Alternative key"
|
||
msgstr "Tecla alternativa"
|
||
|
||
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
||
msgid "Alternative key (or 2 key sequence)"
|
||
msgstr "Tecla alternativa (ou sequência de 2 teclas)"
|
||
|
||
#: lazarusidestrconsts.lisalways
|
||
msgid "Always"
|
||
msgstr "Sempre"
|
||
|
||
#: lazarusidestrconsts.lisalwaysignore
|
||
msgid "Always ignore"
|
||
msgstr "Sempre ignorar"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr "Arquivo ambíguo encontrado"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
||
msgstr "Arquivo ambíguo encontrado: %s%s%s%sEste arquivo pode estar se equivocando com %s%s%s%s%sExcluir o arquivo ambíguo?"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr "Arquivos ambíguos encontrados"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound
|
||
msgid "Ambiguous Unit found"
|
||
msgstr "Unidade ambígua encontrada"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound2
|
||
msgid "Ambiguous unit found"
|
||
msgstr "Unidade ambígua encontrada"
|
||
|
||
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr "Editor de Âncora - nenhum controle selecionado"
|
||
|
||
#: lazarusidestrconsts.lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr "Habilitado = Incluir %s nas Âncoras"
|
||
|
||
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr "Âncora dos controles selecionados"
|
||
|
||
#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
|
||
msgid "Anchor to bottom side of sibling, keep border space"
|
||
msgstr "Âncora no lado inferior do irmão, manter espaço da borda"
|
||
|
||
#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
|
||
msgid "Anchor to left side of sibling, keep border space"
|
||
msgstr "Âncora no lado esquerdo do irmão, manter espaço da borda"
|
||
|
||
#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
|
||
msgid "Anchor to right side of sibling, keep border space"
|
||
msgstr "Âncora no lado direito do irmão, manter espaço da borda"
|
||
|
||
#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
|
||
msgid "Anchor to top side of sibling, keep border space"
|
||
msgstr "Âncora no lado superior do irmão, manter espaço da borda"
|
||
|
||
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
||
msgstr "Ocorreu um erro na última inicialização carregando %s!%s%sCarregar este projeto novamente?"
|
||
|
||
#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
|
||
msgid "Append short description to long description"
|
||
msgstr "Anexar descrição curta à descrição longa"
|
||
|
||
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
|
||
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Aplicação%sUm programa LCL/Free Pascal gráfico. O arquivo do programa é automaticamente mantido pelo Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisapplicationclassname
|
||
msgid "&Application class name"
|
||
msgstr "Nome de classe da &Aplicação"
|
||
|
||
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
||
msgid "apply build flags (-B) to dependencies too"
|
||
msgstr "Aplicar \"flags\" de contrução (-B) também para as dependências"
|
||
|
||
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
||
msgid "A project unit can not be used by other packages/projects"
|
||
msgstr "Uma unidade projeto não pode ser usada por outros pacotes/projetos"
|
||
|
||
#: lazarusidestrconsts.lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr "Espaço da borda em torno do controle. Os outros quatro espaços da borda serão adicionados a esse valor."
|
||
|
||
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
||
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
||
msgstr "Um simples arquivo de programa Pascal.%sEle pode ser usado para um teste rápido e sujo.%sMelhor criar um novo projeto."
|
||
|
||
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr "Perguntar antes de substituir cada texto encontrado"
|
||
|
||
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
||
msgid "Ask for component name after putting it on a designer form"
|
||
msgstr "Perguntar pelo nome componente após colocá-lo num formulário"
|
||
|
||
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
||
msgid "Ask for file name on new file"
|
||
msgstr "Perguntar nome de arquivo no comando novo arquivo "
|
||
|
||
#: lazarusidestrconsts.lisasknameoncreate
|
||
msgid "Ask name on create"
|
||
msgstr "Perguntar nome ao criar"
|
||
|
||
#: lazarusidestrconsts.lisautocompletionoff
|
||
msgid "Auto completion: off"
|
||
msgstr "Auto completar: desligado"
|
||
|
||
#: lazarusidestrconsts.lisautocompletionon
|
||
msgid "Auto completion: on"
|
||
msgstr "Auto completar: ligado"
|
||
|
||
#: lazarusidestrconsts.lisautocontinue
|
||
msgid "Auto Continue"
|
||
msgstr "Continuar Automaticamente"
|
||
|
||
#: lazarusidestrconsts.lisautocontinueafter
|
||
msgid "Auto continue after:"
|
||
msgstr "Continuar autom. depois:"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
|
||
msgid "Automatically convert .lfm files to .lrs include files"
|
||
msgstr "Auto converter arquivos .lfm para arquivo inclusão .lrs"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
||
msgid "Automatically invoke after point"
|
||
msgstr "Invocar automaticamente após ponto"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr "quebra de linha"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr "espaço"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr "final palavra"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr "não adicionar caractere"
|
||
|
||
#: lazarusidestrconsts.lisautomaticfeatures
|
||
msgid "Automatic features"
|
||
msgstr "Características autom."
|
||
|
||
#: lazarusidestrconsts.lisautoshowobjectinspector
|
||
msgid "Auto show"
|
||
msgstr "Mostrar automaticamente"
|
||
|
||
#: lazarusidestrconsts.lisavailablepackages
|
||
msgid "Available packages"
|
||
msgstr "Pacotes disponíveis"
|
||
|
||
#: lazarusidestrconsts.lisbackupchangedfiles
|
||
msgid "Make backup of changed files"
|
||
msgstr "Fazer cópia de segurança dos arquivos modificados"
|
||
|
||
#: lazarusidestrconsts.lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "Arquivo cópia de segurança falhou"
|
||
|
||
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr "Alterar o nome ou versão do pacote quebra dependências. Essas dependências devem ser alteradas também?%sSelecionar Sim para alterar todas as dependências listadas.%sSelecionar Ignorar para quebrar as dependências e continuar."
|
||
|
||
#: lazarusidestrconsts.lisbegins
|
||
msgid "begins"
|
||
msgstr "começa"
|
||
|
||
#: lazarusidestrconsts.lisbehindrelated
|
||
msgid "Behind related"
|
||
msgstr "Relacionado anteriormente"
|
||
|
||
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
||
msgid "Always Build before Run"
|
||
msgstr "Sempre construir antes de executar"
|
||
|
||
#: lazarusidestrconsts.lisbfbuild
|
||
msgctxt "lazarusidestrconsts.lisbfbuild"
|
||
msgid "Build"
|
||
msgstr "Construir"
|
||
|
||
#: lazarusidestrconsts.lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr "Comando de construção"
|
||
|
||
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr "Ao invés de construir o projeto, rodar o comando Construir Arquivo"
|
||
|
||
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr "Ao invés de executar o projeto, rodar o comando Executar Arquivo"
|
||
|
||
#: lazarusidestrconsts.lisbfrun
|
||
msgctxt "lazarusidestrconsts.lisbfrun"
|
||
msgid "Run"
|
||
msgstr "Executar"
|
||
|
||
#: lazarusidestrconsts.lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr "Comando Executar"
|
||
|
||
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
||
msgid "When this file is active in source editor ..."
|
||
msgstr "Quando este arquivo estiver ativo no editor de código ..."
|
||
|
||
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
||
msgid "Working directory (Leave empty for file path)"
|
||
msgstr "Diretório de trabalho (Deixar vazio para caminho de arquivo)"
|
||
|
||
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
|
||
msgid "Working Directory (Leave empty for file path)"
|
||
msgstr "Diretório de trabalho (Deixar vazio para caminho de arquivo)"
|
||
|
||
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
||
msgid "Bold non default values"
|
||
msgstr "Valores não padrão em negrito"
|
||
|
||
#: lazarusidestrconsts.lisborderspace
|
||
msgid "BorderSpace"
|
||
msgstr "Espaço da Borda"
|
||
|
||
#: lazarusidestrconsts.lisbottom
|
||
msgctxt "lazarusidestrconsts.lisbottom"
|
||
msgid "Bottom"
|
||
msgstr "Fundo"
|
||
|
||
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr "Espaço da Borda Inferior. Este valor será adicionado para espaço da borda base e usado para o espaço inferior do controle."
|
||
|
||
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr "Ancoragem Inferior"
|
||
|
||
#: lazarusidestrconsts.lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr "Inferiores"
|
||
|
||
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
||
msgstr "Este é o controle irmão ao qual o lado inferior está ancorado. Deixar vazio para o controle-pai."
|
||
|
||
#: lazarusidestrconsts.lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr "Justificar espaço inferior"
|
||
|
||
#: lazarusidestrconsts.lisbreak
|
||
msgctxt "lazarusidestrconsts.lisbreak"
|
||
msgid "Break"
|
||
msgstr "Interromper"
|
||
|
||
#: lazarusidestrconsts.lisbreakpointproperties
|
||
msgid "Breakpoint Properties"
|
||
msgstr "Propriedades Pontos de Paradas"
|
||
|
||
#: lazarusidestrconsts.lisbrowseforcompiler
|
||
msgid "Browse for Compiler (%s)"
|
||
msgstr "Navegador para Compilador (%s)"
|
||
|
||
#: lazarusidestrconsts.lisbtnbreak
|
||
msgctxt "lazarusidestrconsts.lisbtnbreak"
|
||
msgid "Break"
|
||
msgstr "Interromper"
|
||
|
||
#: lazarusidestrconsts.lisbtncontinue
|
||
msgctxt "lazarusidestrconsts.lisbtncontinue"
|
||
msgid "Continue"
|
||
msgstr "Continuar"
|
||
|
||
#: lazarusidestrconsts.lisbtnfind
|
||
msgid "&Find"
|
||
msgstr "&Localizar"
|
||
|
||
#: lazarusidestrconsts.lisbtnreplace
|
||
msgid "&Replace"
|
||
msgstr "&Substituir"
|
||
|
||
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
||
msgid "build all files of project/package/IDE"
|
||
msgstr "construir todos arquivos do projeto/pacote/IDE"
|
||
|
||
#: lazarusidestrconsts.lisbuildidewithpackages
|
||
msgid "build IDE with packages"
|
||
msgstr "construir IDE com pacotes"
|
||
|
||
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
||
msgid "Building Lazarus failed"
|
||
msgstr "Construção Lazarus falhou"
|
||
|
||
#: lazarusidestrconsts.lisbuildmode
|
||
msgid "Build mode"
|
||
msgstr "Modo construção"
|
||
|
||
#: lazarusidestrconsts.lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "Construir novo projeto"
|
||
|
||
#: lazarusidestrconsts.lisbuildnumber
|
||
msgid "Build Number"
|
||
msgstr "Número da construção"
|
||
|
||
#: lazarusidestrconsts.lisbuildvariables
|
||
msgid "Build variables"
|
||
msgstr "Variáveis construção"
|
||
|
||
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
||
msgid "Calling %s to create Makefile from %s failed."
|
||
msgstr "Chamando %s para criar \"Makefile\" de %s falhou."
|
||
|
||
#: lazarusidestrconsts.liscancel
|
||
msgctxt "lazarusidestrconsts.liscancel"
|
||
msgid "Cancel"
|
||
msgstr "Cancelar"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr "Cancelar carregamento deste componente"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr "Cancelar carregamento de Unidade"
|
||
|
||
#: lazarusidestrconsts.liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr "Cancelar renomeação"
|
||
|
||
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
||
msgid "Can not copy top level component."
|
||
msgstr "Não é possível copiar o componente de nível superior."
|
||
|
||
#: lazarusidestrconsts.liscannotcreatefile
|
||
msgid "Can not create file %s%s%s"
|
||
msgstr "Não é possível criar o arquivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
||
msgid "Cannot find lazarus starter:%s%s"
|
||
msgstr "Não é possível localizar o iniciador do lazarus:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr "Somente pode ser alterada a classe de TComponents."
|
||
|
||
#: lazarusidestrconsts.lisccdchangeclassof
|
||
msgid "Change Class of %s"
|
||
msgstr "Alterar Classe de %s"
|
||
|
||
#: lazarusidestrconsts.lisccdnoclass
|
||
msgid "no class"
|
||
msgstr "sem classe"
|
||
|
||
#: lazarusidestrconsts.lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr "Compilador ambíguo"
|
||
|
||
#: lazarusidestrconsts.lisccochecktestdir
|
||
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
||
msgstr "Favor verificar o diretório Teste em %sAmbiente -> Opções Ambiente -> Arquivos -> Diretório para contrução de projetos teste"
|
||
|
||
#: lazarusidestrconsts.lisccocompilernotanexe
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr "O compilador \"%s\" não é um arquivo executável.%sDetalhes: %s"
|
||
|
||
#: lazarusidestrconsts.lisccocontains
|
||
msgid "contains "
|
||
msgstr "contém"
|
||
|
||
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr "Copiar saída para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.lisccodatesdiffer
|
||
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr "As datas dos arquivos .ppu do FPC diferem em mais de uma hora.%sIsto pode significar que eles são de duas instalações diferentes.%sArquivo1: %s%sArquivo2: %s"
|
||
|
||
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
|
||
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
||
msgstr "arquivo de mensagens em inglês do FPC está faltando:components/codetools/fpc.errore.msg"
|
||
|
||
#: lazarusidestrconsts.lisccoerrorcaption
|
||
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
||
msgid "Error"
|
||
msgstr "Erro"
|
||
|
||
#: lazarusidestrconsts.lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr "ERRO:"
|
||
|
||
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr "Caminho de unidade FPC contém um fonte:"
|
||
|
||
#: lazarusidestrconsts.lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr "Símbolos de nova linha"
|
||
|
||
#: lazarusidestrconsts.lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr "DICA:"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr "Compilador inválido"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr "Caminho de busca inválido"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr "Diretório de teste inválido"
|
||
|
||
#: lazarusidestrconsts.lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr "Unidade faltando"
|
||
|
||
#: lazarusidestrconsts.lisccomsgppunotfound
|
||
msgid "compiled FPC unit not found: %s.ppu"
|
||
msgstr "Unidade compilada FPC não encontrada: %s.ppu"
|
||
|
||
#: lazarusidestrconsts.lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr "Configurações múltiplas do compilador encontradas:"
|
||
|
||
#: lazarusidestrconsts.liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr "\"fpc.cfg\" não encontrado"
|
||
|
||
#: lazarusidestrconsts.lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr "não é ASCII"
|
||
|
||
#: lazarusidestrconsts.lisccoppuexiststwice
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr "ppu duplicado: %s, %s"
|
||
|
||
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
||
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
||
msgstr "A unidade compilada FPC %s.ppu não foi encontrada.%sTipicamente significa que o seu \"fpc.cfg\" tem um erro. Ou sua instalação FPC está danificada."
|
||
|
||
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr "Há um arquivo .ppu mais antigo que o próprio compilador:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
|
||
msgid "relative unit path found in fpc cfg: %s"
|
||
msgstr "caminho relativo de unidade encontrado no \"fpc.cfg\": %s"
|
||
|
||
#: lazarusidestrconsts.lisccoseveralcompilers
|
||
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr "Há vários compiladores Free Pascal no caminho. %s%s%sTalvez você tenha se esquecido de excluir um compilador antigo?"
|
||
|
||
#: lazarusidestrconsts.lisccoskip
|
||
msgid "Skip"
|
||
msgstr "Pular"
|
||
|
||
#: lazarusidestrconsts.lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr "caracteres especiais"
|
||
|
||
#: lazarusidestrconsts.lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr "Sucesso em todos os testes"
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr "Impossível criar Arquivo Teste"
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
||
msgid "Unable to create Test pascal file \"%s\"."
|
||
msgstr "Impossível criar arquivo pascal Teste \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisccounabletogetfiledate
|
||
msgid "Unable to get file date of %s."
|
||
msgstr "Impossível obter data do arquivo %s."
|
||
|
||
#: lazarusidestrconsts.lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr "caracteres não usuais"
|
||
|
||
#: lazarusidestrconsts.lisccowarningcaption
|
||
msgid "Warning"
|
||
msgstr "Aviso"
|
||
|
||
#: lazarusidestrconsts.lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr "AVISO:"
|
||
|
||
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr "delimitador de caminho incorreto"
|
||
|
||
#: lazarusidestrconsts.liscecategories
|
||
msgid "Categories"
|
||
msgstr "Categorias"
|
||
|
||
#: lazarusidestrconsts.liscecomplexitygroup
|
||
msgid "Complexity"
|
||
msgstr "Complexidade"
|
||
|
||
#: lazarusidestrconsts.lisceconstants
|
||
msgid "Constants"
|
||
msgstr "Constantes"
|
||
|
||
#: lazarusidestrconsts.lisceemptyblocks
|
||
msgid "Empty blocks"
|
||
msgstr "Blocos vazios"
|
||
|
||
#: lazarusidestrconsts.lisceemptyclasssections
|
||
msgid "Empty class sections"
|
||
msgstr "Seções de classe vazias"
|
||
|
||
#: lazarusidestrconsts.lisceemptygroup
|
||
msgid "Empty constructs"
|
||
msgstr "Construções vazias"
|
||
|
||
#: lazarusidestrconsts.lisceemptyprocedures
|
||
msgid "Empty procedures"
|
||
msgstr "Procedimentos vazios"
|
||
|
||
#: lazarusidestrconsts.liscefilter
|
||
msgid "(Filter)"
|
||
msgstr "(Filtro)"
|
||
|
||
#: lazarusidestrconsts.liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr "Seguir cursor"
|
||
|
||
#: lazarusidestrconsts.liscein
|
||
msgid "%s in %s"
|
||
msgstr "%s no %s"
|
||
|
||
#: lazarusidestrconsts.lisceisarootcontrol
|
||
msgid "Is a root control"
|
||
msgstr "É um controle raiz"
|
||
|
||
#: lazarusidestrconsts.liscelongparamlistcount
|
||
msgid "Parameters count treating as \"many\""
|
||
msgstr "Núm. parâmetros tratados como \"muitos\""
|
||
|
||
#: lazarusidestrconsts.liscelongprocedures
|
||
msgid "Long procedures"
|
||
msgstr "Procedimentos longos"
|
||
|
||
#: lazarusidestrconsts.liscelongproclinecount
|
||
msgid "Line count of procedure treated as \"long\""
|
||
msgstr "Núm. linhas de procedimentos tratados como \"longo\""
|
||
|
||
#: lazarusidestrconsts.liscemanynestedprocedures
|
||
msgid "Many nested procedures"
|
||
msgstr "Muitos procedimentos aninhados"
|
||
|
||
#: lazarusidestrconsts.liscemanyparameters
|
||
msgid "Many parameters"
|
||
msgstr "Muitos parâmetros"
|
||
|
||
#: lazarusidestrconsts.liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr "Mostrar Categorias"
|
||
|
||
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr "Mostrar Ramificações Fonte"
|
||
|
||
#: lazarusidestrconsts.liscenestedproccount
|
||
msgid "Nested procedures count treating as \"many\""
|
||
msgstr "Núm. procedimentos aninhados tratados como \"muitos\""
|
||
|
||
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling"
|
||
msgstr "Centralizar controle horizontalmente em relação ao controle-irmão especificado"
|
||
|
||
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling"
|
||
msgstr "Centralizar controle verticalmente em relação ao controle-irmão especificado"
|
||
|
||
#: lazarusidestrconsts.liscenterform
|
||
msgid "Center form"
|
||
msgstr "Centralizar formulário"
|
||
|
||
#: lazarusidestrconsts.liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "Centralizar na janela"
|
||
|
||
#: lazarusidestrconsts.liscenters
|
||
msgid "Centers"
|
||
msgstr "Centros"
|
||
|
||
#: lazarusidestrconsts.lisceomode
|
||
msgid "Preferred Exhibition Mode"
|
||
msgstr "Modo Preferido Exibição"
|
||
|
||
#: lazarusidestrconsts.lisceomodecategory
|
||
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
||
msgid "Category"
|
||
msgstr "Categoria"
|
||
|
||
#: lazarusidestrconsts.lisceomodesource
|
||
msgid "Source"
|
||
msgstr "Fonte"
|
||
|
||
#: lazarusidestrconsts.lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr "Nunca, apenas manualmente"
|
||
|
||
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr "Somente usado no modo categoria"
|
||
|
||
#: lazarusidestrconsts.lisceoonidle
|
||
msgid "On idle"
|
||
msgstr "Quando ocioso"
|
||
|
||
#: lazarusidestrconsts.lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr "Atualizar automaticamente"
|
||
|
||
#: lazarusidestrconsts.lisceothergroup
|
||
msgctxt "lazarusidestrconsts.lisceothergroup"
|
||
msgid "Other"
|
||
msgstr "Outros"
|
||
|
||
#: lazarusidestrconsts.lisceoupdate
|
||
msgid "Update"
|
||
msgstr "Atualizar"
|
||
|
||
#: lazarusidestrconsts.lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr "Quando alternar arquivo no editor fonte"
|
||
|
||
#: lazarusidestrconsts.lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr "Procedimentos"
|
||
|
||
#: lazarusidestrconsts.lisceproperties
|
||
msgctxt "lazarusidestrconsts.lisceproperties"
|
||
msgid "Properties"
|
||
msgstr "Propriedades"
|
||
|
||
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
||
msgid "Published properties without default"
|
||
msgstr "Propriedades publicadas sem padrão"
|
||
|
||
#: lazarusidestrconsts.lisceshowcodeobserver
|
||
msgid "Show observerations about"
|
||
msgstr "Mostrar observações sobre"
|
||
|
||
#: lazarusidestrconsts.liscestylegroup
|
||
msgctxt "lazarusidestrconsts.liscestylegroup"
|
||
msgid "Style"
|
||
msgstr "Estilo"
|
||
|
||
#: lazarusidestrconsts.liscetodos
|
||
msgid "ToDos"
|
||
msgstr "Para Fazer (ToDos)"
|
||
|
||
#: lazarusidestrconsts.liscetypes
|
||
msgid "Types"
|
||
msgstr "Tipos"
|
||
|
||
#: lazarusidestrconsts.lisceunnamedconstants
|
||
msgid "Unnamed constants"
|
||
msgstr "Constantes sem nome"
|
||
|
||
#: lazarusidestrconsts.lisceunsortedmembers
|
||
msgid "Unsorted members"
|
||
msgstr "Membros sem classificação"
|
||
|
||
#: lazarusidestrconsts.lisceunsortedvisibility
|
||
msgid "Unsorted visibility"
|
||
msgstr "Visibilidade sem classificação"
|
||
|
||
#: lazarusidestrconsts.lisceuses
|
||
msgctxt "lazarusidestrconsts.lisceuses"
|
||
msgid "Uses"
|
||
msgstr "\"Uses\""
|
||
|
||
#: lazarusidestrconsts.liscevariables
|
||
msgid "Variables"
|
||
msgstr "Variáveis"
|
||
|
||
#: lazarusidestrconsts.liscewrongindentation
|
||
msgid "Wrong indentation"
|
||
msgstr "Recuo incorreto"
|
||
|
||
#: lazarusidestrconsts.lischangeclass
|
||
msgid "Change Class"
|
||
msgstr "Alterar Classe"
|
||
|
||
#: lazarusidestrconsts.lischangeencoding
|
||
msgid "Change Encoding"
|
||
msgstr "Alterar codificação"
|
||
|
||
#: lazarusidestrconsts.lischangefile
|
||
msgid "Change file"
|
||
msgstr "Alterar arquivo"
|
||
|
||
#: lazarusidestrconsts.lischangeparent
|
||
#| msgid "Change parent ..."
|
||
msgid "Change Parent..."
|
||
msgstr "Alterar controle-pai ..."
|
||
|
||
#: lazarusidestrconsts.lischaracter
|
||
msgid "Character"
|
||
msgstr "Caracter"
|
||
|
||
#: lazarusidestrconsts.lischaractermap
|
||
msgid "Character Map"
|
||
msgstr "Mapa de Caracteres"
|
||
|
||
#: lazarusidestrconsts.lischeckchangesondiskwithloading
|
||
msgid "Check changes on disk with loading"
|
||
msgstr "Verificar alterações no disco ao carregar"
|
||
|
||
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
||
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
|
||
msgstr "verifique se a próxima sílaba (token) no código é um fim e se não retorna fimlinha + fim; + fimlinha"
|
||
|
||
#: lazarusidestrconsts.lischeckoptions
|
||
msgid "Check options"
|
||
msgstr "Opções verificação"
|
||
|
||
#: lazarusidestrconsts.lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr "Escolha um nome diferente"
|
||
|
||
#: lazarusidestrconsts.lischooseafpdoclink
|
||
msgid "Choose a FPDoc link"
|
||
msgstr "Escolha um vínculo \"FPDOC\""
|
||
|
||
#: lazarusidestrconsts.lischooseakey
|
||
msgid "Choose a key ..."
|
||
msgstr "Escolha uma tecla ..."
|
||
|
||
#: lazarusidestrconsts.lischooseanameforthenewcomponent
|
||
msgid "Choose a name for the new component"
|
||
msgstr "Escolha um nome para o novo componente"
|
||
|
||
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
||
msgid "Choose a pascal file for indentation examples"
|
||
msgstr "Escolha um arquivo pascal para exemplos recuo"
|
||
|
||
#: lazarusidestrconsts.lischoosecompilerpath
|
||
msgid "Choose compiler filename (%s)"
|
||
msgstr "Escolher nome de arquivo do compilador (%s)"
|
||
|
||
#: lazarusidestrconsts.lischoosedebuggerpath
|
||
msgid "Choose debugger filename"
|
||
msgstr "Escolher nome de arquivo do depurador"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr "Escolha um pacote Delphi (*.dpk)"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr "Escolha um projeto Delphi (*.dpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr "Escolher Unidade Delphi (*.pas)"
|
||
|
||
#: lazarusidestrconsts.lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr "Escolher diretório"
|
||
|
||
#: lazarusidestrconsts.lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr "Escolher diretório fonte FPC"
|
||
|
||
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr "Escolher Diretório Lazarus"
|
||
|
||
#: lazarusidestrconsts.lischoosemakepath
|
||
msgid "Choose make path"
|
||
msgstr "Escolher caminho do make"
|
||
|
||
#: lazarusidestrconsts.lischoosename
|
||
msgid "Choose name"
|
||
msgstr "Escolha nome"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr "Escolha um desses items para criar um novo Arquivo"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr "Escolha um desses items para criar um novo Pacote"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr "Escolha um desses items para criar um novo Projeto"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
||
msgid "Choose one of these items to inherit from an existing one"
|
||
msgstr "Escolha um desses itens para herdar de outro já existente"
|
||
|
||
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr "Escolher fonte do programa (*.pp,*.pas,*.lpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr "Escolha a estrutura para circundar a seleção"
|
||
|
||
#: lazarusidestrconsts.lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr "Escolha o diretório para testes"
|
||
|
||
#: lazarusidestrconsts.lisclasscompletion
|
||
msgid "Class Completion"
|
||
msgstr "Complemento Classe"
|
||
|
||
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
|
||
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
||
msgstr "Classe em conflito com arquivo .lfm:%sA unidade %s%susa a unidade %s%sao qual contém a classe %s,%smas o arquivo .lfm já contém outra classe.%sDeve haver somente um classe planejada por unidade.%sFavor mover %s para outra unidade."
|
||
|
||
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
||
msgid "Classes and properties exist. Values were not checked."
|
||
msgstr "Classes e propriedades existem. Valores não foram verificados."
|
||
|
||
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
||
msgstr "Classe %s%s%s não é uma classe de componente registrado.%sImpossível colar."
|
||
|
||
#: lazarusidestrconsts.lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr "Classe não encontrada"
|
||
|
||
#: lazarusidestrconsts.lisclassofmethodnotfound
|
||
msgid "Class %s%s%s of method %s%s%s not found."
|
||
msgstr "Classe %s%s%s do método %s%s%s não encontrada."
|
||
|
||
#: lazarusidestrconsts.liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "Limpar Diretório"
|
||
|
||
#: lazarusidestrconsts.liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "Limpar subdiretórios"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr "Manter todos os arquivos de texto"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr "Manter arquivos conforme filtro"
|
||
|
||
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr "Remover arquivo conforme filtro"
|
||
|
||
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr "Sintaxe Simples (ex: * em vez de .*)"
|
||
|
||
#: lazarusidestrconsts.liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr "Limpar o Fonte do Lazarus (Clean)"
|
||
|
||
#: lazarusidestrconsts.liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr "Limpar caminho da unidade?"
|
||
|
||
#: lazarusidestrconsts.liscleardirectory
|
||
msgid "Clear Directory?"
|
||
msgstr "Limpar Diretório?"
|
||
|
||
#: lazarusidestrconsts.lisclearkeymapping
|
||
msgid "Clear Key Mapping"
|
||
msgstr "Limpar Mapeamento Teclas"
|
||
|
||
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr "Clique aqui para navegar no arquivo"
|
||
|
||
#: lazarusidestrconsts.lisclose
|
||
msgid "&Close"
|
||
msgstr "&Fechar"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsclose
|
||
msgid "Close files"
|
||
msgstr "Fechar arquivos"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabshide
|
||
msgid "Hide window"
|
||
msgstr "Ocultar janela"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsquestion
|
||
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
||
msgstr "Fechando uma Janela Editor Fonte. Deseja fechar todos os arquivos ou ocultar a janela?"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabstitle
|
||
msgid "Close Source Editor Window"
|
||
msgstr "Fechar Janela Editor Fonte"
|
||
|
||
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr "Opções especificas da Interface LCL"
|
||
|
||
#: lazarusidestrconsts.liscmparameter
|
||
msgid "Parameter"
|
||
msgstr "Parâmetro"
|
||
|
||
#: lazarusidestrconsts.liscmplstcomponents
|
||
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
||
msgid "Components"
|
||
msgstr "Componentes"
|
||
|
||
#: lazarusidestrconsts.liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr "Herança"
|
||
|
||
#: lazarusidestrconsts.liscmplstlist
|
||
msgid "List"
|
||
msgstr "Lista"
|
||
|
||
#: lazarusidestrconsts.liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr "Paleta"
|
||
|
||
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr "Arquivo adicional de configuração do compilador ambíguo"
|
||
|
||
#: lazarusidestrconsts.liscocallon
|
||
msgid "Call on:"
|
||
msgstr "Chamar em:"
|
||
|
||
#: lazarusidestrconsts.liscocallonbuild
|
||
msgctxt "lazarusidestrconsts.liscocallonbuild"
|
||
msgid "Build"
|
||
msgstr "Construção"
|
||
|
||
#: lazarusidestrconsts.liscocalloncompile
|
||
msgctxt "lazarusidestrconsts.liscocalloncompile"
|
||
msgid "Compile"
|
||
msgstr "Compilar"
|
||
|
||
#: lazarusidestrconsts.liscocallonrun
|
||
msgctxt "lazarusidestrconsts.liscocallonrun"
|
||
msgid "Run"
|
||
msgstr "Executar"
|
||
|
||
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
||
msgid "%s%sClick OK if you are sure to do that."
|
||
msgstr "%s%sClique OK se você tem certeza disso."
|
||
|
||
#: lazarusidestrconsts.liscocommand
|
||
msgctxt "lazarusidestrconsts.liscocommand"
|
||
msgid "Command:"
|
||
msgstr "Comando:"
|
||
|
||
#: lazarusidestrconsts.liscodebrowser
|
||
msgid "Code browser"
|
||
msgstr "Navegador de código"
|
||
|
||
#: lazarusidestrconsts.liscodeexplorer
|
||
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorador de Código"
|
||
|
||
#: lazarusidestrconsts.liscodefault
|
||
msgid "default (%s)"
|
||
msgstr "padrão (%s)"
|
||
|
||
#: lazarusidestrconsts.liscodegenerationoptions
|
||
msgid "Code generation options"
|
||
msgstr "Opções geração código"
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddlinkbutton
|
||
msgid "Add link"
|
||
msgstr "Adicionar vínculo"
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "Adicionar caminho"
|
||
|
||
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
||
msgid "Browse"
|
||
msgstr "Navegar"
|
||
|
||
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr "Confirmar substituição"
|
||
|
||
#: lazarusidestrconsts.liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr "Criar item ajuda"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
|
||
msgid "Delete link"
|
||
msgstr "Excluir vínculo"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "Remover caminho"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdescrtag
|
||
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
||
msgid "Description"
|
||
msgstr "Descrição"
|
||
|
||
#: lazarusidestrconsts.liscodehelperrorstag
|
||
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
||
msgid "Errors"
|
||
msgstr "Erros"
|
||
|
||
#: lazarusidestrconsts.liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "Exemplo"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr "Inserir \"tag\" formatação em negrito"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr "Inserir \"tag\" de formatação de código"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr "Inserir \"tag\" de formatação itálico"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr "Inserir \"tag\" de comentário da formatação"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr "Inserir \"tag\" de formatação de sublinhado"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr "Inserir \"tag\" de formatação de variável"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinherited
|
||
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
||
msgid "Inherited"
|
||
msgstr "Herança"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr "Inserir um vínculo ..."
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr "Inserir \"tag\" de formatação de parágrafo"
|
||
|
||
#: lazarusidestrconsts.liscodehelpmainformcaption
|
||
msgid "FPDoc editor"
|
||
msgstr "Editor FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnodocumentation
|
||
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
|
||
msgid "(none)"
|
||
msgstr "(nenhum)"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
||
msgid "(no inherited description found)"
|
||
msgstr "(nenhuma descrição de herança encontrada)"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<NENHUM>"
|
||
|
||
#: lazarusidestrconsts.liscodehelppathsgroupbox
|
||
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
|
||
msgid "FPDoc files path"
|
||
msgstr "Caminho arquivos FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelpreplacebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
|
||
msgid "Replace"
|
||
msgstr "Substituir"
|
||
|
||
#: lazarusidestrconsts.liscodehelpsavebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
|
||
msgid "Save"
|
||
msgstr "Salvar"
|
||
|
||
#: lazarusidestrconsts.liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr "Veja também"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr "Descrição curta de"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr "Curto"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshowemptymethods
|
||
msgid "Show empty methods"
|
||
msgstr "Mostrar métodos vazios"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshowunusedunits
|
||
msgid "Show unused units"
|
||
msgstr "Mostrar unidades não usadas"
|
||
|
||
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
||
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
||
msgid "Ignore constants in next functions"
|
||
msgstr "Ignorar constantes nas próximas funções"
|
||
|
||
#: lazarusidestrconsts.liscodeobscharconst
|
||
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
||
msgid "Search for unnamed char constants"
|
||
msgstr "Localizar constantes de caracteres não nomeadas"
|
||
|
||
#: lazarusidestrconsts.liscodeobserver
|
||
msgid "Code Observer"
|
||
msgstr "Observador de Código"
|
||
|
||
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
||
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
||
msgid "Ignore next unnamed constants"
|
||
msgstr "Ignorar próximas constantes não nomeadas"
|
||
|
||
#: lazarusidestrconsts.liscodetempladd
|
||
msgctxt "lazarusidestrconsts.liscodetempladd"
|
||
msgid "Add"
|
||
msgstr "Adicionar"
|
||
|
||
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "Adicionar Modelo de Código"
|
||
|
||
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
||
msgid " A token %s%s%s already exists! "
|
||
msgstr "Uma marca %s%s%s já existe!"
|
||
|
||
#: lazarusidestrconsts.liscodetemplautocompleteon
|
||
msgid "Auto complete on ..."
|
||
msgstr "Completar automaticamente em ..."
|
||
|
||
#: lazarusidestrconsts.liscodetemplchange
|
||
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
||
msgid "Change"
|
||
msgstr "Alterar"
|
||
|
||
#: lazarusidestrconsts.liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "Comentário:"
|
||
|
||
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr "Editar Modelo de Código"
|
||
|
||
#: lazarusidestrconsts.liscodetemplerror
|
||
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
||
msgid "Error"
|
||
msgstr "Erro"
|
||
|
||
#: lazarusidestrconsts.liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr "Sílaba:"
|
||
|
||
#: lazarusidestrconsts.liscodetools
|
||
msgid "CodeTools"
|
||
msgstr "Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "Ação: %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
||
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
||
msgstr "Ramificações criadas automaticamente não podem ser editadas,%snem podem possuir ramificações filhas não auto criadas."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "%s, gerado automaticamente"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes can not be edited."
|
||
msgstr "Ramificações criadas automaticamente não podem ser editadas."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "Bloco"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr "Editor de definições das ferramentas de código"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
|
||
msgid "CodeTools Defines Preview"
|
||
msgstr "Visualiza definições das ferramentas de código"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
||
msgid "compiler path"
|
||
msgstr "Caminho do compilador"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "Converter ramificações"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr "Criar definições para diretório %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr "Criar definições para o compilador Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr "Criar definições para os fontes SVN do Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
|
||
msgid "Create Defines for Lazarus Directory"
|
||
msgstr "Criar definições para diretório Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr "Criar definições para o projeto %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr "Criar macros FPC e caminhos para um diretório de projeto FPC"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr "Definir"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr "Definir Recursão"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "Excluir ramificação"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sPor exemplo: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sque são usados por este %s projeto.%sPor exemplo: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr "Descrição:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "Diretório %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsedit
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
|
||
msgid "Edit"
|
||
msgstr "Editar"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr "\"Else\""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr "\"ElseIf\""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorreading
|
||
msgid "Error reading %s%s%s%s%s"
|
||
msgstr "Erro lendo %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
|
||
msgid "Error reading project info file %s%s%s%s%s"
|
||
msgstr "Erro lendo arquivo de informações do projeto %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
|
||
msgid "Error while writing %s%s%s%s%s"
|
||
msgstr "Erro durante escrita %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
|
||
msgid "Error while writing project info file %s%s%s%s%s"
|
||
msgstr "Erro durante escrita do arquivo de informações do projeto %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsexit
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
|
||
msgid "Exit"
|
||
msgstr "Sair"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr "Sair sem Salvar"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr "Diretório SVN do fonte FPC"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr "\"If\""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
||
msgid "IfDef"
|
||
msgstr "\"IfDef\""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr "\"IfNDef\""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr "Diretório"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr "Inserir modelo de compilador Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr "Inserir modelo de diretório Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr "Inserir modelo de projeto Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr "Inserir modelo de compilador Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr "Inserir modelo de diretório Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Inserir modelo de projeto Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr "Inserir modelo de compilador Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr "Inserir modelo de diretório Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr "Inserir modelo de projeto Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr "Inserir modelo de compilador Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr "Inserir modelo de projeto Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr "Inserir modelo de Fonte SVN Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr "Inserir modelo de compilador Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr "Inserir modelo de diretório Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr "Inserir modelo de projeto Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
|
||
msgid "Insert Lazarus Directory Template"
|
||
msgstr "Inserir modelo de Diretório Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr "Inserir ramificação como filha"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr "Inserir ramificação abaixo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr "Inserir Modelo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr "Controle-Pai Inválido"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr "Ramificação do Controle-Pai inválida"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr "Ramificação anterior inválida"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sPor exemplo: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sque são usados por este %s projeto.%sPor exemplo: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
|
||
msgid "Lazarus Directory"
|
||
msgstr "Diretório Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr "Mover ramificação abaixo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr "Mover ramificação um nível abaixo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr "Move ramificação um nível acima"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr "Mover ramificação acima"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsname
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
||
msgid "Name:"
|
||
msgstr "Nome:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr "Nova ramificação"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
|
||
msgid "Node and its children are only valid for this project"
|
||
msgstr "Ramificações e suas filhas são válidas apenas para este projeto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr "Ramificação é somente leitura"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "Nenhum selecionado"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node can not contain child nodes."
|
||
msgstr "Ramificação do controle-pai não pode conter ramificações filhas."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr "Ramificação anterior não pode conter ramificações filhas."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Diretório do projeto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "Diretório do projeto %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
|
||
msgid "%s, project specific"
|
||
msgstr "%s, específico do projeto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr "Erro de Leitura"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr "Salvar e Sair"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "Ramificação selecionada:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
||
msgstr "O diretório SVN do fonte Free Pascal. Não requerido. Isto irá aprimorar a procura de declaração e depuração."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr "O diretório de projeto Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr "O diretório SVN do fonte Free Pascal."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
|
||
msgid "The Lazarus main directory."
|
||
msgstr "O diretório principal do Lazarus."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr "O caminho para compilador Free Pascal.%s Por exemplo %s/usr/bin/%s -n%s ou %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr "O caminho para o compilador Free Pascal deste projeto. Requerido apenas se você marcar o fonte SVN do FPC abaixo. Usado para auto-criar macros."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr "O diretório de projeto %s, %sque contém os arquivos .dpr, .dpk."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr "Indefinir"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr "Indefinir Tudo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr "Indefinir Recursão"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr "Valor como Caminho Arquivos"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr "Valor como Texto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr "Variável:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr "Erro de Escrita"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "Em"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
||
msgid "Bracket"
|
||
msgstr "Parentêse"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr "Dois Pontos"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr "Vírgula"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Identificador"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr "Palavra-Chave"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr "Nova linha"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnone
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
||
msgid "None"
|
||
msgstr "Nenhum"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr "Número"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsok
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
|
||
msgid "Ok"
|
||
msgstr "Ok"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr "Ponto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr "Ponto e vírgula"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsspace
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
||
msgid "Space"
|
||
msgstr "Espaço"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr "Const. \"String\""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr "Símbolo"
|
||
|
||
#: lazarusidestrconsts.liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr "Executar depois"
|
||
|
||
#: lazarusidestrconsts.liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr "Executar antes"
|
||
|
||
#: lazarusidestrconsts.liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr "Retrair todas as classes"
|
||
|
||
#: lazarusidestrconsts.liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr "Retrair todos os pacotes"
|
||
|
||
#: lazarusidestrconsts.liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr "Retrair todas as unidades"
|
||
|
||
#: lazarusidestrconsts.liscommandafter
|
||
msgid "Command after"
|
||
msgstr "Comando posterior"
|
||
|
||
#: lazarusidestrconsts.liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr "Comando posterior inválido"
|
||
|
||
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr "Comando posterior à publicação do módulo"
|
||
|
||
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr "Parâmetros de linha de comando do programa"
|
||
|
||
#: lazarusidestrconsts.liscompileidewithoutlinking
|
||
msgid "Compile IDE (without linking)"
|
||
msgstr "Compilar IDE (sem vincular)"
|
||
|
||
#: lazarusidestrconsts.liscompiler
|
||
msgid "Compiler"
|
||
msgstr "Compilador"
|
||
|
||
#: lazarusidestrconsts.liscompilererror
|
||
msgid "Compiler error"
|
||
msgstr "Erro do compilador"
|
||
|
||
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr "Erro: compilador inválido: %s"
|
||
|
||
#: lazarusidestrconsts.liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr "Nome de arquivo do compilador"
|
||
|
||
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
||
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
||
msgstr "Dica: Você pode ajustar o caminho do compilador em Ambiente->Opções de Ambiente->Arquivos->Caminho do Compilador"
|
||
|
||
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr "NOTA: Arquivo de configuração das ferramentas de código não encontrado - usando padrão"
|
||
|
||
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr "NOTA: carregando arquivo antigo de configurações das ferramentas de código"
|
||
|
||
#: lazarusidestrconsts.liscompileroptionsforproject
|
||
msgid "Compiler Options for Project: %s"
|
||
msgstr "Opções do Compilador para o Projeto: %s"
|
||
|
||
#: lazarusidestrconsts.liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%s (compilando ...)"
|
||
|
||
#: lazarusidestrconsts.liscomponent
|
||
msgid "Component"
|
||
msgstr "Componente"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameiskeyword
|
||
msgid "Component name %s%s%s is keyword"
|
||
msgstr "Nome de componente %s%s%s é uma palavra-chave"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
||
msgid "Component name %s%s%s is not a valid identifier"
|
||
msgstr "Nome de componente %s%s%s não é um identificador válido"
|
||
|
||
#: lazarusidestrconsts.liscomppalfindcomponent
|
||
msgid "Find component"
|
||
msgstr "Localizar componente"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr "Abrir pacote"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr "Abrir unidade"
|
||
|
||
#: lazarusidestrconsts.liscomptest
|
||
#| msgid "Test"
|
||
msgctxt "lazarusidestrconsts.liscomptest"
|
||
msgid "&Test"
|
||
msgstr "&Testar"
|
||
|
||
#: lazarusidestrconsts.liscondition
|
||
msgid "Condition"
|
||
msgstr "Condição"
|
||
|
||
#: lazarusidestrconsts.lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr "Diretório de configuração do Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuild
|
||
msgid "Configure Build %s"
|
||
msgstr "Configurar Construir %s"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
||
msgid "Configure %sBuild Lazarus%s"
|
||
msgstr "Configurar %sConstrução Lazarus%s"
|
||
|
||
#: lazarusidestrconsts.lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr "Confirmar alterações"
|
||
|
||
#: lazarusidestrconsts.lisconfirmdelete
|
||
msgid "Confirm delete"
|
||
msgstr "Confirmar exclusão"
|
||
|
||
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
||
msgid "Do you want to rebuild Lazarus?"
|
||
msgstr "Você deseja reconstruir o Lazarus?"
|
||
|
||
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr "Confirmar novo conjunto pacote para a IDE"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageaction
|
||
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
||
msgid "Action"
|
||
msgstr "Ação"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
||
msgid "New package set"
|
||
msgstr "Novo conjunto pacote"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
||
msgid "Old package set"
|
||
msgstr "Antigo conjunto pacote"
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr "Aplicação console"
|
||
|
||
#: lazarusidestrconsts.lisconstructorcode
|
||
msgid "Constructor code"
|
||
msgstr "Código do construtor"
|
||
|
||
#: lazarusidestrconsts.liscontains
|
||
msgid "contains"
|
||
msgstr "contém"
|
||
|
||
#: lazarusidestrconsts.liscontextsensitive
|
||
msgid "Context sensitive"
|
||
msgstr "Sensível ao contexto"
|
||
|
||
#: lazarusidestrconsts.liscontinue
|
||
msgctxt "lazarusidestrconsts.liscontinue"
|
||
msgid "Continue"
|
||
msgstr "Continuar"
|
||
|
||
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr "Continuar sem carregar o formulário"
|
||
|
||
#: lazarusidestrconsts.liscontributors
|
||
msgid "Contributors"
|
||
msgstr "Colaboradores"
|
||
|
||
#: lazarusidestrconsts.liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr "Controle precisa de um controle-pai"
|
||
|
||
#: lazarusidestrconsts.lisconvautoremoveproperties
|
||
msgid "Automatic removal of unknown properties"
|
||
msgstr "Remoção automática de propriedades desconhecidas"
|
||
|
||
#: lazarusidestrconsts.lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr "Erro de conversão"
|
||
|
||
#: lazarusidestrconsts.lisconvert
|
||
msgid "Convert"
|
||
msgstr "Converter"
|
||
|
||
#: lazarusidestrconsts.lisconvertencoding
|
||
msgid "Convert encoding"
|
||
msgstr "Converter codificação"
|
||
|
||
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
||
msgid "Convert encoding of projects/packages"
|
||
msgstr "Converter codificação do projeto/pacotes"
|
||
|
||
#: lazarusidestrconsts.lisconvertprojectorpackage
|
||
msgid "Convert project or package"
|
||
msgstr "Converter projeto ou pacote"
|
||
|
||
#: lazarusidestrconsts.lisconverttarget1
|
||
msgid "Lazarus/LCL"
|
||
msgstr "Lazarus/LCL"
|
||
|
||
#: lazarusidestrconsts.lisconverttarget2
|
||
msgid "Lazarus/LCL for Windows only"
|
||
msgstr "Lazarus/LCL apenas para Windows"
|
||
|
||
#: lazarusidestrconsts.lisconverttarget3
|
||
msgid "Both Lazarus/LCL and Delphi"
|
||
msgstr "Ambos Lazarus/LCL e Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplacements
|
||
msgid "Type Replacements"
|
||
msgstr "Substituições Tipos"
|
||
|
||
#: lazarusidestrconsts.lisconvtypestoreplace
|
||
msgid "Types to replace"
|
||
msgstr "Tipos à substituir"
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplacements
|
||
msgid "Unit Replacements"
|
||
msgstr "Substituições Unidades"
|
||
|
||
#: lazarusidestrconsts.lisconvunitstoreplace
|
||
msgid "Units to replace"
|
||
msgstr "Unidades à substituir"
|
||
|
||
#: lazarusidestrconsts.lisconvunitstypesproperties
|
||
msgid "Units, Types and Properties"
|
||
msgstr "Unidades, Tipos e Propriedades"
|
||
|
||
#: lazarusidestrconsts.liscopyall
|
||
msgid "Copy All"
|
||
msgstr "Copiar Tudo"
|
||
|
||
#: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard
|
||
msgid "Copy all and hidden messages to clipboard"
|
||
msgstr "Copiar todas as mensagens, incluse as escondidas, para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
||
msgid "Copy all items to clipboard"
|
||
msgstr "Copiar todos os items para a Área de Transf."
|
||
|
||
#: lazarusidestrconsts.liscopyallmessagestoclipboard
|
||
msgid "Copy all messages to clipboard"
|
||
msgstr "Copiar todas as mensagens para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.liscopyalloutputclipboard
|
||
msgid "Copy all output to clipboard"
|
||
msgstr "Copiar toda saída para área transferência"
|
||
|
||
#: lazarusidestrconsts.liscopydescription
|
||
msgid "Copy description to clipboard"
|
||
msgstr "Copiar descrição para área transferência"
|
||
|
||
#: lazarusidestrconsts.liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr "Erro na cópia"
|
||
|
||
#: lazarusidestrconsts.liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "Erro na cópia"
|
||
|
||
#: lazarusidestrconsts.liscopyidentifier
|
||
msgid "Copy %s%s%s to clipboard"
|
||
msgstr "Copiar %s%s%s para área transferência"
|
||
|
||
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr "Cópiar um formulário inteiro não está implementado."
|
||
|
||
#: lazarusidestrconsts.liscopyitemtoclipboard
|
||
msgid "Copy item to clipboard"
|
||
msgstr "Copiar item para Área Transferência"
|
||
|
||
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
||
msgid "Copy selected items to clipboard"
|
||
msgstr "Copiar itens selecionados para Área Transf."
|
||
|
||
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
||
msgid "Copy selected messages to clipboard"
|
||
msgstr "Copiar mensagens selecionadas para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr "Localizar mensagens FPC"
|
||
|
||
#: lazarusidestrconsts.liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr "Localizar mensagens Make"
|
||
|
||
#: lazarusidestrconsts.liscoshowallmessages
|
||
msgid "Show all messages"
|
||
msgstr "Mostrar todas as mensagens"
|
||
|
||
#: lazarusidestrconsts.liscoskipcallingcompiler
|
||
msgid "Skip calling Compiler"
|
||
msgstr "Saltar chamada de Compilador"
|
||
|
||
#: lazarusidestrconsts.liscotargetosspecificoptions
|
||
msgid "Target OS specific options"
|
||
msgstr "Opções específicas do SO Alvo"
|
||
|
||
#: lazarusidestrconsts.liscouldnotadditomainsource
|
||
msgid "Could not add %s{$I %s%s} to main source!"
|
||
msgstr "Não pode adicionar %s{$I %s%s} ao código fonte principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
||
msgid "Could not add %s{$R %s%s} to main source!"
|
||
msgstr "Não pode adicionar %s{$R %s%s} ao código fonte principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
||
msgid "Could not add %s%s%s to main source!"
|
||
msgstr "Não pode adicionar %s%s%s ao código fonte principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
||
msgid "Could not remove %s%s%s from main source!"
|
||
msgstr "Não pode remover %s%s%s do código fonte principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
||
msgid "Could not remove %s{$I %s%s} from main source!"
|
||
msgstr "Não pode remover %s{$I %s%s} do código fonte principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
||
msgid "Could not remove %s{$R %s%s} from main source!"
|
||
msgstr "Não pode remover %s{$R %s%s} do código fonte principal!"
|
||
|
||
#: lazarusidestrconsts.liscovarious
|
||
msgid "%s (various)"
|
||
msgstr "%s (vários)"
|
||
|
||
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr "Aviso: O arquivo adicional de configuração de compilador tem o mesmo nome de um dos arquivos de configuração padrão que o compilador Free Pascal está buscando. Isto pode resultar SOMENTE na análise da configuração adicional, saltando a configuração padrão."
|
||
|
||
#: lazarusidestrconsts.liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr "Abrir pacote %s"
|
||
|
||
#: lazarusidestrconsts.liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr "Abrir unidade %s"
|
||
|
||
#: lazarusidestrconsts.liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr "Crie um projeto primeiro!"
|
||
|
||
#: lazarusidestrconsts.liscreatedirectory
|
||
msgid "Create directory?"
|
||
msgstr "Criar diretório?"
|
||
|
||
#: lazarusidestrconsts.liscreatefunction
|
||
msgid "Create function"
|
||
msgstr "Criar função"
|
||
|
||
#: lazarusidestrconsts.liscreatehelpnode
|
||
msgid "Create Help node"
|
||
msgstr "Criar ramificação Ajuda"
|
||
|
||
#: lazarusidestrconsts.liscreateit
|
||
msgid "Create it"
|
||
msgstr "Criá-lo"
|
||
|
||
#: lazarusidestrconsts.liscreatenewproject
|
||
msgid "Create new project"
|
||
msgstr "Criar novo projeto"
|
||
|
||
#: lazarusidestrconsts.liscreateproject
|
||
msgid "Create project"
|
||
msgstr "Criar projeto"
|
||
|
||
#: lazarusidestrconsts.lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr "Escolha o diretório"
|
||
|
||
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr "Valores do diretório de Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr "Definir modelos"
|
||
|
||
#: lazarusidestrconsts.lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<nenhuma variável selecionada>"
|
||
|
||
#: lazarusidestrconsts.lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr "Abrir Visualização"
|
||
|
||
#: lazarusidestrconsts.lisctdefstools
|
||
msgid "Tools"
|
||
msgstr "Ferramentas"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr "Variável: %s"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr "Nome da Variável"
|
||
|
||
#: lazarusidestrconsts.lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr "Modelos"
|
||
|
||
#: lazarusidestrconsts.lisctinsertmacro
|
||
msgid "Insert Macro"
|
||
msgstr "Inserir Macro"
|
||
|
||
#: lazarusidestrconsts.lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr "favor selecionar uma macro"
|
||
|
||
#: lazarusidestrconsts.lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr "Selecionar Código de Macro"
|
||
|
||
#: lazarusidestrconsts.liscurrent
|
||
msgid "Current"
|
||
msgstr "Atual"
|
||
|
||
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr "Coluna do cursor no editor atual"
|
||
|
||
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr "Linha do cursor no editor atual"
|
||
|
||
#: lazarusidestrconsts.liscustomoptions
|
||
msgid "custom options"
|
||
msgstr "Opções personalizadas"
|
||
|
||
#: lazarusidestrconsts.liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr "Opções personalizadas"
|
||
|
||
#: lazarusidestrconsts.liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr "Programa personalizado"
|
||
|
||
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
|
||
msgid "Custom Program%sA freepascal program."
|
||
msgstr "Programa personalizado%sUm programa Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisdatamodule
|
||
msgid "Data Module"
|
||
msgstr "Data Module"
|
||
|
||
#: lazarusidestrconsts.lisdate
|
||
msgid "Date"
|
||
msgstr "Data"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "Nenhum depurador especificado"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr "Marcar ponto de parada assim mesmo"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
||
msgstr "Não há um depurador especificado.%sMarcar pontos de parada não tem efeito até que você configure um Depurador, no diálogo de opções de depurador, no menu."
|
||
|
||
#: lazarusidestrconsts.lisdebuggererror
|
||
msgid "Debugger error"
|
||
msgstr "Erro do Depurador "
|
||
|
||
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr "Erro do Depurador%sOoops, o depurador entrou em uma condição de erro%sSalve seu trabalho agora !%sClique Parar e espere pelo melhor, estamos puxando a tomada."
|
||
|
||
#: lazarusidestrconsts.lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr "Depurador inválido"
|
||
|
||
#: lazarusidestrconsts.lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%s (depurando ...)"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
||
msgid "Add Exception"
|
||
msgstr "Adicionar Exceção"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr "Caminho de busca adicional"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr "Ponto de parada"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr "Limpar registro de eventos ao executar"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr "Opções gerais do Depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr "Opções específicas do Depurador (dependem do tipo de depurador)"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
||
msgid "Duplicate Exception name"
|
||
msgstr "Duplicar nome da Exceção"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
||
msgid "Enter the name of the exception"
|
||
msgstr "Digitar o nome da exceção"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
||
msgid "Event Log"
|
||
msgstr "Registro de Eventos"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr "Manipulado por"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr "Manipulado pelo Depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr "Manipulado pelo Programa"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmid
|
||
msgid "ID"
|
||
msgstr "ID"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr "Ignorar estas exceções"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr "Exceções de Idioma"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
||
msgid "Limit linecount to"
|
||
msgstr "Limitar contagem de linha em"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
||
msgid "Module"
|
||
msgstr "Módulo"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmname
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
|
||
msgid "Name"
|
||
msgstr "Nome"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
||
msgid "Notify on Lazarus Exceptions"
|
||
msgstr "Notificar Exceções Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr "Exceções do SO"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr "Saída"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr "Processo"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr "Retomar"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr "Retomar Manipulados"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr "Retomar não Manipulados"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr "Mostrar mensagem na parada"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr "Sinais"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr "Thread"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmwindow
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
|
||
msgid "Window"
|
||
msgstr "Janela"
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr "Impossível carregar arquivo"
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
||
msgid "Unable to load file %s%s%s."
|
||
msgstr "Impossível carregar arquivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisdecimal
|
||
msgid "Decimal"
|
||
msgstr "Decimal"
|
||
|
||
#: lazarusidestrconsts.lisdefaultvalue
|
||
msgid "Default value"
|
||
msgstr "Valor padrão"
|
||
|
||
#: lazarusidestrconsts.lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr "&Excluir Tudo"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
||
msgid "Delete all breakpoints?"
|
||
msgstr "Excluir todos os pontos de parada?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
||
msgid "Delete all breakpoints in file %s%s%s?"
|
||
msgstr "Excluir todos os pontos de parada no arquivo %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallinsamesource
|
||
msgid "Delete All in same source"
|
||
msgstr "Excluir Tudo no mesmo código fonte"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
||
msgid "Delete all selected breakpoints?"
|
||
msgstr "Excluir todos os pontos de parada selecionados?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr "Excluir todos esses arquivos?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr "Excluir arquivo ambíguo?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpoint
|
||
msgid "Delete Breakpoint"
|
||
msgstr "Excluir Ponto de parada"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointatline
|
||
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
||
msgstr "Excluir ponto de parada na%s\"%s\" linha %d?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebuildmode
|
||
msgid "Delete build mode"
|
||
msgstr "Excluir modo construção"
|
||
|
||
#: lazarusidestrconsts.lisdeletebuildmode2
|
||
msgid "Delete build mode?"
|
||
msgstr "Excluir modo construção?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebuildmode3
|
||
msgid "Delete build mode %s%s%s?"
|
||
msgstr "Excluir modo construção %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebuildvar
|
||
msgid "Delete build variable %s%s%s?"
|
||
msgstr "Excluir variável construção %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr "Falha na exclusão do arquivo"
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile
|
||
msgid "Delete old file %s%s%s?"
|
||
msgstr "Excluir arquivo antigo %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile2
|
||
msgid "Delete old file?"
|
||
msgstr "Excluir arquivo antigo?"
|
||
|
||
#: lazarusidestrconsts.lisdeleterow
|
||
msgid "Delete row"
|
||
msgstr "Excluir linha"
|
||
|
||
#: lazarusidestrconsts.lisdeleteselectedfiles
|
||
msgid "Delete selected files"
|
||
msgstr "Excluir arquivos selecionados"
|
||
|
||
#: lazarusidestrconsts.lisdeletesetting
|
||
msgid "Delete setting"
|
||
msgstr "Excluir ajustes"
|
||
|
||
#: lazarusidestrconsts.lisdeletesetting2
|
||
msgid "Delete setting?"
|
||
msgstr "Excluir ajustes?"
|
||
|
||
#: lazarusidestrconsts.lisdeletesetting3
|
||
msgid "Delete setting %s%s%s?"
|
||
msgstr "Excluir ajustes %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue
|
||
msgid "Delete value %s%s%s"
|
||
msgstr "Excluir valor %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisdeletingoffilefailed
|
||
msgid "Deleting of file %s%s%s failed."
|
||
msgstr "Falha ao eliminar arquivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisdelphi
|
||
msgid "Delphi"
|
||
msgstr "Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphipackage
|
||
msgid "Delphi package"
|
||
msgstr "Pacote Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphiproject
|
||
msgid "Delphi project"
|
||
msgstr "Projeto Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphiunit
|
||
msgid "Delphi unit"
|
||
msgstr "Unidade Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
|
||
msgid "There is already another component with the name %s%s%s."
|
||
msgstr "Já existe outro componente com o nome %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr "Diretório de destino"
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
|
||
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
||
msgstr "Diretório de destino %s%s%s é inválido.%sFavor escolher um caminho completo."
|
||
|
||
#: lazarusidestrconsts.lisdestructorcode
|
||
msgid "Destructor code"
|
||
msgstr "Código do Destruidor"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr "Não diferenciar maiúsc./minúsc."
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr "Ignorar se linhas em branco foram adicionadas ou removidas"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr "Ignorar diferenças no final de linha (ex. #10 = #13#10)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr "Ignorar quantidade de espaços em branco"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr "Ignorar espaços (caracteres de nova linha não incluídos)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr "Ignorar espaços no final da linha"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr "Ignorar espaços no início da linha"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "Somente seleção"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
||
msgid "Open Diff in editor"
|
||
msgstr "Abrir \"Diff\" no editor"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgtext1
|
||
msgid "Text1"
|
||
msgstr "Texto1"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgtext2
|
||
msgid "Text2"
|
||
msgstr "Texto2"
|
||
|
||
#: lazarusidestrconsts.lisdigits
|
||
msgid "Digits:"
|
||
msgstr "Dígitos:"
|
||
|
||
#: lazarusidestrconsts.lisdirectives
|
||
msgid "Directives"
|
||
msgstr "Diretivas"
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound
|
||
msgid "Directory %s%s%s not found."
|
||
msgstr "Diretório %s%s%s não encontrado."
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotwritable
|
||
msgid "Directory not writable"
|
||
msgstr "Diretório não gravável"
|
||
|
||
#: lazarusidestrconsts.lisdisableallinsamesource
|
||
msgid "Disable All in same source"
|
||
msgstr "Desabiltar Tudo no mesmo código fonte"
|
||
|
||
#: lazarusidestrconsts.lisdisablebreakpoint
|
||
msgid "Disable Breakpoint"
|
||
msgstr "Desabilitar Ponto de Parada"
|
||
|
||
#: lazarusidestrconsts.lisdisabled
|
||
msgid "Disabled"
|
||
msgstr "Desabilitado"
|
||
|
||
#: lazarusidestrconsts.lisdisablegroup
|
||
msgid "Disable Group"
|
||
msgstr "Desabilitar Grupo"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr "&Descartar alterações"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffchangedfiles
|
||
msgid "Changed files:"
|
||
msgstr "Arquivos alterados:"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr "Clique em um dos items acima para ver as diferenças"
|
||
|
||
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr "Erro lendo o arquivo: %s"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
|
||
msgid "Ignore disk changes"
|
||
msgstr "Ignorar alterações no disco"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffrevertall
|
||
msgid "Reload from disk"
|
||
msgstr "Recarregar do disco"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr "Alguns arquivos foram alterados no disco:"
|
||
|
||
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr "Distinguir letras grandes e pequenas, ex: A e a"
|
||
|
||
#: lazarusidestrconsts.lisdocumentationeditor
|
||
msgid "Documentation Editor"
|
||
msgstr "Editor de Documentação"
|
||
|
||
#: lazarusidestrconsts.lisdoesnotexists
|
||
msgid "%s does not exists: %s"
|
||
msgstr "%s não existe: %s"
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheide
|
||
msgid "Do not close the IDE"
|
||
msgstr "Não fechar a IDE"
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "Não fechar o projeto"
|
||
|
||
#: lazarusidestrconsts.lisdonotcompiledependencies
|
||
msgid "do not compile dependencies"
|
||
msgstr "não compilar dependências"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr "Não mostrar a tela de início"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
||
msgid "Do not show this message again"
|
||
msgstr "Não mostrar esta mensagem novamente"
|
||
|
||
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
||
msgid "Draw grid lines"
|
||
msgstr "Desenhar linhas da grade"
|
||
|
||
#: lazarusidestrconsts.lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr "Copiar componentes selecionados para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr "Recortar componentes selecionados para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr "Mover componente um atrás"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr "Mover componente um adiante"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr "Mover componente para trás"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr "Mover componente para frente"
|
||
|
||
#: lazarusidestrconsts.lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr "Colar componentes selecionados da Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr "Selecionar componente pai"
|
||
|
||
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
||
msgid "Duplicate found of value %s%s%s."
|
||
msgstr "Valor duplicado encontrado %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
||
msgstr "Nome duplicado: Um componente chamado %s%s%s já existe no componente herdado %s"
|
||
|
||
#: lazarusidestrconsts.liseditcontexthelp
|
||
msgid "Edit context help"
|
||
msgstr "Editar ajuda contextual"
|
||
|
||
#: lazarusidestrconsts.lisedoptschoosescheme
|
||
msgid "Choose Scheme"
|
||
msgstr "Escolher Esquema"
|
||
|
||
#: lazarusidestrconsts.lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "Todos os pacotes"
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr "Projeto Atual"
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
|
||
msgid "Current Project Directory"
|
||
msgstr "Diretório do Projeto Atual"
|
||
|
||
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
|
||
msgid "Global Source Path addition"
|
||
msgstr "Caminho adicional para Fontes Globais"
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectincpath
|
||
msgid "Project IncPath"
|
||
msgstr "Caminho \"IncPath\""
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectsrcpath
|
||
msgid "Project SrcPath"
|
||
msgstr "Caminho \"SrcPath\""
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectunitpath
|
||
msgid "Project UnitPath"
|
||
msgstr "Caminhos para as unidades do Projeto"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr "Todos os projetos"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr "Ajustar modo FPC para DELPHI"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
||
msgid "set FPC mode to FPC"
|
||
msgstr "ajustar modo FPC para FPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr "Ajustar modo FPC para GPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
||
msgid "set FPC mode to MacPas"
|
||
msgstr "ajustar modo FPC para MacPas"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr "Ajustar modo FPC para TP"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr "Ajustar IOCHECKS=ON"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr "Ajustar OVERFLOWCHECKS=ON"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr "Ajustar RANGECHEKS=ON"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr "usar unidade HeapTrc"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr "usar unidade LineInfo"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolalt
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr "Uma ferramenta válida necessita no mínimo de um título e um nome de arquivo."
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolctrl
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "Editar Ferramenta"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolinsert
|
||
msgid "Insert"
|
||
msgstr "Inserir"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolkey
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
||
msgid "Key"
|
||
msgstr "Tecla"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolmacros
|
||
msgid "Macros"
|
||
msgstr "Macros"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr "Parâmetros:"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
||
msgid "Program Filename:"
|
||
msgstr "Nome do programa:"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for Free Pascal Compiler messages"
|
||
msgstr "Examinar saída por mensagens do compilador Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for make messages"
|
||
msgstr "Examinar saída por mensagens do Make"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolshift
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr "Título e Nome do Arquivo requerido"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr "Diretório trabalho:"
|
||
|
||
#: lazarusidestrconsts.lisemdall
|
||
msgid "All"
|
||
msgstr "Tudo"
|
||
|
||
#: lazarusidestrconsts.lisemdemtpymethods
|
||
msgid "Emtpy Methods"
|
||
msgstr "Métodos Vazios"
|
||
|
||
#: lazarusidestrconsts.lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr "Métodos vazios encontrados:"
|
||
|
||
#: lazarusidestrconsts.lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr "Somente publicados"
|
||
|
||
#: lazarusidestrconsts.lisemdpublic
|
||
msgid "Public"
|
||
msgstr "Público"
|
||
|
||
#: lazarusidestrconsts.lisemdpublished
|
||
msgid "Published"
|
||
msgstr "Publicado"
|
||
|
||
#: lazarusidestrconsts.lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr "Remover métodos"
|
||
|
||
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr "Localizar nestas seções de classe:"
|
||
|
||
#: lazarusidestrconsts.lisempty
|
||
msgid "Empty"
|
||
msgstr "Vazio"
|
||
|
||
#: lazarusidestrconsts.lisenableall
|
||
msgid "&Enable All"
|
||
msgstr "&Habilitar Tudo"
|
||
|
||
#: lazarusidestrconsts.lisenableallinsamesource
|
||
msgid "Enable All in same source"
|
||
msgstr "Habilitar tudo no mesmo código fonte"
|
||
|
||
#: lazarusidestrconsts.lisenablebreakpoint
|
||
msgid "Enable Breakpoint"
|
||
msgstr "Habilitar Ponto de Parada"
|
||
|
||
#: lazarusidestrconsts.lisenabled
|
||
msgctxt "lazarusidestrconsts.lisenabled"
|
||
msgid "Enabled"
|
||
msgstr "Ativado"
|
||
|
||
#: lazarusidestrconsts.lisenablegroup
|
||
msgid "Enable Group"
|
||
msgstr "Habilitar Grupo"
|
||
|
||
#: lazarusidestrconsts.lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr "Ativar Macros"
|
||
|
||
#: lazarusidestrconsts.lisenclose
|
||
msgid "Enclose"
|
||
msgstr "Circundar"
|
||
|
||
#: lazarusidestrconsts.lisencloseselection
|
||
msgctxt "lazarusidestrconsts.lisencloseselection"
|
||
msgid "Enclose Selection"
|
||
msgstr "Circundar Seleção"
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr "Codificação do arquivo %s%s%s%sno disco é %s. Nova codificação é %s."
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr "Codificação no arquivo %s%s%s%sno disco é %s. Nova codificação é %s."
|
||
|
||
#: lazarusidestrconsts.lisentertransla
|
||
msgid "Enter translation language"
|
||
msgstr "Entre com o idioma de tradução"
|
||
|
||
#: lazarusidestrconsts.lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
||
msgid "Double click on messages jumps (otherwise: single click)"
|
||
msgstr "Clique duplo em salto de mensagens (Caso contrario: clique único)"
|
||
|
||
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
||
msgid "Environment variable, name as parameter"
|
||
msgstr "Variável ambiente, nome como parâmetro"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr "Diretório não encontrado"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
|
||
msgid "FPC source directory \"%s\" not found."
|
||
msgstr "Diretório do fonte FPC \"%s\" não encontrado."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
|
||
msgid "Invalid compiler filename"
|
||
msgstr "Nome do arquivo do compilador inválido"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
|
||
msgid "The compiler file \"%s\" is not an executable."
|
||
msgstr "O arquivo de compilador \"%s\" não é um executável."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr "Nome de arquivo do depurador inválido"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr "O arquivo do depurador \"%s\" não é um executável."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
|
||
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
||
msgstr "O diretório do fonte FPC \"%s\" não parece correto. Normalmente ele contém diretórios tais como: rtl, packages, compiler, ... ."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
|
||
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
||
msgstr "O diretório do Lazarus \"%s\" não parece correto. Normalmente ele contém diretórios tais como: lcl, debugger, designer, components, ..."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
|
||
msgid "Invalid make filename"
|
||
msgstr "Nome de arquivo Make inválido"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
|
||
msgid "The make file \"%s\" is not an executable."
|
||
msgstr "O arquivo Make \"%s\" não é um executável."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
|
||
msgid "Lazarus directory \"%s\" not found."
|
||
msgstr "Diretório do Lazarus \"%s\" não encontrado."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr "Diretório de teste \"%s\" não encontrado."
|
||
|
||
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
|
||
msgid "NOTE: only absolute paths are supported now"
|
||
msgstr "NOTA: somente caminhos absolutos são suportados agora"
|
||
|
||
#: lazarusidestrconsts.liseotabwidths
|
||
msgctxt "lazarusidestrconsts.liseotabwidths"
|
||
msgid "Tab widths"
|
||
msgstr "Largura de tabulações"
|
||
|
||
#: lazarusidestrconsts.liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr "Opção inválida na posição %d: \"%s\""
|
||
|
||
#: lazarusidestrconsts.liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr "Opção na posição %d não permite um argumento: %s"
|
||
|
||
#: lazarusidestrconsts.liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr "Opção na posição %d precisa de um argumento : %s"
|
||
|
||
#: lazarusidestrconsts.liserror
|
||
msgid "Error: "
|
||
msgstr "Erro:"
|
||
|
||
#: lazarusidestrconsts.liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr "Erro ao criar arquivo"
|
||
|
||
#: lazarusidestrconsts.liserrorcreatinglrs
|
||
msgid "Error creating lrs"
|
||
msgstr "Erro criando lrs"
|
||
|
||
#: lazarusidestrconsts.liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr "Erro na exclusão do arquivo"
|
||
|
||
#: lazarusidestrconsts.liserrorin
|
||
msgid "Error in %s"
|
||
msgstr "Erro em %s"
|
||
|
||
#: lazarusidestrconsts.liserrorinitializingprogramserrors
|
||
msgid "Error initializing program%s%s%s%s%sError: %s"
|
||
msgstr "Erro inicializando o programa%s%s%s%s%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr "Erro carregando arquivo"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfrom
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr "Erro carregado %s de%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr "Erro ao mover o componente"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr "Erro ao mover o componente %s%s"
|
||
|
||
#: lazarusidestrconsts.liserrornamingcomponent
|
||
msgid "Error naming component"
|
||
msgstr "Erro ao nomear componente"
|
||
|
||
#: lazarusidestrconsts.liserroropeningcomponent
|
||
msgid "Error opening component"
|
||
msgstr "Erro abrindo componente"
|
||
|
||
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr "Erro na análise do fluxo de componente no arquivo LFM."
|
||
|
||
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr "Erro na leitura da lista de pacotes do arquivo%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxml
|
||
msgid "Error reading XML"
|
||
msgstr "Erro lendo XML"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxmlfile
|
||
msgid "Error reading xml file %s%s%s%s%s"
|
||
msgstr "Erro lendo arquivo xml %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr "Erro na renomeação do arquivo"
|
||
|
||
#: lazarusidestrconsts.liserrors
|
||
msgctxt "lazarusidestrconsts.liserrors"
|
||
msgid "Errors"
|
||
msgstr "Erros"
|
||
|
||
#: lazarusidestrconsts.liserrorsavingto
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr "Erro salvando %s to%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
||
msgid "Error setting the name of a component %s to %s"
|
||
msgstr "Erro ao ajustar o nome de um componente %s para %s"
|
||
|
||
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr "Erro na escrita do lista de pacotes para arquivo%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liseteditcustomscanners
|
||
msgid "Edit custom scanners (%s)"
|
||
msgstr "Editar \"scanners\" personalizados (%s)"
|
||
|
||
#: lazarusidestrconsts.lisevalexpression
|
||
msgid "Eval expression"
|
||
msgstr "Avaliar expressão"
|
||
|
||
#: lazarusidestrconsts.lisevaluate
|
||
msgid "E&valuate"
|
||
msgstr "A&valiar"
|
||
|
||
#: lazarusidestrconsts.liseverynthlinenumber
|
||
msgid "Every n-th line number:"
|
||
msgstr "Todo enésimo número linha:"
|
||
|
||
#: lazarusidestrconsts.lisexamplefile
|
||
msgid "Example file:"
|
||
msgstr "Arquivo exemplo:"
|
||
|
||
#: lazarusidestrconsts.lisexamples
|
||
msgid "Examples"
|
||
msgstr "Exemplos"
|
||
|
||
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
||
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
msgstr "Exemplos:%sIdentificador%sTMyEnum.Enum%sNomeUnidade.Identificador%s#NomePacote.NomeUnidade.Identificador"
|
||
|
||
#: lazarusidestrconsts.lisexceptiondialog
|
||
msgid "Debugger Exception Notification"
|
||
msgstr "Notificação Exceções Depurador"
|
||
|
||
#: lazarusidestrconsts.lisexcludefilter
|
||
msgid "Exclude Filter"
|
||
msgstr "Filtro de Exclusão"
|
||
|
||
#: lazarusidestrconsts.lisexcludefilter2
|
||
msgid "Exclude filter"
|
||
msgstr "Filtro exclusão"
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr "Executando comando posterior"
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr "Executando comando anterior"
|
||
|
||
#: lazarusidestrconsts.lisexecutionpaused
|
||
msgid "Execution paused"
|
||
msgstr "Execução pausada"
|
||
|
||
#: lazarusidestrconsts.lisexecutionpausedadress
|
||
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
||
msgstr "Execução pausada%s Endereço: $%s%s Procedimento: %s%s Arquivo %s%s (Algum dia uma janela assembler poderá aparecer aqui :)%s"
|
||
|
||
#: lazarusidestrconsts.lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr "Execução parada"
|
||
|
||
#: lazarusidestrconsts.lisexeprograms
|
||
msgid "Programs"
|
||
msgstr "Programas"
|
||
|
||
#: lazarusidestrconsts.lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr "Expandir todas as classes"
|
||
|
||
#: lazarusidestrconsts.lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr "Expandir todos os pacotes"
|
||
|
||
#: lazarusidestrconsts.lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr "Expandir todas as unidades"
|
||
|
||
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr "Nome de arquivo expandido do editor de arquivo atual"
|
||
|
||
#: lazarusidestrconsts.lisexport
|
||
msgid "Export ..."
|
||
msgstr "Exportar..."
|
||
|
||
#: lazarusidestrconsts.lisexportlist
|
||
msgid "Export list"
|
||
msgstr "Exportar Lista"
|
||
|
||
#: lazarusidestrconsts.lisexpression
|
||
msgid "Expression:"
|
||
msgstr "Expressão:"
|
||
|
||
#: lazarusidestrconsts.lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr "Estender caminho da unidade?"
|
||
|
||
#: lazarusidestrconsts.lisextract
|
||
msgid "Extract"
|
||
msgstr "Extrair"
|
||
|
||
#: lazarusidestrconsts.lisextractprocedure
|
||
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
||
msgid "Extract Procedure"
|
||
msgstr "Extrair Procedimento"
|
||
|
||
#: lazarusidestrconsts.lisexttoolexternaltools
|
||
msgid "External tools"
|
||
msgstr "Ferramentas externas"
|
||
|
||
#: lazarusidestrconsts.lisexttoolfailedtoruntool
|
||
msgid "Failed to run tool"
|
||
msgstr "Falha ao executar ferramenta"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr "Máximo de Ferramentas atingido"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmovedown
|
||
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
|
||
msgid "Down"
|
||
msgstr "Abaixo"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmoveup
|
||
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
|
||
msgid "Up"
|
||
msgstr "Acima"
|
||
|
||
#: lazarusidestrconsts.lisexttoolremove
|
||
msgid "Remove"
|
||
msgstr "Remover"
|
||
|
||
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr "Há um máximo de %s ferramentas."
|
||
|
||
#: lazarusidestrconsts.lisexttooltitlecompleted
|
||
msgid "\"%s\" completed"
|
||
msgstr "\"%s\" completado"
|
||
|
||
#: lazarusidestrconsts.lisexttoolunabletorunthetool
|
||
msgid "Unable to run the tool %s%s%s:%s%s"
|
||
msgstr "Impossível executar ferramenta %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
||
msgid "Failed to load fold state"
|
||
msgstr "Falha ao carregar estado retração"
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr "Reduzir atualização de janela"
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr "Atualizar itens da janela do editor quando ocioso.(Reduz pico processamento para computadores lentos)"
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Arquivo %s%s%s%snão parece ser um arquivo texto.%sAbrir assim mesmo?"
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Arquivo %s%s%s%snão parece ser um arquivo texto.%sAbrir assim mesmo?"
|
||
|
||
#: lazarusidestrconsts.lisfileextensionofprograms
|
||
msgid "File extension of programs"
|
||
msgstr "Extensões de arquivos de programas"
|
||
|
||
#: lazarusidestrconsts.lisfilefilter
|
||
msgid "File filter"
|
||
msgstr "Filtro arquivo"
|
||
|
||
#: lazarusidestrconsts.lisfilehaschangedsave
|
||
msgid "File %s%s%s has changed. Save?"
|
||
msgstr "Arquivo %s%s%s foi alterado. Salvar?"
|
||
|
||
#: lazarusidestrconsts.lisfilehasnoproject
|
||
msgid "File has no project"
|
||
msgstr "Arquivo não tem projeto"
|
||
|
||
#: lazarusidestrconsts.lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr "Arquivo não aceita escrita"
|
||
|
||
#: lazarusidestrconsts.lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr "Arquivo é um vínculo simbólico"
|
||
|
||
#: lazarusidestrconsts.lisfileisvirtual
|
||
msgid "File %s%s%s is virtual."
|
||
msgstr "Arquivo %s%s%s é virtual."
|
||
|
||
#: lazarusidestrconsts.lisfilelinkerror
|
||
msgid "File link error"
|
||
msgstr "Erro vínculo arquivo"
|
||
|
||
#: lazarusidestrconsts.lisfilenameaddress
|
||
msgid "Filename/Address"
|
||
msgstr "Nome de arquivo/Endereço"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr "Arquivo não encontrado"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound2
|
||
msgid "File %s%s%s not found.%s"
|
||
msgstr "Arquivo %s%s%s não encontrado.%s"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
||
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
||
msgstr "Arquivo %s%s%s não encontrado.%sDeseja criá-lo?%s"
|
||
|
||
#: lazarusidestrconsts.lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr "Arquivo não está em minúsculo"
|
||
|
||
#: lazarusidestrconsts.lisfilenottext
|
||
msgid "File not text"
|
||
msgstr "Arquivo não é texto"
|
||
|
||
#: lazarusidestrconsts.lisfilesettings
|
||
msgid "File Settings ..."
|
||
msgstr "Configurações Arquivo ..."
|
||
|
||
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
||
msgid "Files in ASCII or UTF-8 encoding"
|
||
msgstr "Arquivos em ASCII ou codificação UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
||
msgid "Files not in ASCII nor UTF-8 encoding"
|
||
msgstr "Arquivos não está em ASCII nem na codificação UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr "arquivo, onde saída do depurador é escrita. Se não for especificado, a saída será para o console."
|
||
|
||
#: lazarusidestrconsts.lisfilter
|
||
msgid "Filter"
|
||
msgstr "Filtro"
|
||
|
||
#: lazarusidestrconsts.lisfilter2
|
||
msgid "(filter)"
|
||
msgstr "(filtro)"
|
||
|
||
#: lazarusidestrconsts.lisfiltersets
|
||
msgid "Filter Sets"
|
||
msgstr "Conjunto Filtros"
|
||
|
||
#: lazarusidestrconsts.lisfindfilecasesensitive
|
||
msgid "&Case sensitive"
|
||
msgstr "&Diferenciar maiúsc./minúsc."
|
||
|
||
#: lazarusidestrconsts.lisfindfiledirectoryoptions
|
||
msgid "Directory options"
|
||
msgstr "Opções de diretório"
|
||
|
||
#: lazarusidestrconsts.lisfindfilefilemaskbak
|
||
msgid "File mask (*;*.*;*.bak?)"
|
||
msgstr "Máscara de arquivo (*;*.*;*.bak?)"
|
||
|
||
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
||
msgid "Include sub directories"
|
||
msgstr "Incluir subdiretórios"
|
||
|
||
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr "Padrão linhas &múltiplas"
|
||
|
||
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr "Apenas arquivos texto"
|
||
|
||
#: lazarusidestrconsts.lisfindfileregularexpressions
|
||
msgid "&Regular expressions"
|
||
msgstr "Expressões ®ulares"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
||
msgid "search all files in &project"
|
||
msgstr "Localizar todos os arquivos no &projeto"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
||
msgid "search all &open files"
|
||
msgstr "Localizar todos &os arquivos abertos"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
||
msgid "search in &directories"
|
||
msgstr "Localizar nos &diretórios"
|
||
|
||
#: lazarusidestrconsts.lisfindfiletexttofind
|
||
msgid "Text to find:"
|
||
msgstr "Texto para localizar:"
|
||
|
||
#: lazarusidestrconsts.lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr "Onde"
|
||
|
||
#: lazarusidestrconsts.lisfindfilewholewordsonly
|
||
msgid "&Whole words only"
|
||
msgstr "&Somente palavras inteiras"
|
||
|
||
#: lazarusidestrconsts.lisfindkeycombination
|
||
msgid "Find key combination"
|
||
msgstr "Localizar combinação teclas"
|
||
|
||
#: lazarusidestrconsts.lisfindmissingunit
|
||
msgid "Find missing unit"
|
||
msgstr "Localizar unidade faltante"
|
||
|
||
#: lazarusidestrconsts.lisfirst
|
||
msgid "First"
|
||
msgstr "Primeiro"
|
||
|
||
#: lazarusidestrconsts.lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr "Corrigir arquivo LFM"
|
||
|
||
#: lazarusidestrconsts.lisfloatingpoin
|
||
msgid "Floating Point"
|
||
msgstr "Ponto Flutuante"
|
||
|
||
#: lazarusidestrconsts.lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr "Forçar renomeação"
|
||
|
||
#: lazarusidestrconsts.lisform
|
||
msgid "Form"
|
||
msgstr "Formulário"
|
||
|
||
#: lazarusidestrconsts.lisformaterror
|
||
msgid "Format error"
|
||
msgstr "Erro formatação"
|
||
|
||
#: lazarusidestrconsts.lisformloaderror
|
||
msgid "Form load error"
|
||
msgstr "Erro carga formulário"
|
||
|
||
#: lazarusidestrconsts.lisfpcmakefailed
|
||
msgid "fpcmake failed"
|
||
msgstr "\"fpcmake\" falhou"
|
||
|
||
#: lazarusidestrconsts.lisfpcomponents
|
||
msgctxt "lazarusidestrconsts.lisfpcomponents"
|
||
msgid "Components"
|
||
msgstr "Componentes"
|
||
|
||
#: lazarusidestrconsts.lisfpcresources
|
||
msgid "FPC resources"
|
||
msgstr "Recursos FPC"
|
||
|
||
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
|
||
msgid "FPC Source Directory error"
|
||
msgstr "Erro no diretório de Fonte FPC"
|
||
|
||
#: lazarusidestrconsts.lisfpctooold
|
||
msgid "FPC too old"
|
||
msgstr "FPC muito antigo"
|
||
|
||
#: lazarusidestrconsts.lisfpcversion
|
||
msgid "FPC Version: "
|
||
msgstr "Versão FPC:"
|
||
|
||
#: lazarusidestrconsts.lisfpcversioneg222
|
||
msgid "FPC Version (e.g. 2.2.2)"
|
||
msgstr "Versão FPC (ex. 2.2.2)"
|
||
|
||
#: lazarusidestrconsts.lisfpdoceditor
|
||
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
||
msgid "FPDoc Editor"
|
||
msgstr "Editor FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisfpfindpalettecomponent
|
||
msgid "Find palette component"
|
||
msgstr "Localizar componente da paleta"
|
||
|
||
#: lazarusidestrconsts.lisframe
|
||
msgid "Frame"
|
||
msgstr "Quadro com bordas"
|
||
|
||
#: lazarusidestrconsts.lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr "Localizar para &trás"
|
||
|
||
#: lazarusidestrconsts.lisfreepascal
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalcompilernotfound
|
||
msgid "Free Pascal Compiler not found"
|
||
msgstr "Compilador Free Pascal não encontrado"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
|
||
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
||
msgstr "programa freepascal usando \"TCustomApplication\" para verificar de forma fácil as opções de linha de comando, tratamento de exceções, etc. O arquivo do programa é mantido automaticamente pelo Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
||
msgid "Freepascal source directory"
|
||
msgstr "Diretório fonte do Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcefile
|
||
msgid "FreePascal source file"
|
||
msgstr "Arquivo fonte Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
|
||
msgid "Free Pascal Sources not found"
|
||
msgstr "Fontes do Free Pascal não encontrados"
|
||
|
||
#: lazarusidestrconsts.lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr "Localizar para fre&nte"
|
||
|
||
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr "Arquivos adicionais para localizar (ex: /path/*.pas;/path2/*.pp)"
|
||
|
||
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr "Localizar ou Renomear Identificador"
|
||
|
||
#: lazarusidestrconsts.lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr "Localizar Referências"
|
||
|
||
#: lazarusidestrconsts.lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr "Identificador: %s"
|
||
|
||
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr "em todos os pacotes e projetos abertos"
|
||
|
||
#: lazarusidestrconsts.lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr "na unidade atual"
|
||
|
||
#: lazarusidestrconsts.lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr "no projeto principal"
|
||
|
||
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr "no projeto/pacote proprietário da unidade atual"
|
||
|
||
#: lazarusidestrconsts.lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr "Identificador Inválido"
|
||
|
||
#: lazarusidestrconsts.lisfrirename
|
||
msgid "Rename"
|
||
msgstr "Renomear"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr "Renomear todas as Referências"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameto
|
||
msgid "Rename to"
|
||
msgstr "Renomear para"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr "Localizar também nos comentários"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchwhere
|
||
msgid "Search where"
|
||
msgstr "Localizar onde"
|
||
|
||
#: lazarusidestrconsts.lisfunction
|
||
msgid "Function"
|
||
msgstr "Função"
|
||
|
||
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
||
msgid "get word at current cursor position"
|
||
msgstr "obter palavra na posição atual do cursor"
|
||
|
||
#: lazarusidestrconsts.lisgotoline
|
||
msgid "Goto line"
|
||
msgstr "Ir para a linha"
|
||
|
||
#: lazarusidestrconsts.lisgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEstes fontes são software livre; você pode redistribuir e/ou modificá-los sob os termos da GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior. %sEste código é distribuído na esperança de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.%sVocê deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lisgroup
|
||
msgid "Group"
|
||
msgstr "Grupo"
|
||
|
||
#: lazarusidestrconsts.lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr "Aumentar para o maior"
|
||
|
||
#: lazarusidestrconsts.lishashelp
|
||
msgid "Has Help"
|
||
msgstr "Tem Ajuda"
|
||
|
||
#: lazarusidestrconsts.lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr "Cabeçalho de comentário para classe"
|
||
|
||
#: lazarusidestrconsts.lishelpentries
|
||
msgid "Help entries"
|
||
msgstr "Entradas da Ajuda"
|
||
|
||
#: lazarusidestrconsts.lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "Seletor de Ajuda"
|
||
|
||
#: lazarusidestrconsts.lishexadecimal
|
||
msgid "Hexadecimal"
|
||
msgstr "Hexadecimal"
|
||
|
||
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
||
msgid "Help for FreePascal Compiler message"
|
||
msgstr "Ajuda para mensagem do Compilador Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr "Dica: Verificar se dois pacotes contém uma unidade com o mesmo nome."
|
||
|
||
#: lazarusidestrconsts.lishintopen
|
||
msgctxt "lazarusidestrconsts.lishintopen"
|
||
msgid "Open"
|
||
msgstr "Abrir"
|
||
|
||
#: lazarusidestrconsts.lishintpause
|
||
msgctxt "lazarusidestrconsts.lishintpause"
|
||
msgid "Pause"
|
||
msgstr "Pausar"
|
||
|
||
#: lazarusidestrconsts.lishintrun
|
||
msgctxt "lazarusidestrconsts.lishintrun"
|
||
msgid "Run"
|
||
msgstr "Executar"
|
||
|
||
#: lazarusidestrconsts.lishintsave
|
||
msgctxt "lazarusidestrconsts.lishintsave"
|
||
msgid "Save"
|
||
msgstr "Salvar"
|
||
|
||
#: lazarusidestrconsts.lishintsaveall
|
||
msgid "Save all"
|
||
msgstr "Salvar tudo"
|
||
|
||
#: lazarusidestrconsts.lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr "Passar para"
|
||
|
||
#: lazarusidestrconsts.lishintstepout
|
||
msgid "Run until function returns"
|
||
msgstr "Executar até o retorno da função"
|
||
|
||
#: lazarusidestrconsts.lishintstepover
|
||
msgid "Step Over"
|
||
msgstr "Passar sobre"
|
||
|
||
#: lazarusidestrconsts.lishintstop
|
||
msgctxt "lazarusidestrconsts.lishintstop"
|
||
msgid "Stop"
|
||
msgstr "Parar"
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr "Dica: A função \"Make Resourcestring\" espera uma constante de sequência de caracteres.%sFavor selecionar a expressão e tentar novamente."
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
||
msgstr "Dica: A função \"Make Resourcestring\" espera uma constante de sequência de caracteres.%sFavor selecionar apenas uma expressão de deste tipo e tentar novamente."
|
||
|
||
#: lazarusidestrconsts.lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr "Alternar Formulário/Unidade"
|
||
|
||
#: lazarusidestrconsts.lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr "Exibir Formulários"
|
||
|
||
#: lazarusidestrconsts.lishintviewunits
|
||
msgid "View Units"
|
||
msgstr "Exibir Unidades"
|
||
|
||
#: lazarusidestrconsts.lishitcount
|
||
msgid "Hitcount"
|
||
msgstr "Conta acertos"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr "Banco de Dados"
|
||
|
||
#: lazarusidestrconsts.lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "Opções de Ajuda"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr "Propriedades:"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr "Visualizadores"
|
||
|
||
#: lazarusidestrconsts.lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr "Caminho do Doc HTML do FPC"
|
||
|
||
#: lazarusidestrconsts.lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr "Horizontal"
|
||
|
||
#: lazarusidestrconsts.liside
|
||
msgid "IDE"
|
||
msgstr "IDE"
|
||
|
||
#: lazarusidestrconsts.lisidebuildoptions
|
||
msgid "IDE build options"
|
||
msgstr "Opções construção IDE"
|
||
|
||
#: lazarusidestrconsts.lisideintf
|
||
msgid "IDE Interface"
|
||
msgstr "Interface IDE"
|
||
|
||
#: lazarusidestrconsts.lisidentifier
|
||
msgid "identifier"
|
||
msgstr "identificador"
|
||
|
||
#: lazarusidestrconsts.lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr "Identificadores começam com ..."
|
||
|
||
#: lazarusidestrconsts.lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr "Identificadores contêm ..."
|
||
|
||
#: lazarusidestrconsts.lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr "Opções da IDE:"
|
||
|
||
#: lazarusidestrconsts.lisideprojectdirinidetitle
|
||
msgid "Show project directory in IDE title"
|
||
msgstr "Mostrar diretório do projeto no título da IDE"
|
||
|
||
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
||
msgid "IDE title starts with project name"
|
||
msgstr "Título IDE começa com o nome do projeto"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroraccessingxml
|
||
msgid "Error accessing xml"
|
||
msgstr "Erro ao acessar XML"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
|
||
msgid "Error accessing xml file %s%s%s:%s%s"
|
||
msgstr "Erro ao acessar arquivo XML %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoerrorloadingxml
|
||
msgid "Error loading xml"
|
||
msgstr "Erro ao carregar XML"
|
||
|
||
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
|
||
msgid "Error loading xml file %s%s%s:%s%s"
|
||
msgstr "Erro ao carregar arquivo XML %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr "Arquivo exportado já existe"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr "Arquivo exportado %s%s%s já existe.%sAbrir arquivo e substituir somente as opções do compilador?%s(Outros ajustes serão mantidos.)"
|
||
|
||
#: lazarusidestrconsts.lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr "Carregar do arquivo"
|
||
|
||
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
|
||
msgid "Open or Load Compiler Options"
|
||
msgstr "Abrir ou carregar opções de compilador"
|
||
|
||
#: lazarusidestrconsts.lisiecoopenrecent
|
||
msgid "Open recent"
|
||
msgstr "Abrir recente"
|
||
|
||
#: lazarusidestrconsts.lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr "Arquivos recentes"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "Salvar para arquivo"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetorecent
|
||
msgid "Save to recent"
|
||
msgstr "Salvar no recente"
|
||
|
||
#: lazarusidestrconsts.lisifdok
|
||
msgctxt "lazarusidestrconsts.lisifdok"
|
||
msgid "OK"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts.lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr "Ignorar tudo"
|
||
|
||
#: lazarusidestrconsts.lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr "Ignorar e continuar"
|
||
|
||
#: lazarusidestrconsts.lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr "Ignorar binários"
|
||
|
||
#: lazarusidestrconsts.lisignoreexceptiontype
|
||
msgid "Ignore this exception type"
|
||
msgstr "Ignorar este tipo de exceção"
|
||
|
||
#: lazarusidestrconsts.lisignoremissingfile
|
||
msgid "Ignore missing file"
|
||
msgstr "Ignorar arquivo faltante"
|
||
|
||
#: lazarusidestrconsts.lisignoreusetformasancestor
|
||
msgid "Ignore, use TForm as ancestor"
|
||
msgstr "Ignorar, usar TForm como ancestral"
|
||
|
||
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
||
msgid "Imitate indentation of current unit, project or package"
|
||
msgstr "Seguir exemplo recuo da unidade atual, projeto ou pacote"
|
||
|
||
#: lazarusidestrconsts.lisimplementationcommentforclass
|
||
msgid "Implementation comment for class"
|
||
msgstr "Comentário implementação para classe"
|
||
|
||
#: lazarusidestrconsts.lisimportlist
|
||
msgid "Import list"
|
||
msgstr "Importar lista"
|
||
|
||
#: lazarusidestrconsts.lisimpossible
|
||
msgid "Impossible"
|
||
msgstr "Impossível"
|
||
|
||
#: lazarusidestrconsts.lisincludefilter
|
||
msgid "Include Filter"
|
||
msgstr "Filtro de Inclusão"
|
||
|
||
#: lazarusidestrconsts.lisincludepath
|
||
msgid "include path"
|
||
msgstr "caminho de inclusão"
|
||
|
||
#: lazarusidestrconsts.lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr "Caminhos de inclusão"
|
||
|
||
#: lazarusidestrconsts.lisindentation
|
||
msgid "Indentation"
|
||
msgstr "Recuo"
|
||
|
||
#: lazarusidestrconsts.lisindex
|
||
msgid "Index"
|
||
msgstr "Índice"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildabort
|
||
msgid "Aborted..."
|
||
msgstr "Abortado..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuildcaption
|
||
msgid "Compile Project"
|
||
msgstr "Compilar Projeto"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildcomplile
|
||
msgid "Compiling..."
|
||
msgstr "Compilando..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuilderror
|
||
msgid "Error..."
|
||
msgstr "Erro..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuilderrors
|
||
msgid "Errors:"
|
||
msgstr "Erros:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildhint
|
||
msgid "Hints:"
|
||
msgstr "Dicas:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildlines
|
||
msgctxt "lazarusidestrconsts.lisinfobuildlines"
|
||
msgid "Lines:"
|
||
msgstr "Linhas:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildmakeabort
|
||
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
|
||
msgid "Abort"
|
||
msgstr "Abortar"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildnote
|
||
msgid "Notes:"
|
||
msgstr "Notas:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildproject
|
||
msgid "Project:"
|
||
msgstr "Projeto:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildsuccess
|
||
msgid "Success..."
|
||
msgstr "Sucesso..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuildwarning
|
||
msgid "Warnings:"
|
||
msgstr "Avisos:"
|
||
|
||
#: lazarusidestrconsts.lisinformation
|
||
msgid "Information"
|
||
msgstr "Informação"
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr "Informação sobre %s"
|
||
|
||
#: lazarusidestrconsts.lisinfrontofrelated
|
||
msgid "In front of related"
|
||
msgstr "Na frente do relacionado"
|
||
|
||
#: lazarusidestrconsts.lisinheritedcomponent
|
||
msgid "Inherited Component"
|
||
msgstr "Componente Herdado"
|
||
|
||
#: lazarusidestrconsts.lisinheriteditem
|
||
msgid "Inherited Item"
|
||
msgstr "Item herdado"
|
||
|
||
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
||
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
||
msgstr "Com o propósito de criar uma cópia \"limpa\" do projeto/pacote, todos os arquivos no seguinte diretório serão excluídos e todo o seu conteúdo será perdido.%s%sExcluir todos os arquivos em %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisinsertdate
|
||
msgid "insert date"
|
||
msgstr "inserir data"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtime
|
||
msgid "insert date and time"
|
||
msgstr "inserir data e hora"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
||
msgid "Insert date and time. Optional: format string"
|
||
msgstr "Inserir data e hora. Opcional: seq.caracteres formatação"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
||
msgid "Insert date. Optional: format string"
|
||
msgstr "Inserir data. Opcional: seq.caracteres formatação"
|
||
|
||
#: lazarusidestrconsts.lisinsertendifneeded
|
||
msgid "insert end if needed"
|
||
msgstr "inserir fim se necessário"
|
||
|
||
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
||
msgid "Insert name of current procedure"
|
||
msgstr "inserir nome do procedimento atual"
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag
|
||
msgid "Insert PrintShort tag"
|
||
msgstr "Inserir \"tag PrintShort\""
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag2
|
||
msgid "Insert printshort tag"
|
||
msgstr "Inserir \"tag printshort\""
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurehead
|
||
msgid "insert procedure head"
|
||
msgstr "inserir cabeçalho procedimento"
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurename
|
||
msgid "insert procedure name"
|
||
msgstr "inserir nome procedimento"
|
||
|
||
#: lazarusidestrconsts.lisinserttime
|
||
msgid "insert time"
|
||
msgstr "inserir hora"
|
||
|
||
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
||
msgid "Insert time. Optional: format string"
|
||
msgstr "Inserir hora. Opcional: seq.caracteres formatação"
|
||
|
||
#: lazarusidestrconsts.lisinserturltag
|
||
msgid "Insert url tag"
|
||
msgstr "Inserir \"tag\" url"
|
||
|
||
#: lazarusidestrconsts.lisinspect
|
||
msgid "&Inspect"
|
||
msgstr "&Inspecionar"
|
||
|
||
#: lazarusidestrconsts.lisinspectdata
|
||
msgid "Data"
|
||
msgstr "Dados"
|
||
|
||
#: lazarusidestrconsts.lisinspectdialog
|
||
msgid "Debug Inspector"
|
||
msgstr "Inspetor do Depurador"
|
||
|
||
#: lazarusidestrconsts.lisinspectmethods
|
||
msgid "Methods"
|
||
msgstr "Métodos"
|
||
|
||
#: lazarusidestrconsts.lisinspectproperties
|
||
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
||
msgid "Properties"
|
||
msgstr "Propriedades"
|
||
|
||
#: lazarusidestrconsts.lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr "Falha na instalação"
|
||
|
||
#: lazarusidestrconsts.lisinstalledpackages
|
||
msgid "Installed Packages"
|
||
msgstr "Pacotes Instalados"
|
||
|
||
#: lazarusidestrconsts.lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "Instalar Seleção"
|
||
|
||
#: lazarusidestrconsts.lisinvalidbuildvarthebuildvarmustbeapascalidentifie
|
||
msgid "Invalid build variable %s%s%s. The build variable must be a pascal identifier."
|
||
msgstr "Variável construção inválida %s%s%s. A variável construção deve ser um identificador pascal."
|
||
|
||
#: lazarusidestrconsts.lisinvalidcircle
|
||
msgid "Invalid circle"
|
||
msgstr "Referência circular inválida"
|
||
|
||
#: lazarusidestrconsts.lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr "Comando inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidcompilerfilename
|
||
msgid "Invalid Compiler Filename"
|
||
msgstr "Nome de arquivo do compilador inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr "Exclusão inválida"
|
||
|
||
#: lazarusidestrconsts.lisinvaliddestinationdirectory
|
||
msgid "Invalid destination directory"
|
||
msgstr "Diretório de destino inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpression
|
||
msgid "Invalid expression:%s%s%s%s"
|
||
msgstr "Expressão inválida: %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr "Expressão inválida.%sDica: A função \"Make Resourcestring\" espera uma constante de sequência de caracteres em um arquivo único. Favor selecionar a expressão e tentar novamente."
|
||
|
||
#: lazarusidestrconsts.lisinvalidfilter
|
||
msgid "Invalid filter"
|
||
msgstr "Filtro inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
|
||
msgid "Invalid Free Pascal source directory"
|
||
msgstr "Diretório fonte do Free Pascal inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr "Multi-seleção inválida"
|
||
|
||
#: lazarusidestrconsts.lisinvalidoff
|
||
msgid "Invalid (Off)"
|
||
msgstr "Inválido (Desligado)"
|
||
|
||
#: lazarusidestrconsts.lisinvalidon
|
||
msgid "Invalid (On)"
|
||
msgstr "Inválido (Ligado)"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr "Identificador Pascal inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
||
msgid "The name \"%s\" is not a valid pascal identifier."
|
||
msgstr "O nome \"%s\" não é um identificador Pascal válido."
|
||
|
||
#: lazarusidestrconsts.lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr "\"Proc name\" inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr "Nome do arquivo de projeto inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
||
msgid "Invalid publishing Directory"
|
||
msgstr "Diretório de publicação inválido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr "Seleção inválida"
|
||
|
||
#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
|
||
msgid "%s is a group. A setting can only be added to normal build modes."
|
||
msgstr "%s é um grupo. Um ajuste pode ser adicionado apenas aos modos normais contrução"
|
||
|
||
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s já faz parte do Projeto."
|
||
|
||
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "%s%s%s é um nome de projeto inválido.%sFavor escolher outro nome (ex. projeto1.lpi)"
|
||
|
||
#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
|
||
msgid "%s is a %s.%sThis circle dependency is not allowed."
|
||
msgstr "%s é um %s.%sEsta dependência circular não é permitida."
|
||
|
||
#: lazarusidestrconsts.lisjhjumphistory
|
||
msgid "Jump History"
|
||
msgstr "Saltar para Histórico"
|
||
|
||
#: lazarusidestrconsts.lisjitform
|
||
msgid "JIT Form"
|
||
msgstr "Formulário \"JIT\""
|
||
|
||
#: lazarusidestrconsts.liskeep
|
||
msgid "keep"
|
||
msgstr "mantém"
|
||
|
||
#: lazarusidestrconsts.liskeepname
|
||
msgid "Keep name"
|
||
msgstr "Manter nome"
|
||
|
||
#: lazarusidestrconsts.liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr "Mantê-los e continuar"
|
||
|
||
#: lazarusidestrconsts.liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr "Comandos personalizados"
|
||
|
||
#: lazarusidestrconsts.liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr "Comandos do Editor"
|
||
|
||
#: lazarusidestrconsts.liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr "Comandos do Inspetor de Objetos"
|
||
|
||
#: lazarusidestrconsts.liskeyor2keysequence
|
||
msgid "Key (or 2 key sequence)"
|
||
msgstr "Tecla (ou sequência de 2 teclas)"
|
||
|
||
#: lazarusidestrconsts.liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "Abortar construção"
|
||
|
||
#: lazarusidestrconsts.liskmaddactiveunittoproject
|
||
msgid "Add active unit to project"
|
||
msgstr "Adicionar unidade ativa ao projeto"
|
||
|
||
#: lazarusidestrconsts.liskmaddwatch
|
||
msgid "Add watch"
|
||
msgstr "Adicionar observador"
|
||
|
||
#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
|
||
msgid "Build all files of project/program"
|
||
msgstr "Construir todos os arquivos do projeto/programa"
|
||
|
||
#: lazarusidestrconsts.liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr "Construir projeto/programa"
|
||
|
||
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr "Escolha o esquema de mapeamento de teclas"
|
||
|
||
#: lazarusidestrconsts.liskmclassic
|
||
msgid "Classic"
|
||
msgstr "Clássico"
|
||
|
||
#: lazarusidestrconsts.liskmcloseall
|
||
msgid "Close All"
|
||
msgstr "Fechar tudo"
|
||
|
||
#: lazarusidestrconsts.liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "Fechar projeto"
|
||
|
||
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr "Editor definições das Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.liskmcodetoolsoptions
|
||
msgid "CodeTools options"
|
||
msgstr "Opções das ferramentas de código"
|
||
|
||
#: lazarusidestrconsts.liskmcompileroptions
|
||
msgid "Compiler options"
|
||
msgstr "Opções do compilador"
|
||
|
||
#: lazarusidestrconsts.liskmconfigbuildfile
|
||
msgid "Config %sBuild File%s"
|
||
msgstr "Configurar %sConstruir Arquivo%s"
|
||
|
||
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
||
msgid "Configure custom components"
|
||
msgstr "Configurar componentes personalizados"
|
||
|
||
#: lazarusidestrconsts.liskmconfigurehelp
|
||
msgid "Configure Help"
|
||
msgstr "Configurar Ajuda"
|
||
|
||
#: lazarusidestrconsts.liskmconfigureinstalledpackages
|
||
msgid "Configure installed packages"
|
||
msgstr "Configurar pacotes instalados"
|
||
|
||
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr "Ajuda contextual"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr "Converter pacote Delphi para Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
||
msgid "Convert Delphi project to Lazarus project"
|
||
msgstr "Converter Projeto Delphi para Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
||
msgid "Convert Delphi unit to Lazarus unit"
|
||
msgstr "Converter Unidade Delphi para Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
||
msgid "Convert DFM file to LFM"
|
||
msgstr "Converter arquivo DFM para LFM"
|
||
|
||
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
||
msgid "Copy selected Components to clipboard"
|
||
msgstr "Copiar componentes selecionados para a Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
||
msgid "Cut selected Components to clipboard"
|
||
msgstr "Recortar componentes selecionados para a Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr "Excluir último caractere"
|
||
|
||
#: lazarusidestrconsts.liskmdiffeditorfiles
|
||
msgid "Diff editor files"
|
||
msgstr "Comparar arquivos do editor"
|
||
|
||
#: lazarusidestrconsts.liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr "Editar modelos de código"
|
||
|
||
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr "Editar ajuda contextual"
|
||
|
||
#: lazarusidestrconsts.liskmeditoroptions
|
||
msgctxt "lazarusidestrconsts.liskmeditoroptions"
|
||
msgid "Editor options"
|
||
msgstr "Opções do editor"
|
||
|
||
#: lazarusidestrconsts.liskmencloseselection
|
||
msgid "Enclose selection"
|
||
msgstr "Circundar seleção"
|
||
|
||
#: lazarusidestrconsts.liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr "Avaliar/Modificar"
|
||
|
||
#: lazarusidestrconsts.liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr "Configurar Ferramentas Externas"
|
||
|
||
#: lazarusidestrconsts.liskmfindincremental
|
||
msgid "Find incremental"
|
||
msgstr "Localização incremental"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker0
|
||
msgid "Go to marker 0"
|
||
msgstr "Ir para marcador 0"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker1
|
||
msgid "Go to marker 1"
|
||
msgstr "Ir para marcador 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker2
|
||
msgid "Go to marker 2"
|
||
msgstr "Ir para marcador 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker3
|
||
msgid "Go to marker 3"
|
||
msgstr "Ir para marcador 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker4
|
||
msgid "Go to marker 4"
|
||
msgstr "Ir para marcador 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker5
|
||
msgid "Go to marker 5"
|
||
msgstr "Ir para marcador 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker6
|
||
msgid "Go to marker 6"
|
||
msgstr "Ir para marcador 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker7
|
||
msgid "Go to marker 7"
|
||
msgstr "Ir para marcador 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker8
|
||
msgid "Go to marker 8"
|
||
msgstr "Ir para marcador 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker9
|
||
msgid "Go to marker 9"
|
||
msgstr "Ir para marcador 9"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr "Ir para editor fonte 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr "Ir para editor fonte 10"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr "Ir para editor fonte 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr "Ir para editor fonte 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr "Ir para editor fonte 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr "Ir para editor fonte 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr "Ir para editor fonte 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr "Ir para editor fonte 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr "Ir para editor fonte 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr "Ir para editor fonte 9"
|
||
|
||
#: lazarusidestrconsts.liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr "Inserir data e hora"
|
||
|
||
#: lazarusidestrconsts.liskminsertifdef
|
||
msgid "Insert $IFDEF"
|
||
msgstr "Inserir $IFDEF"
|
||
|
||
#: lazarusidestrconsts.liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr "Inserir nome de usuário"
|
||
|
||
#: lazarusidestrconsts.liskminspect
|
||
msgid "Inspect"
|
||
msgstr "Inspecionar"
|
||
|
||
#: lazarusidestrconsts.liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr "Esquema de mapeamento de teclas"
|
||
|
||
#: lazarusidestrconsts.liskmlazarusdefault
|
||
msgid "Lazarus (default)"
|
||
msgstr "Lazarus (padrão)"
|
||
|
||
#: lazarusidestrconsts.liskmmacosxapple
|
||
msgid "Mac OS X (Apple style)"
|
||
msgstr "Mac OS X (estilo Apple)"
|
||
|
||
#: lazarusidestrconsts.liskmmacosxlaz
|
||
msgid "Mac OS X (Lazarus style)"
|
||
msgstr "Mac OS X (estilo Lazarus)"
|
||
|
||
#: lazarusidestrconsts.liskmnewpackage
|
||
msgid "New package"
|
||
msgstr "Novo pacote"
|
||
|
||
#: lazarusidestrconsts.liskmnewproject
|
||
msgid "New project"
|
||
msgstr "Novo projeto"
|
||
|
||
#: lazarusidestrconsts.liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr "Novo projeto do arquivo"
|
||
|
||
#: lazarusidestrconsts.liskmnewunit
|
||
msgctxt "lazarusidestrconsts.liskmnewunit"
|
||
msgid "New Unit"
|
||
msgstr "Nova Unidade"
|
||
|
||
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
||
msgid "Note: All keys will be set to the values of the chosen scheme."
|
||
msgstr "Nota: Todas as teclas serão ajustadas para os valores do esquema escolhido."
|
||
|
||
#: lazarusidestrconsts.liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr "Abrir arquivo de pacote"
|
||
|
||
#: lazarusidestrconsts.liskmpackagegraph
|
||
msgid "Package graph"
|
||
msgstr "Gráfico pacotes"
|
||
|
||
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
||
msgid "Paste Components from clipboard"
|
||
msgstr "Colar componentes da Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr "Pausar programa"
|
||
|
||
#: lazarusidestrconsts.liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr "Publicar projeto"
|
||
|
||
#: lazarusidestrconsts.liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr "Compilação rápida, sem vinculação"
|
||
|
||
#: lazarusidestrconsts.liskmremoveactiveunitfromproject
|
||
msgid "Remove active unit from project"
|
||
msgstr "Remover unidade ativa do projeto"
|
||
|
||
#: lazarusidestrconsts.liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr "Executar programa"
|
||
|
||
#: lazarusidestrconsts.liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "SalvarTudo"
|
||
|
||
#: lazarusidestrconsts.liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "SalvarComo"
|
||
|
||
#: lazarusidestrconsts.liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "Salvar projeto"
|
||
|
||
#: lazarusidestrconsts.liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "Salvar projeto como"
|
||
|
||
#: lazarusidestrconsts.liskmselectlineend
|
||
msgid "Select line end"
|
||
msgstr "Selecionar fim linha"
|
||
|
||
#: lazarusidestrconsts.liskmselectlinestart
|
||
msgid "Select line start"
|
||
msgstr "Selecionar início linha"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagebottom
|
||
msgid "Select page bottom"
|
||
msgstr "Selecionar fundo da página"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagetop
|
||
msgid "Select page top"
|
||
msgstr "Selecionar topo da página"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordleft
|
||
msgid "Select word left"
|
||
msgstr "Selecionar palavra a esquerda"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordright
|
||
msgid "Select word right"
|
||
msgstr "Selecionar palavra a direita"
|
||
|
||
#: lazarusidestrconsts.liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr "Ajustar Marcador livre"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker0
|
||
msgid "Set marker 0"
|
||
msgstr "Ajustar marcador 0"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker1
|
||
msgid "Set marker 1"
|
||
msgstr "Ajustar marcador 1"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker2
|
||
msgid "Set marker 2"
|
||
msgstr "Ajustar marcador 2"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker3
|
||
msgid "Set marker 3"
|
||
msgstr "Ajustar marcador 3"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker4
|
||
msgid "Set marker 4"
|
||
msgstr "Ajustar marcador 4"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker5
|
||
msgid "Set marker 5"
|
||
msgstr "Ajustar marcador 5"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker6
|
||
msgid "Set marker 6"
|
||
msgstr "Ajustar marcador 6"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker7
|
||
msgid "Set marker 7"
|
||
msgstr "Ajustar marcador 7"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker8
|
||
msgid "Set marker 8"
|
||
msgstr "Ajustar marcador 8"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker9
|
||
msgid "Set marker 9"
|
||
msgstr "Ajustar marcador 9"
|
||
|
||
#: lazarusidestrconsts.liskmstopprogram
|
||
msgid "Stop program"
|
||
msgstr "Parar programa"
|
||
|
||
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr "Alternar Unidade/Formulário"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker0
|
||
msgid "Toggle marker 0"
|
||
msgstr "Alternar marcador 0"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker1
|
||
msgid "Toggle marker 1"
|
||
msgstr "Alternar marcador 1"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker2
|
||
msgid "Toggle marker 2"
|
||
msgstr "Alternar marcador 2"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker3
|
||
msgid "Toggle marker 3"
|
||
msgstr "Alternar marcador 3"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker4
|
||
msgid "Toggle marker 4"
|
||
msgstr "Alternar marcador 4"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker5
|
||
msgid "Toggle marker 5"
|
||
msgstr "Alternar marcador 5"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker6
|
||
msgid "Toggle marker 6"
|
||
msgstr "Alternar marcador 6"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker7
|
||
msgid "Toggle marker 7"
|
||
msgstr "Alternar marcador 7"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker8
|
||
msgid "Toggle marker 8"
|
||
msgstr "Alternar marcador 8"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker9
|
||
msgid "Toggle marker 9"
|
||
msgstr "Alternar marcador 9"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewassembler
|
||
msgid "Toggle view Assembler"
|
||
msgstr "Alternar exibição Assembler"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
||
msgid "Toggle view Breakpoints"
|
||
msgstr "Alternar exibição pontos de parada"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
||
msgid "Toggle view Call Stack"
|
||
msgstr "Alternar exibição chamada de pilha"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr "Alternar exibição explorador de código"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
||
msgid "Toggle view component palette"
|
||
msgstr "Alternar exibição paleta de componentes"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
||
msgid "Toggle view Debuger Event Log"
|
||
msgstr "Alternar exibição Histórico Eventos Depuração"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
||
msgid "Toggle view Debugger Output"
|
||
msgstr "Alternar exibição Saída do Depurador"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr "Alternar exibição Editor de Documentação"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr "Alternar exibição botões da IDE"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
||
msgid "Toggle view Local Variables"
|
||
msgstr "Alternar exibição Variáveis Locais"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr "Alternar exibição Mensagens"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr "Alternar exibição Inspetor de Objetos"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewregisters
|
||
msgid "Toggle view Registers"
|
||
msgstr "Alternar exibição Registradores"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr "Alternar exibição Resultados de Pesquisa"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr "Alternar exibição Editor Código"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewwatches
|
||
msgid "Toggle view Watches"
|
||
msgstr "Alternar exibição Observadores"
|
||
|
||
#: lazarusidestrconsts.liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr "Exibir histórico de saltos"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr "Exibir opções de projeto"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectsource
|
||
msgid "View project source"
|
||
msgstr "Exibir fonte do projeto"
|
||
|
||
#: lazarusidestrconsts.liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr "Exibir informações da unidade"
|
||
|
||
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr "Aplicação iniciando inválida"
|
||
|
||
#: lazarusidestrconsts.lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr "Iniciando linha de comando alvo"
|
||
|
||
#: lazarusidestrconsts.lislazarusdesktopsettings
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr "Configurações da Área de Trabalho do Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr "Diretório Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectorynotfound
|
||
msgid "Lazarus directory not found"
|
||
msgstr "Diretório Lazarus não encontrado"
|
||
|
||
#: lazarusidestrconsts.lislazarusdiroverride
|
||
msgid "directory, to be used as a basedirectory"
|
||
msgstr "diretório para ser usado como diretório base"
|
||
|
||
#: lazarusidestrconsts.lislazaruseditorv
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr "Lazarus IDE v%s"
|
||
|
||
#: lazarusidestrconsts.lislazarusfile
|
||
msgid "Lazarus File"
|
||
msgstr "Arquivo Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusform
|
||
msgid "Lazarus form"
|
||
msgstr "Formulário Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr "IDE do Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusinclude
|
||
msgid "Lazarus include file"
|
||
msgstr "Arquivo de inclusões Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr "ID de idioma do Lazarus (ex. en, de, br, fi)"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr "Nome de idioma do Lazarus (ex. inglês, alemão)"
|
||
|
||
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr "lazarus [opções] <nome-de-arquivo-do-projeto>"
|
||
|
||
#: lazarusidestrconsts.lislazaruspackage
|
||
msgid "Lazarus package"
|
||
msgstr "Pacote Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusproject
|
||
msgid "Lazarus project"
|
||
msgstr "Projeto Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusprojectinfofile
|
||
msgid "Lazarus Project Info file"
|
||
msgstr "Arquivo de informações de Projeto Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusprojectsource
|
||
msgid "Lazarus project source"
|
||
msgstr "Fonte de Projeto Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusunit
|
||
msgid "Lazarus unit"
|
||
msgstr "Unidade Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazbuildaboaction
|
||
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
||
msgid "Action"
|
||
msgstr "Ação"
|
||
|
||
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr "Escolha o diretório de saída do executável da IDE"
|
||
|
||
#: lazarusidestrconsts.lislazbuildabopart
|
||
msgid "Part"
|
||
msgstr "Parte"
|
||
|
||
#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
|
||
msgid "Advanced Build Options"
|
||
msgstr "Opções Avançadas Construção"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuild
|
||
msgctxt "lazarusidestrconsts.lislazbuildbuild"
|
||
msgid "Build"
|
||
msgstr "Construir"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildcodetools
|
||
msgid "Build CodeTools"
|
||
msgstr "Construir Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
|
||
msgid "Build components (SynEdit, CodeTools)"
|
||
msgstr "Construir componentes (SynEdit, Ferramentas de Código)"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildexamples
|
||
msgid "Build examples"
|
||
msgstr "Construir exemplos"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildide
|
||
msgid "Build IDE"
|
||
msgstr "Construir IDE"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildjitform
|
||
msgid "Build JITForm"
|
||
msgstr "Construir JITForm"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildoptions
|
||
msgid "Build Options"
|
||
msgstr "Opções Construção"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildsynedit
|
||
msgid "Build SynEdit"
|
||
msgstr "Construir SynEdit"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcancel
|
||
msgctxt "lazarusidestrconsts.lislazbuildcancel"
|
||
msgid "Cancel"
|
||
msgstr "Cancelar"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcleanall
|
||
msgid "Clean all"
|
||
msgstr "Limpeza Total (Clean all)"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcleanbuild
|
||
msgid "Clean+Build"
|
||
msgstr "Limpar+Construir"
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
||
msgid "Confirm before rebuilding Lazarus"
|
||
msgstr "Confirmar antes de reconstruir o Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Erro escrevendo arquivo"
|
||
|
||
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
||
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
||
msgstr "%s%s%s%s\"lazbuild\" não é interativo, abortando agora."
|
||
|
||
#: lazarusidestrconsts.lislazbuildlclinterface
|
||
msgid "LCL interface"
|
||
msgstr "Interface LCL"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnone
|
||
msgctxt "lazarusidestrconsts.lislazbuildnone"
|
||
msgid "None"
|
||
msgstr "Nenhum"
|
||
|
||
#: lazarusidestrconsts.lislazbuildok
|
||
msgctxt "lazarusidestrconsts.lislazbuildok"
|
||
msgid "Ok"
|
||
msgstr "Ok"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr "Opções:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqboapplcltarget
|
||
msgid "Target"
|
||
msgstr "Alvo"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildall
|
||
msgid "Build All"
|
||
msgstr "Construir Tudo"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
|
||
msgid "Build IDE without Packages"
|
||
msgstr "Construir IDE sem Pacotes"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
|
||
msgid "Build IDE with Packages"
|
||
msgstr "Construir IDE com Pacotes"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildlcl
|
||
msgid "Build LCL"
|
||
msgstr "Construir LCL"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildother
|
||
msgctxt "lazarusidestrconsts.lislazbuildqbobuildother"
|
||
msgid "Other"
|
||
msgstr "Outros"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
|
||
msgid "Clean Up + Build all"
|
||
msgstr "Limpar + Construir tudo"
|
||
|
||
#: lazarusidestrconsts.lislazbuildquickbuildoptions
|
||
msgid "Quick Build Options"
|
||
msgstr "Opções Rápidas de Construção"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
||
msgid "Restart after successful Build"
|
||
msgstr "Reiniciar após construir com sucesso"
|
||
|
||
#: lazarusidestrconsts.lislazbuildsavesettings
|
||
msgid "Save settings"
|
||
msgstr "Salvar ajustes"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr "CPU Alvo:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr "Diretório alvo:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr "SO Alvo:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr "Impossível escrever arquivo \"%s\":%s"
|
||
|
||
#: lazarusidestrconsts.lislazbuildwithstaticpackages
|
||
msgid "With packages"
|
||
msgstr "Com pacotes"
|
||
|
||
#: lazarusidestrconsts.lislcl
|
||
msgid "LCL"
|
||
msgstr "LCL"
|
||
|
||
#: lazarusidestrconsts.lislclunitpathmissing
|
||
msgid "LCL unit path missing"
|
||
msgstr "Caminho de unidade LCL faltando"
|
||
|
||
#: lazarusidestrconsts.lislclwidgettype
|
||
msgid "LCL Widget Type"
|
||
msgstr "Tipo \"Widget\" LCL"
|
||
|
||
#: lazarusidestrconsts.lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr "Adicionar vínculo ao herdado"
|
||
|
||
#: lazarusidestrconsts.lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr "Copiar do herdado"
|
||
|
||
#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
||
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr "%s não possui um caminho \"LazDoc\" válido.%sImpossível criar arquivo \"fpdoc\" para %s"
|
||
|
||
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr "Mover entradas para herdado"
|
||
|
||
#: lazarusidestrconsts.lisldnovalidlazdocpath
|
||
msgid "No valid LazDoc path"
|
||
msgstr "Nenhum caminho \"LazDoc\" válido"
|
||
|
||
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr "A unidade %s não é propriedade de nenhum pacote ou projeto.%sFavor adicionar a unidade a um pacote ou projeto.%sImpossível criar o arquivo \"fpdoc\"."
|
||
|
||
#: lazarusidestrconsts.lisleaveemptyfo
|
||
msgid "Leave empty for default .po file"
|
||
msgstr "Deixar vazio por padrão o arquivo .po"
|
||
|
||
#: lazarusidestrconsts.lisleft
|
||
msgctxt "lazarusidestrconsts.lisleft"
|
||
msgid "Left"
|
||
msgstr "Esquefa"
|
||
|
||
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr "Espaço da borda esquerda. Este valor será adicionado a base do espaço da borda e usado para o espaço esquerdo do controle."
|
||
|
||
#: lazarusidestrconsts.lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr "Ancoragem a esquerda"
|
||
|
||
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
||
msgstr "Este é o controle irmão ao qual o lado esquerdo está ancorado. Deixar vazio para o controle-pai."
|
||
|
||
#: lazarusidestrconsts.lisleftsides
|
||
msgid "Left sides"
|
||
msgstr "Lados Esquerdos"
|
||
|
||
#: lazarusidestrconsts.lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr "Justificar a esquerda"
|
||
|
||
#: lazarusidestrconsts.lislevels
|
||
msgid "Levels"
|
||
msgstr "Níveis"
|
||
|
||
#: lazarusidestrconsts.lislfmfile
|
||
msgid "LFM file"
|
||
msgstr "Arquivo LFM"
|
||
|
||
#: lazarusidestrconsts.lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr "Arquivo LFM corrompido"
|
||
|
||
#: lazarusidestrconsts.lislfmisok
|
||
msgid "LFM is ok"
|
||
msgstr "LFM está ok"
|
||
|
||
#: lazarusidestrconsts.lislgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEsta biblioteca é software livre; você pode redistribuí-la e/ou modificá-la sob os termos da GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior. %sEste programa é distribuido na esperanca de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.%sVocê deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
|
||
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
||
msgstr "Biblioteca%sUma biblioteca Free Pascal (.dll sobre windows, .so sobre linux, .dylib sobre macosx). O arquivo fonte da biblioteca é automaticamente mantido pelo Lazarus."
|
||
|
||
#: lazarusidestrconsts.lislibrarypath
|
||
msgid "library path"
|
||
msgstr "caminho biblioteca."
|
||
|
||
#: lazarusidestrconsts.lisline
|
||
msgid "Line:"
|
||
msgstr "Linha:"
|
||
|
||
#: lazarusidestrconsts.lislinelength
|
||
msgid "Line/Length"
|
||
msgstr "Linha/Comprimento"
|
||
|
||
#: lazarusidestrconsts.lislink
|
||
msgid "Link:"
|
||
msgstr "Vínculo:"
|
||
|
||
#: lazarusidestrconsts.lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr "Opções do Vinculador"
|
||
|
||
#: lazarusidestrconsts.lislinktarget
|
||
msgid "Link target"
|
||
msgstr "Alvo vínculo"
|
||
|
||
#: lazarusidestrconsts.lislistofallcasevalues
|
||
msgid "list of all case values"
|
||
msgstr "lista de todos os valores \"case\""
|
||
|
||
#: lazarusidestrconsts.lisloadingfailed
|
||
msgid "Loading %s failed."
|
||
msgstr "Carga %s falhou."
|
||
|
||
#: lazarusidestrconsts.lislocals
|
||
msgid "Locals"
|
||
msgstr "Locais"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgname
|
||
msgctxt "lazarusidestrconsts.lislocalsdlgname"
|
||
msgid "Name"
|
||
msgstr "Nome"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgvalue
|
||
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
|
||
msgid "Value"
|
||
msgstr "Valor"
|
||
|
||
#: lazarusidestrconsts.lislogmessage
|
||
msgid "Log message"
|
||
msgstr "Mensagem registro"
|
||
|
||
#: lazarusidestrconsts.lislogo
|
||
msgid "Logo"
|
||
msgstr "Logotipo"
|
||
|
||
#: lazarusidestrconsts.lislowercasestring
|
||
msgid "lowercase string"
|
||
msgstr "Seq.caracteres minúsculas"
|
||
|
||
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
||
msgid "Lowercase string given as parameter"
|
||
msgstr "Seq.caracteres minúsculas dada como parâmetro"
|
||
|
||
#: lazarusidestrconsts.lislrsincludefiles
|
||
msgid "lrs include files"
|
||
msgstr "Arquivos inclusão lrs"
|
||
|
||
#: lazarusidestrconsts.lismacpascal
|
||
msgid "Mac Pascal"
|
||
msgstr "Mac Pascal"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr "Inserir Dados"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr "Inserir parâmetros de execução"
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
||
msgid "Main Unit has Application.CreateForm statements"
|
||
msgstr "Unidade principal tem declarações \"Application.CreateForm\""
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
|
||
msgid "Main Unit has Application.Title statements"
|
||
msgstr "Unidade principal tem declarações \"Application.Title\""
|
||
|
||
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
||
msgid "Main Unit has Uses Section containing all Units of project"
|
||
msgstr "Unidade principal tem Seção \"Uses\" contendo todas as unidades do projeto"
|
||
|
||
#: lazarusidestrconsts.lismainunitispascalsource
|
||
msgid "Main Unit is Pascal Source"
|
||
msgstr "Unidade principal é Fonte Pascal"
|
||
|
||
#: lazarusidestrconsts.lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr "Gerar Executável"
|
||
|
||
#: lazarusidestrconsts.lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr "\"Make\" não encontrado"
|
||
|
||
#: lazarusidestrconsts.lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr "Criar recurso de sequência de caracteres"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "Adicionar a seção"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
||
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr "O recurso de sequência de caracteres %s%s%s já existe.%sFavor escolher outro nome.%sUse Ignorar para adicionar assim mesmo."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr "Opções de Conversão"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr "Identificador Personalizado"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
||
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Identificador"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr "Comprimento identificador:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr "Prefixo identificador:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr "Inserir alfabeticamente"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr "Inserir contexto sensível"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr "Seção Recurso de sequência de carac. inválida"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr "Favor escolher um seção de recurso de sequência de caracteres da lista."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr "Recurso de sequência de carac. já existe"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr "Seção Recurso sequência caracteres:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr "Visualizar fonte"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr "Constante de sequência de caracteres no fonte"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr "Sequências de carac. com o mesmo valor:"
|
||
|
||
#: lazarusidestrconsts.lismaxs
|
||
msgid "Max %d"
|
||
msgstr "Máximo %d"
|
||
|
||
#: lazarusidestrconsts.lismemorydump
|
||
msgid "Memory Dump"
|
||
msgstr "Despejo Memória"
|
||
|
||
#: lazarusidestrconsts.lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "Abortar Construção"
|
||
|
||
#: lazarusidestrconsts.lismenuaddbpsource
|
||
msgid "Source breakpoint"
|
||
msgstr "Ponto de parada no fonte"
|
||
|
||
#: lazarusidestrconsts.lismenuaddbreakpoint
|
||
msgid "Add breakpoint"
|
||
msgstr "Adicionar ponto de parada"
|
||
|
||
#: lazarusidestrconsts.lismenuaddcurunittopkg
|
||
msgid "Add active unit to a package"
|
||
msgstr "Adicionar unidade ativa a um pacote"
|
||
|
||
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
||
msgid "Add jump point to history"
|
||
msgstr "Adicionar ponto de salto ao histórico"
|
||
|
||
#: lazarusidestrconsts.lismenuaddtoproject
|
||
msgid "Add editor file to Project"
|
||
msgstr "Adicionar arquivo editor ao Projeto"
|
||
|
||
#: lazarusidestrconsts.lismenuaddwatch
|
||
msgid "Add watch ..."
|
||
msgstr "Adicionar observador ..."
|
||
|
||
#: lazarusidestrconsts.lismenubeaklinesinselection
|
||
msgid "Break Lines in selection"
|
||
msgstr "Interromper Linhas na seleção"
|
||
|
||
#: lazarusidestrconsts.lismenubuild
|
||
msgctxt "lazarusidestrconsts.lismenubuild"
|
||
msgid "Build"
|
||
msgstr "Construir"
|
||
|
||
#: lazarusidestrconsts.lismenubuildall
|
||
msgid "Build all"
|
||
msgstr "Construir Tudo"
|
||
|
||
#: lazarusidestrconsts.lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "Construir Arquivo"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarus
|
||
msgid "Build Lazarus"
|
||
msgstr "Construir Lazarus"
|
||
|
||
#: lazarusidestrconsts.lismenuchecklfm
|
||
msgid "Check LFM file in editor"
|
||
msgstr "Verificar arquivo LFM no Editor"
|
||
|
||
#: lazarusidestrconsts.lismenucleandirectory
|
||
msgid "Clean directory ..."
|
||
msgstr "Limpar diretório ..."
|
||
|
||
#: lazarusidestrconsts.lismenuclose
|
||
msgctxt "lazarusidestrconsts.lismenuclose"
|
||
msgid "Close"
|
||
msgstr "Fechar"
|
||
|
||
#: lazarusidestrconsts.lismenucloseall
|
||
#| msgid "Close all editor files"
|
||
msgid "Close a&ll editor files"
|
||
msgstr "Fechar &tudo"
|
||
|
||
#: lazarusidestrconsts.lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "Fechar Projeto"
|
||
|
||
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
||
msgid "CodeTools defines editor ..."
|
||
msgstr "Editor definições das ferramentas de código ..."
|
||
|
||
#: lazarusidestrconsts.lismenucollectpofil
|
||
msgid "Collect .po files"
|
||
msgstr "Coletar arquivos .po"
|
||
|
||
#: lazarusidestrconsts.lismenucommentselection
|
||
msgid "Comment selection"
|
||
msgstr "Comentar seleção"
|
||
|
||
#: lazarusidestrconsts.lismenucompileroptions
|
||
msgid "Compiler Options ..."
|
||
msgstr "Opções do Compilador ..."
|
||
|
||
#: lazarusidestrconsts.lismenucompletecode
|
||
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Completar Código"
|
||
|
||
#: lazarusidestrconsts.lismenuconditionalselection
|
||
msgid "Insert $IFDEF..."
|
||
msgstr "Inserir $IFDEF..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr "Configurar arquivo Construir+Executar ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
||
msgid "Configure custom components ..."
|
||
msgstr "Configurar componentes personalizados ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigexternaltools
|
||
msgid "Configure external tools ..."
|
||
msgstr "Configurar ferramentas externas ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr "Configurar \"Construção Lazarus\" ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurehelp
|
||
msgid "Configure Help ..."
|
||
msgstr "Configurar Ajuda ..."
|
||
|
||
#: lazarusidestrconsts.lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr "Ajuda de contexto sensível"
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
||
msgid "Convert Delphi package to Lazarus package ..."
|
||
msgstr "Converter pacote Delphi para Lazarus..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
||
msgid "Convert Delphi project to Lazarus project ..."
|
||
msgstr "Converter projeto Delphi para Lazarus..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
||
msgid "Convert Delphi unit to Lazarus unit ..."
|
||
msgstr "Converter unidade Delphi para Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
||
#| msgid "Convert DFM file to LFM ..."
|
||
msgid "Convert binary DFM file to text LFM and check syntax ..."
|
||
msgstr "Converter arquivo binário DFM para LFM texto e verificar sintaxe..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertencoding
|
||
msgid "Convert encoding of projects/packages ..."
|
||
msgstr "Converter codificação dos projetos/pacotes ..."
|
||
|
||
#: lazarusidestrconsts.lismenucopy
|
||
msgctxt "lazarusidestrconsts.lismenucopy"
|
||
msgid "Copy"
|
||
msgstr "Copiar"
|
||
|
||
#: lazarusidestrconsts.lismenucreatefpdocfiles
|
||
msgid "Create FPDoc files"
|
||
msgstr "Criar arquivos \"FPDoc\""
|
||
|
||
#: lazarusidestrconsts.lismenucreatepofile
|
||
msgid "Create .po files"
|
||
msgstr "Criar arquivos .po"
|
||
|
||
#: lazarusidestrconsts.lismenucut
|
||
msgctxt "lazarusidestrconsts.lismenucut"
|
||
msgid "Cut"
|
||
msgstr "Recortar"
|
||
|
||
#: lazarusidestrconsts.lismenudebugwindows
|
||
msgid "Debug windows"
|
||
msgstr "Janelas de Depuração"
|
||
|
||
#: lazarusidestrconsts.lismenudiff
|
||
msgctxt "lazarusidestrconsts.lismenudiff"
|
||
msgid "Diff"
|
||
msgstr "Comparar (Diff)"
|
||
|
||
#: lazarusidestrconsts.lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "&Editar"
|
||
|
||
#: lazarusidestrconsts.lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr "Modelos de Código ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr "Editar Ajuda contexto sensível"
|
||
|
||
#: lazarusidestrconsts.lismenueditinstallpkgs
|
||
msgid "Configure installed packages ..."
|
||
msgstr "Configurar pacotes instalados ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditor
|
||
msgid "Menu Editor..."
|
||
msgstr "Editor Menu..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorcancel
|
||
msgctxt "lazarusidestrconsts.lismenueditorcancel"
|
||
msgid "Cancel"
|
||
msgstr "Cancelar"
|
||
|
||
#: lazarusidestrconsts.lismenueditorcreatesubmenu
|
||
msgid "Create Submenu"
|
||
msgstr "Criar Submenu"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletefromtemplate
|
||
msgid "Delete From Template..."
|
||
msgstr "Excluir do Modelo..."
|
||
|
||
#: lazarusidestrconsts.lismenueditordeleteitem
|
||
msgid "Delete Item"
|
||
msgstr "Excluir Item"
|
||
|
||
#: lazarusidestrconsts.lismenueditorhandleonclickevent
|
||
msgid "Handle OnClick Event"
|
||
msgstr "Manipulador Evento \"OnClick\""
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
|
||
msgid "Insert From Template..."
|
||
msgstr "Inserir do Modelo..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
|
||
msgid "Insert New Item (after)"
|
||
msgstr "Inserir Novo Item (depois)"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
|
||
msgid "Insert New Item (before)"
|
||
msgstr "Inserir Novo Item (antes)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr "Editor de Menu"
|
||
|
||
#: lazarusidestrconsts.lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr "Mover Abaixo (ou direita)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr "Mover Acima (ou esquerda)"
|
||
|
||
#: lazarusidestrconsts.lismenueditornewtemplatedescription
|
||
msgid "New Template Description..."
|
||
msgstr "Nova Descrição de Modelo..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorsaveastemplate
|
||
msgid "Save As Template..."
|
||
msgstr "Salvar Como Modelo..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorselectmenu
|
||
msgid "Select Menu:"
|
||
msgstr "Selecionar Menu:"
|
||
|
||
#: lazarusidestrconsts.lismenueditorselecttemplate
|
||
msgid "Select Template:"
|
||
msgstr "Selecionar Modelo:"
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplatepreview
|
||
msgid "Template Preview"
|
||
msgstr "Visualizar Modelo"
|
||
|
||
#: lazarusidestrconsts.lismenuencloseselection
|
||
msgid "Enclose selection ..."
|
||
msgstr "Circundar seleção ..."
|
||
|
||
#: lazarusidestrconsts.lismenuenvironent
|
||
msgid "E&nvironment"
|
||
msgstr "A&mbiente"
|
||
|
||
#: lazarusidestrconsts.lismenuevaluate
|
||
msgid "Evaluate/Modify ..."
|
||
msgstr "Avaliar/Modificar ..."
|
||
|
||
#: lazarusidestrconsts.lismenuextractproc
|
||
msgid "Extract procedure ..."
|
||
msgstr "Extrair procedimento ..."
|
||
|
||
#: lazarusidestrconsts.lismenufile
|
||
msgid "&File"
|
||
msgstr "&Arquivo"
|
||
|
||
#: lazarusidestrconsts.lismenufind
|
||
msgctxt "lazarusidestrconsts.lismenufind"
|
||
msgid "Find"
|
||
msgstr "Localizar"
|
||
|
||
#: lazarusidestrconsts.lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr "&Localizar ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
||
msgid "Find other end of code block"
|
||
msgstr "Localizar outro final do bloco de código"
|
||
|
||
#: lazarusidestrconsts.lismenufindcodeblockstart
|
||
msgid "Find code block start"
|
||
msgstr "Localizar início do bloco de código"
|
||
|
||
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
||
msgid "Find Declaration at cursor"
|
||
msgstr "Localizar Declaração sob o cursor"
|
||
|
||
#: lazarusidestrconsts.lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr "Localizar referências do identificador ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindinfiles
|
||
msgid "Find &in files ..."
|
||
msgstr "Localizar &nos arquivos ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "Localizar &Próxima"
|
||
|
||
#: lazarusidestrconsts.lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "Localizar &Anterior"
|
||
|
||
#: lazarusidestrconsts.lismenufpdoceditor
|
||
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
|
||
msgid "FPDoc Editor"
|
||
msgstr "Editor FPDoc"
|
||
|
||
#: lazarusidestrconsts.lismenugeneraloptions
|
||
msgid "Options ..."
|
||
msgstr "Opções ..."
|
||
|
||
#: lazarusidestrconsts.lismenugotoincludedirective
|
||
msgid "Goto include directive"
|
||
msgstr "Ir para a diretiva de inclusão"
|
||
|
||
#: lazarusidestrconsts.lismenugotoline
|
||
msgid "Goto line ..."
|
||
msgstr "Ir para linha ..."
|
||
|
||
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
||
msgid "Guess misplaced IFDEF/ENDIF"
|
||
msgstr "Adivinhar IFDEF/ENDIF fora de lugar"
|
||
|
||
#: lazarusidestrconsts.lismenuguessunclosedblock
|
||
msgid "Guess unclosed block"
|
||
msgstr "Adivinhar bloco não fechado"
|
||
|
||
#: lazarusidestrconsts.lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "Aj&uda"
|
||
|
||
#: lazarusidestrconsts.lismenuideinternals
|
||
msgid "IDE internals"
|
||
msgstr "Interno IDE"
|
||
|
||
#: lazarusidestrconsts.lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr "Pesquisa Incremental"
|
||
|
||
#: lazarusidestrconsts.lismenuindentselection
|
||
msgid "Indent selection"
|
||
msgstr "Recuar seleção"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
||
msgid "ChangeLog entry"
|
||
msgstr "Entrada no registro alterações"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcharacter
|
||
msgid "Insert from Character Map"
|
||
msgstr "Inserir do Mapa de Caracteres"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
||
msgid "CVS keyword"
|
||
msgstr "Palavra-Chave CVS"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertdatetime
|
||
msgid "Current date and time"
|
||
msgstr "Data e hora atuais"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgeneral
|
||
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
||
msgid "General"
|
||
msgstr "Geral"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgplnotice
|
||
msgid "GPL notice"
|
||
msgstr "Aviso GPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
||
msgid "LGPL notice"
|
||
msgstr "Aviso LGPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
||
msgid "Modified LGPL notice"
|
||
msgstr "Nota LGL modificada"
|
||
|
||
#: lazarusidestrconsts.lismenuinserttext
|
||
msgid "Insert text"
|
||
msgstr "Inserir Texto"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertusername
|
||
msgid "Current username"
|
||
msgstr "Nome Usuário atual"
|
||
|
||
#: lazarusidestrconsts.lismenuinspect
|
||
msgid "Inspect ..."
|
||
msgstr "Inspecionar ..."
|
||
|
||
#: lazarusidestrconsts.lismenujumpback
|
||
msgid "Jump back"
|
||
msgstr "Saltar atrás"
|
||
|
||
#: lazarusidestrconsts.lismenujumpforward
|
||
msgid "Jump forward"
|
||
msgstr "Saltar adiante"
|
||
|
||
#: lazarusidestrconsts.lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr "Saltar para"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonextbookmark
|
||
msgid "Jump to next bookmark"
|
||
msgstr "Saltar para o próximo marcador"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonexterror
|
||
msgid "Jump to next error"
|
||
msgstr "Saltar para o próximo erro"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
||
msgid "Jump to previous bookmark"
|
||
msgstr "Saltar para o marcador anterior"
|
||
|
||
#: lazarusidestrconsts.lismenujumptopreverror
|
||
msgid "Jump to previous error"
|
||
msgstr "Saltar para o erro anterior"
|
||
|
||
#: lazarusidestrconsts.lismenulowercaseselection
|
||
msgid "Lowercase selection"
|
||
msgstr "Seleção em minúsculas"
|
||
|
||
#: lazarusidestrconsts.lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr "Criar recurso de sequência de caracteres ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewform
|
||
msgid "New Form"
|
||
msgstr "Novo Formulário"
|
||
|
||
#: lazarusidestrconsts.lismenunewother
|
||
msgid "New ..."
|
||
msgstr "Novo ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewpackage
|
||
msgid "New package ..."
|
||
msgstr "Novo pacote ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "Novo Projeto ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewprojectfromfile
|
||
msgid "New Project from file ..."
|
||
msgstr "Novo Projeto do Arquivo ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewunit
|
||
msgctxt "lazarusidestrconsts.lismenunewunit"
|
||
msgid "New Unit"
|
||
msgstr "Nova Unidade"
|
||
|
||
#: lazarusidestrconsts.lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "Ajuda Online"
|
||
|
||
#: lazarusidestrconsts.lismenuopen
|
||
#| msgid "Open ..."
|
||
msgid "&Open ..."
|
||
msgstr "A&brir ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
||
msgid "Open filename at cursor"
|
||
msgstr "Abrir arquivo sob o cursor"
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackage
|
||
msgid "Open loaded package ..."
|
||
msgstr "Abrir pacote carregado ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackagefile
|
||
msgid "Open package file (.lpk) ..."
|
||
msgstr "Abrir arquivo de pacote (.lpk)"
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
||
msgid "Open package of current unit"
|
||
msgstr "Abrir pacote da unidade atual"
|
||
|
||
#: lazarusidestrconsts.lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "Abrir Projeto ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecent
|
||
#| msgid "Open Recent ..."
|
||
msgid "Open &Recent ..."
|
||
msgstr "Abrir &Recente ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentpkg
|
||
msgid "Open recent package ..."
|
||
msgstr "Abrir pacote recente ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentproject
|
||
msgid "Open Recent Project ..."
|
||
msgstr "Abrir Projeto Recente ..."
|
||
|
||
#: lazarusidestrconsts.lismenupackage
|
||
msgid "&Package"
|
||
msgstr "&Pacotes"
|
||
|
||
#: lazarusidestrconsts.lismenupackagegraph
|
||
msgid "Package Graph ..."
|
||
msgstr "Gráfico de Pacotes ..."
|
||
|
||
#: lazarusidestrconsts.lismenupackagelinks
|
||
msgid "Package links ..."
|
||
msgstr "Vínculos pacotes ..."
|
||
|
||
#: lazarusidestrconsts.lismenupaste
|
||
msgctxt "lazarusidestrconsts.lismenupaste"
|
||
msgid "Paste"
|
||
msgstr "Colar"
|
||
|
||
#: lazarusidestrconsts.lismenupause
|
||
msgctxt "lazarusidestrconsts.lismenupause"
|
||
msgid "Pause"
|
||
msgstr "Pausar"
|
||
|
||
#: lazarusidestrconsts.lismenuproject
|
||
msgid "&Project"
|
||
msgstr "&Projeto"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr "Inspetor de Projetos"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr "Opções de Projeto ..."
|
||
|
||
#: lazarusidestrconsts.lismenuprojectrun
|
||
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
||
msgid "Run"
|
||
msgstr "Executar"
|
||
|
||
#: lazarusidestrconsts.lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr "Publicar Projeto ..."
|
||
|
||
#: lazarusidestrconsts.lismenuquickcompile
|
||
msgid "Quick compile"
|
||
msgstr "Compilação rápida"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
||
msgid "Quick syntax check"
|
||
msgstr "Verificação rápida de sintaxe"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
||
msgid "Quick syntax check OK"
|
||
msgstr "Verificação rápida de sintaxe OK"
|
||
|
||
#: lazarusidestrconsts.lismenuquit
|
||
#| msgid "Quit"
|
||
msgid "&Quit"
|
||
msgstr "&Sair"
|
||
|
||
#: lazarusidestrconsts.lismenuredo
|
||
msgctxt "lazarusidestrconsts.lismenuredo"
|
||
msgid "Redo"
|
||
msgstr "Refazer"
|
||
|
||
#: lazarusidestrconsts.lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr "Remover do Projeto ..."
|
||
|
||
#: lazarusidestrconsts.lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr "Renomear Identificador ..."
|
||
|
||
#: lazarusidestrconsts.lismenureplace
|
||
msgctxt "lazarusidestrconsts.lismenureplace"
|
||
msgid "Replace"
|
||
msgstr "Substituir"
|
||
|
||
#: lazarusidestrconsts.lismenureplace2
|
||
msgid "&Replace ..."
|
||
msgstr "&Substituir ..."
|
||
|
||
#: lazarusidestrconsts.lismenureportingbug
|
||
msgid "Reporting a bug..."
|
||
msgstr "Reportar uma falha (\"bug\")..."
|
||
|
||
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
||
msgid "Rescan FPC source directory"
|
||
msgstr "Reexaminar diretório fonte do FPC"
|
||
|
||
#: lazarusidestrconsts.lismenuresetdebugger
|
||
msgid "Reset debugger"
|
||
msgstr "Reiniciar Depurador"
|
||
|
||
#: lazarusidestrconsts.lismenurestart
|
||
msgid "Restart"
|
||
msgstr "Reiniciar"
|
||
|
||
#: lazarusidestrconsts.lismenurevert
|
||
msgid "Revert"
|
||
msgstr "Reverter"
|
||
|
||
#: lazarusidestrconsts.lismenurun
|
||
msgid "&Run"
|
||
msgstr "&Executar"
|
||
|
||
#: lazarusidestrconsts.lismenurunfile
|
||
msgid "Run File"
|
||
msgstr "Executar Arquivo"
|
||
|
||
#: lazarusidestrconsts.lismenurunparameters
|
||
msgid "Run Parameters ..."
|
||
msgstr "Parâmetros de Execução ..."
|
||
|
||
#: lazarusidestrconsts.lismenuruntocursor
|
||
msgid "Run to cursor"
|
||
msgstr "Executar até o Cursor"
|
||
|
||
#: lazarusidestrconsts.lismenusave
|
||
#| msgid "Save"
|
||
msgctxt "lazarusidestrconsts.lismenusave"
|
||
msgid "&Save"
|
||
msgstr "Salva&r"
|
||
|
||
#: lazarusidestrconsts.lismenusaveall
|
||
msgid "Save All"
|
||
msgstr "Salvar Tudo"
|
||
|
||
#: lazarusidestrconsts.lismenusaveas
|
||
#| msgid "Save As ..."
|
||
msgid "Save &As ..."
|
||
msgstr "Salvar &Como ..."
|
||
|
||
#: lazarusidestrconsts.lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "Salvar Projeto"
|
||
|
||
#: lazarusidestrconsts.lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "Salvar Projeto Como ..."
|
||
|
||
#: lazarusidestrconsts.lismenusearch
|
||
msgid "&Search"
|
||
msgstr "&Localizar"
|
||
|
||
#: lazarusidestrconsts.lismenuselect
|
||
msgid "Select"
|
||
msgstr "Selecionar"
|
||
|
||
#: lazarusidestrconsts.lismenuselectall
|
||
msgid "Select all"
|
||
msgstr "Selecionar tudo"
|
||
|
||
#: lazarusidestrconsts.lismenuselectcodeblock
|
||
msgid "Select code block"
|
||
msgstr "Selecionar bloco de código"
|
||
|
||
#: lazarusidestrconsts.lismenuselectline
|
||
msgid "Select line"
|
||
msgstr "Selecionar linha"
|
||
|
||
#: lazarusidestrconsts.lismenuselectparagraph
|
||
msgid "Select paragraph"
|
||
msgstr "Selecionar parágrafo"
|
||
|
||
#: lazarusidestrconsts.lismenuselecttobrace
|
||
msgid "Select to brace"
|
||
msgstr "Selecionar para fixar"
|
||
|
||
#: lazarusidestrconsts.lismenuselectword
|
||
msgid "Select word"
|
||
msgstr "Selecionar palavra"
|
||
|
||
#: lazarusidestrconsts.lismenusetfreebookmark
|
||
msgid "Set a free bookmark"
|
||
msgstr "Ajustar um marcador livre"
|
||
|
||
#: lazarusidestrconsts.lismenushowexecutionpoint
|
||
msgid "Show execution point"
|
||
msgstr "Mostrar ponto execução"
|
||
|
||
#: lazarusidestrconsts.lismenusortselection
|
||
msgid "Sort selection ..."
|
||
msgstr "Ordenar seleção ..."
|
||
|
||
#: lazarusidestrconsts.lismenustepinto
|
||
msgid "Step into"
|
||
msgstr "Passar Para"
|
||
|
||
#: lazarusidestrconsts.lismenustepout
|
||
msgid "Step out"
|
||
msgstr "Passar Fora"
|
||
|
||
#: lazarusidestrconsts.lismenustepover
|
||
msgid "Step over"
|
||
msgstr "Passar Sobre"
|
||
|
||
#: lazarusidestrconsts.lismenustop
|
||
msgctxt "lazarusidestrconsts.lismenustop"
|
||
msgid "Stop"
|
||
msgstr "Parar"
|
||
|
||
#: lazarusidestrconsts.lismenutabstospacesselection
|
||
msgid "Tabs to spaces in selection"
|
||
msgstr "Tabulações para espaços na seleção"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateabout
|
||
msgid "About"
|
||
msgstr "Sobre"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateclose
|
||
msgctxt "lazarusidestrconsts.lismenutemplateclose"
|
||
msgid "Close"
|
||
msgstr "Fechar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr "Conteúdo"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecopy
|
||
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
|
||
msgid "Copy"
|
||
msgstr "Copiar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecut
|
||
msgctxt "lazarusidestrconsts.lismenutemplatecut"
|
||
msgid "Cut"
|
||
msgstr "Recortar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr "Menu Editar Padrão"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr "Menu Arquivo Padrão"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr "Menu Ajuda Padrão"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateedit
|
||
msgctxt "lazarusidestrconsts.lismenutemplateedit"
|
||
msgid "Edit"
|
||
msgstr "Editar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateexit
|
||
msgctxt "lazarusidestrconsts.lismenutemplateexit"
|
||
msgid "Exit"
|
||
msgstr "Sair"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefile
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefile"
|
||
msgid "File"
|
||
msgstr "Arquivo"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefind
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
||
msgid "Find"
|
||
msgstr "Localizar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefindnext
|
||
msgid "Find Next"
|
||
msgstr "Localizar Próximo"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatehelp
|
||
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
|
||
msgid "Help"
|
||
msgstr "Ajuda"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatenew
|
||
msgid "New"
|
||
msgstr "Novo"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateopen
|
||
msgctxt "lazarusidestrconsts.lismenutemplateopen"
|
||
msgid "Open"
|
||
msgstr "Abrir"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateopenrecent
|
||
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
||
msgid "Open Recent"
|
||
msgstr "Abrir Recente"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatepaste
|
||
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
|
||
msgid "Paste"
|
||
msgstr "Colar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateredo
|
||
msgctxt "lazarusidestrconsts.lismenutemplateredo"
|
||
msgid "Redo"
|
||
msgstr "Refazer"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatesave
|
||
msgctxt "lazarusidestrconsts.lismenutemplatesave"
|
||
msgid "Save"
|
||
msgstr "Salvar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatesaveas
|
||
msgid "Save As"
|
||
msgstr "Salvar Como"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr "Tutorial"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateundo
|
||
msgctxt "lazarusidestrconsts.lismenutemplateundo"
|
||
msgid "Undo"
|
||
msgstr "Desfazer"
|
||
|
||
#: lazarusidestrconsts.lismenutogglecomment
|
||
msgid "Toggle comment"
|
||
msgstr "Alternar comentário"
|
||
|
||
#: lazarusidestrconsts.lismenutools
|
||
msgid "&Tools"
|
||
msgstr "&Ferramentas"
|
||
|
||
#: lazarusidestrconsts.lismenuuncommentselection
|
||
msgid "Uncomment selection"
|
||
msgstr "Descomentar seleção"
|
||
|
||
#: lazarusidestrconsts.lismenuundo
|
||
msgctxt "lazarusidestrconsts.lismenuundo"
|
||
msgid "Undo"
|
||
msgstr "Desfazer"
|
||
|
||
#: lazarusidestrconsts.lismenuunindentselection
|
||
msgid "Unindent selection"
|
||
msgstr "Retirar recuo da seleção"
|
||
|
||
#: lazarusidestrconsts.lismenuuppercaseselection
|
||
msgid "Uppercase selection"
|
||
msgstr "Seleção em maiúsculas"
|
||
|
||
#: lazarusidestrconsts.lismenuview
|
||
msgid "&View"
|
||
msgstr "&Exibir"
|
||
|
||
#: lazarusidestrconsts.lismenuviewanchoreditor
|
||
#| msgid "View Anchor Editor"
|
||
msgid "Anchor Editor"
|
||
msgstr "Editor de Âncora"
|
||
|
||
#: lazarusidestrconsts.lismenuviewassembler
|
||
msgid "Assembler"
|
||
msgstr "Assembler"
|
||
|
||
#: lazarusidestrconsts.lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "Pontos de parada"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr "Chamada de Pilha"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodebrowser
|
||
msgid "Code Browser"
|
||
msgstr "Navegador Código"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorador de Código"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
||
#| msgid "View Component Palette"
|
||
msgid "Component Palette"
|
||
msgstr "Paleta de Componentes"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "&Componentes"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugevents
|
||
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
||
msgid "Event Log"
|
||
msgstr "Registro de Eventos"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugoutput
|
||
msgid "Debug output"
|
||
msgstr "Saída da Depuração"
|
||
|
||
#: lazarusidestrconsts.lismenuviewforms
|
||
msgid "Forms..."
|
||
msgstr "Formulários..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewidespeedbuttons
|
||
#| msgid "View IDE speed buttons"
|
||
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
|
||
msgid "IDE speed buttons"
|
||
msgstr "Botões IDE"
|
||
|
||
#: lazarusidestrconsts.lismenuviewjumphistory
|
||
#| msgid "Jump-History ..."
|
||
msgid "Jump History ..."
|
||
msgstr "Saltar para histórico ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr "Variáveis Locais"
|
||
|
||
#: lazarusidestrconsts.lismenuviewmessages
|
||
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
||
msgid "Messages"
|
||
msgstr "Mensagens"
|
||
|
||
#: lazarusidestrconsts.lismenuviewobjectinspector
|
||
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
||
msgid "Object Inspector"
|
||
msgstr "Inspetor de Objetos"
|
||
|
||
#: lazarusidestrconsts.lismenuviewregisters
|
||
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
||
msgid "Registers"
|
||
msgstr "Registradores"
|
||
|
||
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr "Navegador Restrições"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr "Resultados da busca"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsource
|
||
msgid "&View Source"
|
||
msgstr "&Exibir Fonte"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsourceeditor
|
||
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
||
msgid "Source Editor"
|
||
msgstr "Editor de Código"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtodolist
|
||
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
|
||
msgid "ToDo List"
|
||
msgstr "Lista ToDo (Para Fazer)"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
||
msgid "Toggle form/unit view"
|
||
msgstr "Alternar exibição formulário/unidade"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitdependencies
|
||
#| msgid "View Unit Dependencies"
|
||
msgid "Unit Dependencies"
|
||
msgstr "Dependências da Unidade"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitinfo
|
||
#| msgid "View Unit Information"
|
||
msgid "Unit Information"
|
||
msgstr "Informações da Unidade"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunits
|
||
msgid "Units..."
|
||
msgstr "Unidades..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr "Observadores"
|
||
|
||
#: lazarusidestrconsts.lismenuwindow
|
||
msgid "&Window"
|
||
msgstr "&Janela"
|
||
|
||
#: lazarusidestrconsts.lismessageseditor
|
||
msgid "Messages Editor"
|
||
msgstr "Editor Mensagens"
|
||
|
||
#: lazarusidestrconsts.lismethodclassnotfound
|
||
msgid "Method class not found"
|
||
msgstr "Classe do método não encontrada"
|
||
|
||
#: lazarusidestrconsts.lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr "Eventos faltando"
|
||
|
||
#: lazarusidestrconsts.lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr "Identificadores faltando"
|
||
|
||
#: lazarusidestrconsts.lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr "Pacotes faltando"
|
||
|
||
#: lazarusidestrconsts.lismissingunitschoices
|
||
msgid "Your choices are:"
|
||
msgstr "Suas opções são:"
|
||
|
||
#: lazarusidestrconsts.lismissingunitscomment
|
||
#, fuzzy
|
||
msgid "Comment Out"
|
||
msgstr "Comentar"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsfordelphi
|
||
msgid "For Delphi only"
|
||
msgstr "Apenas para Delphi"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1
|
||
msgid "1) Comment out the selected units."
|
||
msgstr "1) Comentar as unidades selecionadas."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1b
|
||
msgid "1) Use the units only for Delphi."
|
||
msgstr "1) Usar as unidades apenas para Delphi."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo2
|
||
msgid "2) Search for units. Found paths are added to project settings."
|
||
msgstr "2) Procurar por unidades. Caminhos encontrados serão adicionados aos ajustes do projeto."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo3
|
||
msgid "3) Abort now, install packages or fix paths and try again."
|
||
msgstr "3) Abortar agora, instalar pacotes ou corrigir caminhos e tentar novamente."
|
||
|
||
#: lazarusidestrconsts.lismissingunitssearch
|
||
msgid "Search Unit Path"
|
||
msgstr "Caminho Busca Unidades"
|
||
|
||
#: lazarusidestrconsts.lismodifiedlgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEsta biblioteca é software livre; você pode redistribuí-la e/ou moficá-la sob os termos da licença GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior com as seguintes modificações:%sComo uma exceção especial, os detentores do copyright desta biblioteca dão permissão para usá-la com módulos independentes para produzir um executável, independentemente dos termos de licença destes módulos independentes, e copiar e distribuir o executável resultante sob os termos de sua escolha, desde que você encontre, para cada módulo independente vinculado, os termos e condições da licença daquele módulo. Um módulo independente e um módulo que não é derivado ou baseado nesta biblioteca. Se você modificar esta biblioteca você deve estender esta exceção a sua versão da biblioteca, mas não é obrigado a fazer isto. Se você não quiser fazer isto, elimine o estatuto desta exceção da sua versão.%sEste programa é distribuido na esperança de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.%sVocê deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lismodify
|
||
msgid "&Modify"
|
||
msgstr "&Modificar"
|
||
|
||
#: lazarusidestrconsts.lismore
|
||
msgid "More"
|
||
msgstr "Mais"
|
||
|
||
#: lazarusidestrconsts.lismovepage
|
||
msgid "Move Page ..."
|
||
msgstr "Mover Página ..."
|
||
|
||
#: lazarusidestrconsts.lisms
|
||
msgid "(ms)"
|
||
msgstr "(ms)"
|
||
|
||
#: lazarusidestrconsts.lismvdocking
|
||
msgid "Docking"
|
||
msgstr "Aportar"
|
||
|
||
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr "Salvar mensagens para arquivo (*.txt)"
|
||
|
||
#: lazarusidestrconsts.lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr "Conflito de nome"
|
||
|
||
#: lazarusidestrconsts.lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr "Nome do novo procedimento"
|
||
|
||
#: lazarusidestrconsts.lisnever
|
||
msgid "Never"
|
||
msgstr "Nunca"
|
||
|
||
#: lazarusidestrconsts.lisnew
|
||
msgid "new"
|
||
msgstr "novo"
|
||
|
||
#: lazarusidestrconsts.lisnewancestors
|
||
msgid "New Ancestors"
|
||
msgstr "Novo Ancestral"
|
||
|
||
#: lazarusidestrconsts.lisnewbuildmode
|
||
msgid "New build mode"
|
||
msgstr "Novo modo construção"
|
||
|
||
#: lazarusidestrconsts.lisnewclass
|
||
msgid "New Class"
|
||
msgstr "Nova Classe"
|
||
|
||
#: lazarusidestrconsts.lisnewconsoleapplication
|
||
msgid "New console application"
|
||
msgstr "Nova aplicação \"console\""
|
||
|
||
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
||
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Criar uma nova aplicação \"CGI\".%sO arquivo de programa é mantido pelo Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
|
||
msgid "Create a new program."
|
||
msgstr "Criar um novo programa."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr "Criar um novo arquivo do editor.%sEscolha um tipo."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr "Criar um novo arquivo de texto vazio."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
|
||
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Criar uma nova aplicação gráfica.%sO arquivo do programa é mantido pelo Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
|
||
msgid "Create a new pascal unit."
|
||
msgstr "Criar uma nova unidade Pascal."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
|
||
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
||
msgstr "Criar um novo programa.%sO arquivo de programa é mantido pelo Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr "Criar um novo projeto.%sEscolha um tipo."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr "Criar um novo pacote padrão.%sUm pacote é uma coleção de unidades e componentes."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr "Criar uma nova unidade com um \"datamodule\"."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
||
msgid "Create a new unit with a frame"
|
||
msgstr "Criar uma nova unidade com bordas"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr "Criar uma nova unidade com um formulário LCL."
|
||
|
||
#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
|
||
msgid "Inherit from an existing component."
|
||
msgstr "Herdar de um componente existente."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "Nenhum item selecionado"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "Favor selecionar um item primeiro."
|
||
|
||
#: lazarusidestrconsts.lisnewencoding
|
||
msgid "New encoding:"
|
||
msgstr "Nova codificação:"
|
||
|
||
#: lazarusidestrconsts.lisnewgroupasetofmodes
|
||
msgid "New group - a set of modes"
|
||
msgstr "Novo grupo - um conjunto de modos"
|
||
|
||
#: lazarusidestrconsts.lisnewproject
|
||
msgid "%s - (new project)"
|
||
msgstr "%s - (novo projeto)"
|
||
|
||
#: lazarusidestrconsts.lisnewsetting
|
||
msgid "New setting"
|
||
msgstr "Novo ajuste"
|
||
|
||
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
||
msgid "New units are added to uses sections:"
|
||
msgstr "Novas unidades serão adicionadas à seção \"uses\":"
|
||
|
||
#: lazarusidestrconsts.lisno
|
||
msgid "No"
|
||
msgstr "Não"
|
||
|
||
#: lazarusidestrconsts.lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr "Sem arquivo de segurança"
|
||
|
||
#: lazarusidestrconsts.lisnochange
|
||
msgid "No change"
|
||
msgstr "Sem alterações"
|
||
|
||
#: lazarusidestrconsts.lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "Nenhum código selecionado"
|
||
|
||
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr "Nenhuma opção de compilador herdada."
|
||
|
||
#: lazarusidestrconsts.lisnoidewindowselected
|
||
msgid "No IDE window selected"
|
||
msgstr "Nenhuma janela da IDE selecionada"
|
||
|
||
#: lazarusidestrconsts.lisnolfmfile
|
||
msgid "No LFM file"
|
||
msgstr "Nenhum arquivo LFM"
|
||
|
||
#: lazarusidestrconsts.lisnoname
|
||
msgid "noname"
|
||
msgstr "sem nome"
|
||
|
||
#: lazarusidestrconsts.lisnone
|
||
msgid "%snone"
|
||
msgstr "%nenhum"
|
||
|
||
#: lazarusidestrconsts.lisnone2
|
||
msgid "none"
|
||
msgstr "nenhum"
|
||
|
||
#: lazarusidestrconsts.lisnonodeselected
|
||
msgid "no node selected"
|
||
msgstr "Nenhuma ramificação selecionada"
|
||
|
||
#: lazarusidestrconsts.lisnopascalfile
|
||
msgid "No pascal file"
|
||
msgstr "Nenhum arquivo pascal"
|
||
|
||
#: lazarusidestrconsts.lisnoprogramfilesfound
|
||
msgid "No program file %s%s%s found."
|
||
msgstr "Nenhum arquivo de programa %s%s%s encontrado."
|
||
|
||
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr "Seção de recurso sequência de carac. não encontrada."
|
||
|
||
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
||
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr "Normalmente o filtro é uma expressão regular. Em sintaxe simples \".\" é um caractere normal, \"*\" significa qualquer coisa, \"?\" significa qualquer caractere e \",\" e \";\" separam alternativas. Por exemplo: *.pas;*.pp corresponde a ^(.*\\.pas|.*\\.pp)$"
|
||
|
||
#: lazarusidestrconsts.lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr "Nenhuma constante de sequência de caracteres encontrada"
|
||
|
||
#: lazarusidestrconsts.lisnotadelphiproject
|
||
msgid "Not a Delphi project"
|
||
msgstr "Não é um projeto Delphi"
|
||
|
||
#: lazarusidestrconsts.lisnotadelphiunit
|
||
msgid "Not a Delphi unit"
|
||
msgstr "Não é uma unidade Delphi"
|
||
|
||
#: lazarusidestrconsts.lisnotavalidpascalidentifier
|
||
msgid "Not a valid pascal identifier"
|
||
msgstr "Não é um identificador pascal válido"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr "NOTA: Não foi possível criar Modelo Definições para fontes Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr "NOTA: Não foi possível criar Modelo Definições para fontes Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr "Não implementado"
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr "Não implementado ainda:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet2
|
||
msgid "Not implemented yet."
|
||
msgstr "Não implementado ainda."
|
||
|
||
#: lazarusidestrconsts.lisnotnow
|
||
msgid "Not now"
|
||
msgstr "Agora não"
|
||
|
||
#: lazarusidestrconsts.lisnpcreate
|
||
msgid "Create"
|
||
msgstr "Criar"
|
||
|
||
#: lazarusidestrconsts.lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr "Criar um novo projeto"
|
||
|
||
#: lazarusidestrconsts.lisnpselectaprojecttype
|
||
msgid "Select a project type"
|
||
msgstr "Selecione um tipo de projeto"
|
||
|
||
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
||
msgid "Number of files to convert: %s"
|
||
msgstr "Número de arquivos à converter: %s"
|
||
|
||
#: lazarusidestrconsts.lisobjectpascaldefault
|
||
msgid "Object Pascal - default"
|
||
msgstr "Padrão - \"Object Pascal\""
|
||
|
||
#: lazarusidestrconsts.lisobjectpath
|
||
msgid "object path"
|
||
msgstr "caminho objeto"
|
||
|
||
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
||
msgid "Switch to Object Inspector Favorites tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
|
||
msgid "Switch to Object Inspector Favorites tab after asking for component name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoff
|
||
msgid "? (Off)"
|
||
msgstr "? (Desligado)"
|
||
|
||
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
|
||
msgid "Add to favourite properties"
|
||
msgstr "Adicionar as propriedades favoritas"
|
||
|
||
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
|
||
msgid "Choose a base class for the favourite property %s%s%s."
|
||
msgstr "Escolha uma classe base para a propriedade favorita %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisoifclassnotfound
|
||
msgid "Class %s%s%s not found."
|
||
msgstr "Classe %s%s%s não encontrada."
|
||
|
||
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
|
||
msgid "Remove from favourite properties"
|
||
msgstr "Remover das propriedades favoritas"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr "instalação automática dinâmica"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr "instalação automática estática"
|
||
|
||
#: lazarusidestrconsts.lisoipdescription
|
||
msgid "Description: "
|
||
msgstr "Descrição: "
|
||
|
||
#: lazarusidestrconsts.lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%sDescrição: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr "Nome de Arquivo: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr "instalado dinamicamente"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr "instalado estaticamente"
|
||
|
||
#: lazarusidestrconsts.lisoipmissing
|
||
msgid "missing"
|
||
msgstr "faltando"
|
||
|
||
#: lazarusidestrconsts.lisoipmodified
|
||
msgid "modified"
|
||
msgstr "modificado"
|
||
|
||
#: lazarusidestrconsts.lisoipnopackageselected
|
||
msgid "No package selected"
|
||
msgstr "Nenhum pacote selecionado"
|
||
|
||
#: lazarusidestrconsts.lisoipopenloadedpackage
|
||
msgid "Open loaded package"
|
||
msgstr "Abrir pacote carregado"
|
||
|
||
#: lazarusidestrconsts.lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr "Nome do Pacote"
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr "Favor selecionar um pacote"
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
|
||
msgid "Please select a package to open"
|
||
msgstr "Favor selecionar um pacote para abrir"
|
||
|
||
#: lazarusidestrconsts.lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr "somente leitura"
|
||
|
||
#: lazarusidestrconsts.lisoipstate
|
||
msgid "State"
|
||
msgstr "Estado"
|
||
|
||
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "%sEste pacote está instalado, mas o arquivo LPK não foi encontrado"
|
||
|
||
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
|
||
msgid "%sThis package was automatically created"
|
||
msgstr "%sEste pacote foi criado automaticamente"
|
||
|
||
#: lazarusidestrconsts.lisok
|
||
#| msgid "&Ok"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: lazarusidestrconsts.lisold
|
||
msgid "old"
|
||
msgstr "antigo"
|
||
|
||
#: lazarusidestrconsts.lisoldancestors
|
||
msgid "Old Ancestors"
|
||
msgstr "Ancestral Antigo"
|
||
|
||
#: lazarusidestrconsts.lisoldclass
|
||
msgid "Old Class"
|
||
msgstr "Classe Antiga"
|
||
|
||
#: lazarusidestrconsts.lison
|
||
msgid "? (On)"
|
||
msgstr "? (Ligado)"
|
||
|
||
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
||
msgid "On break line (i.e. return or enter key)"
|
||
msgstr "Na quebra linha (ou seja, teclas retorno ou \"enter\")"
|
||
|
||
#: lazarusidestrconsts.lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr "Somente localizar palavras inteiras"
|
||
|
||
#: lazarusidestrconsts.lisonpastefromclipboard
|
||
msgid "On paste from clipboard"
|
||
msgstr "Ao colar da Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr "Abrir como arquivo XML"
|
||
|
||
#: lazarusidestrconsts.lisopendesigneronopenunit
|
||
msgid "Open designer on open unit"
|
||
msgstr "Abrir editor ao abrir unidade"
|
||
|
||
#: lazarusidestrconsts.lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr "Abrir arquivo existente"
|
||
|
||
#: lazarusidestrconsts.lisopenfile
|
||
msgid "Open file"
|
||
msgstr "Abrir arquivo"
|
||
|
||
#: lazarusidestrconsts.lisopenfile2
|
||
msgid "Open File ..."
|
||
msgstr "Abrir Arquivo ..."
|
||
|
||
#: lazarusidestrconsts.lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr "Abrir %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr "Abrir Pacote?"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage2
|
||
msgid "Open package %s"
|
||
msgstr "Abrir pacote %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr "Abrir Arquivo de Pacote"
|
||
|
||
#: lazarusidestrconsts.lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "Abrir Projeto?"
|
||
|
||
#: lazarusidestrconsts.lisopenproject2
|
||
msgid "Open project"
|
||
msgstr "Abrir projeto"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr "Abrir projeto novamente"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "Abrir Arquivo de Projeto"
|
||
|
||
#: lazarusidestrconsts.lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr "Abrir vínculo simbólico"
|
||
|
||
#: lazarusidestrconsts.lisopentarget
|
||
msgid "Open target"
|
||
msgstr "Abrir alvo"
|
||
|
||
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr "Abrir arquivo como código normal"
|
||
|
||
#: lazarusidestrconsts.lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr "Abrir o pacote %s?"
|
||
|
||
#: lazarusidestrconsts.lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr "Abrir o projeto %s?"
|
||
|
||
#: lazarusidestrconsts.lisor
|
||
msgid "or"
|
||
msgstr "ou"
|
||
|
||
#: lazarusidestrconsts.lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr "Sobrepor idioma. Por exemplo --language=de. Veja os valores possíveis no diretório \"languages\"."
|
||
|
||
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
||
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
||
msgstr "%ssobrepor o compilador padrão. ex. ppc386 ppcx64 ppcppc etc. padrão é armazenado em \"environmentoptions.xml\""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
||
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
||
msgstr "%ssobrepor a cpu do projeto. ex. i386 x86_64 powerpc powerpc_64 etc. padrão: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
||
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
||
msgstr "%ssobrepor o sistema operacional do projeto. ex. win32 linux. padrão: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
||
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
||
msgstr "%ssobregarrega o \"widgetset\" do projeto. ex. gtk gtk2 qt win32 carbon. padrão: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr "Sobrescrever arquivo?"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr "Sobrescrever arquivo em disco"
|
||
|
||
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
||
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
||
msgstr "'Proprietário' já usado por TReader/TWriter. Favor escolher outro nome."
|
||
|
||
#: lazarusidestrconsts.lispackage
|
||
msgid "Package"
|
||
msgstr "Pacote"
|
||
|
||
#: lazarusidestrconsts.lispackage2
|
||
msgid "package %s"
|
||
msgstr "pacote %s"
|
||
|
||
#: lazarusidestrconsts.lispackageinfo
|
||
msgid "Package Info"
|
||
msgstr "Informações Pacote"
|
||
|
||
#: lazarusidestrconsts.lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr "Nome do pacote começa com ..."
|
||
|
||
#: lazarusidestrconsts.lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr "Nome do pacote contém ..."
|
||
|
||
#: lazarusidestrconsts.lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr "Pacote necessita instalação"
|
||
|
||
#: lazarusidestrconsts.lispackagestoinstallintheide
|
||
msgid "Packages to install in the IDE"
|
||
msgstr "Pacotes a instalar na IDE"
|
||
|
||
#: lazarusidestrconsts.lispackageunit
|
||
msgid "package unit"
|
||
msgstr "unidade pacote"
|
||
|
||
#: lazarusidestrconsts.lispascalsourcefile
|
||
msgid "Pascal source file"
|
||
msgstr "Arquivo fonte Pascal"
|
||
|
||
#: lazarusidestrconsts.lispascalunit
|
||
msgid "Pascal unit"
|
||
msgstr "unidade Pascal"
|
||
|
||
#: lazarusidestrconsts.lispasscount
|
||
msgid "Pass Count"
|
||
msgstr "Núm. Passos"
|
||
|
||
#: lazarusidestrconsts.lispasteclipboard
|
||
msgid "paste clipboard"
|
||
msgstr "colar área de transferência"
|
||
|
||
#: lazarusidestrconsts.lispastetextfromclipboard
|
||
msgid "Paste text from clipboard"
|
||
msgstr "Colar texto da área de transferência"
|
||
|
||
#: lazarusidestrconsts.lispath
|
||
msgid "Path"
|
||
msgstr "Caminho"
|
||
|
||
#: lazarusidestrconsts.lispatheditbrowse
|
||
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
||
msgid "Browse"
|
||
msgstr "Navegar"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathdown
|
||
msgid "Move path down"
|
||
msgstr "Mover caminho abaixo"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathup
|
||
msgid "Move path up"
|
||
msgstr "Move caminho acima"
|
||
|
||
#: lazarusidestrconsts.lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr "Modelos de caminho"
|
||
|
||
#: lazarusidestrconsts.lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr "Caminhos de busca:"
|
||
|
||
#: lazarusidestrconsts.lispatheditselectdirectory
|
||
msgid "Select directory"
|
||
msgstr "Selecione o diretório"
|
||
|
||
#: lazarusidestrconsts.lispathofthemakeutility
|
||
msgid "Path of the make utility"
|
||
msgstr "Caminho do utilitário \"make\""
|
||
|
||
#: lazarusidestrconsts.lispathtoinstance
|
||
msgid "Path to failed Instance:"
|
||
msgstr "Caminho para Instância com falha:"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddanitem
|
||
msgid "Add an item"
|
||
msgstr "Adicionar um item"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddtoproject
|
||
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
||
msgid "Add to project"
|
||
msgstr "Adicionar ao projeto"
|
||
|
||
#: lazarusidestrconsts.lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "Aplicar alterações"
|
||
|
||
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr "Chamar procedimento de %sRegistro%s da unidade selecionada"
|
||
|
||
#: lazarusidestrconsts.lispckeditcleardependencydefaultfilename
|
||
msgid "Clear dependency filename"
|
||
msgstr "Limpar nome de arquivo de dependência"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompile
|
||
msgctxt "lazarusidestrconsts.lispckeditcompile"
|
||
msgid "Compile"
|
||
msgstr "Compilar"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr "Compilar tudo?"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr "Compilar pacote"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr "Opções do Compilador para o Pacote %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompopts
|
||
msgctxt "lazarusidestrconsts.lispckeditcompopts"
|
||
msgid "Compiler Options"
|
||
msgstr "Opções do Compilador"
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatemakefile
|
||
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Criar \"Makefile\""
|
||
|
||
#: lazarusidestrconsts.lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr "Propriedades de Dependência"
|
||
|
||
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
||
msgid "Edit General Options"
|
||
msgstr "Editar Opções Gerais"
|
||
|
||
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
|
||
msgid "Edit Options to compile package"
|
||
msgstr "Editar Opções para compilar o pacote"
|
||
|
||
#: lazarusidestrconsts.lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr "Propriedades do Arquivo"
|
||
|
||
#: lazarusidestrconsts.lispckeditgeneraloptions
|
||
msgid "General Options"
|
||
msgstr "Opções Gerais"
|
||
|
||
#: lazarusidestrconsts.lispckedithelp
|
||
msgctxt "lazarusidestrconsts.lispckedithelp"
|
||
msgid "Help"
|
||
msgstr "Ajuda"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstall
|
||
msgid "Install"
|
||
msgstr "Instalar"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstallpackageintheide
|
||
msgid "Install package in the IDE"
|
||
msgstr "Instalar pacote na IDE"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr "Versão máxima inválida"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr "Versão mínima inválida"
|
||
|
||
#: lazarusidestrconsts.lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr "Versão Máxima:"
|
||
|
||
#: lazarusidestrconsts.lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr "Versão Mínima:"
|
||
|
||
#: lazarusidestrconsts.lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr "Modificado: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditmore
|
||
msgid "More ..."
|
||
msgstr "Mais ..."
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr "Mover dependência abaixo"
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr "Mover dependência acima"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr "Pacote %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
||
msgid "Package %s%s%s has changed.%sSave package?"
|
||
msgstr "Pacote %s%s%s foi alterado.%sSalvar pacote?"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr "pacote %s não salvo"
|
||
|
||
#: lazarusidestrconsts.lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s, Página: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr "Re-adicionar dependência"
|
||
|
||
#: lazarusidestrconsts.lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr "Re-adicionar arquivo"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr "Somente Leitura: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
||
msgid "Recompile all required"
|
||
msgstr "Recompilar todos requeridos"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileclean
|
||
msgid "Recompile clean"
|
||
msgstr "Recompilar e Limpar"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr "Re-compilar este e todos os pacotes requeridos?"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr "Complementos registrados"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr "Unidade de registro"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr "Remover dependência"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr "Remover Dependência?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Remover dependência %s%s%s%s do pacote %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
||
msgid "Removed Files (these entries are not saved to the lpk file)"
|
||
msgstr "Arquivos Removidos (essas entradas não foram salvas no arquivo LPK)"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
||
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
||
msgstr "Pacotes requeridos removidos(essas entradas não foram salvas no arquivo LPK)"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr "Remover arquivo"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr "Remover arquivo?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
||
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Remover arquivo %s%s%s%sdo pacote %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "Remover item selecionado"
|
||
|
||
#: lazarusidestrconsts.lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr "Pacotes Requeridos"
|
||
|
||
#: lazarusidestrconsts.lispckeditsavechanges
|
||
msgid "Save Changes?"
|
||
msgstr "Salvar Alterações?"
|
||
|
||
#: lazarusidestrconsts.lispckeditsavepackage
|
||
msgid "Save package"
|
||
msgstr "Salvar pacote"
|
||
|
||
#: lazarusidestrconsts.lispckeditsetdependencydefaultfilename
|
||
msgid "Store dependency filename"
|
||
msgstr "Armazenar nome de arquivo dependência"
|
||
|
||
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "A versão máxima %s%s%s não é uma versão de pacote válida.%s(bom exemplo 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "A versão mínima %s%s%s não é uma versão de pacote válida.%s(bom exemplo 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr "Desinstalar"
|
||
|
||
#: lazarusidestrconsts.lispckeditviewpackgesource
|
||
msgid "View Package Source"
|
||
msgstr "Exibir Fonte do Pacote"
|
||
|
||
#: lazarusidestrconsts.lispckexplautocreated
|
||
msgid "AutoCreated"
|
||
msgstr "Criado Automaticamente"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstalled
|
||
msgid "Installed"
|
||
msgstr "Instalado"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr "Instalar na próxima inicialização"
|
||
|
||
#: lazarusidestrconsts.lispckexplisrequiredby
|
||
msgid "Selected package is required by:"
|
||
msgstr "Pacote selecionado é requerido por:"
|
||
|
||
#: lazarusidestrconsts.lispckexplloadedpackages
|
||
msgid "Loaded Packages:"
|
||
msgstr "Pacotes Carregados:"
|
||
|
||
#: lazarusidestrconsts.lispckexplpackagenotfound
|
||
msgid "Package %s not found"
|
||
msgstr "Pacote %s não encontrado"
|
||
|
||
#: lazarusidestrconsts.lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr "%sEstado: "
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start"
|
||
msgstr "Desinstalar na próxima inicialização"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "Adicionar opções para pacotes e projetos dependentes"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "Adicionar caminhos para pacotes/projetos dependentes"
|
||
|
||
#: lazarusidestrconsts.lispckoptsauthor
|
||
msgid "Author:"
|
||
msgstr "Autor:"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
|
||
msgid "Automatically increment version on build"
|
||
msgstr "Incrementar automaticamente a versão ao reconstruir"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "Reconstruir automaticamente se necessário"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "Reconstruir automaticamente quando reconstruir tudo"
|
||
|
||
#: lazarusidestrconsts.lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr "Personalizado"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
||
msgid "Description/Abstract"
|
||
msgstr "Descrição/Abstrato"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
||
msgid "Designtime and Runtime"
|
||
msgstr "Tempo Projeto e Tempo Execução"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeonly
|
||
msgid "Designtime only"
|
||
msgstr "Apenas em Tempo Projeto"
|
||
|
||
#: lazarusidestrconsts.lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr "Integração com a IDE"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr "Incluir"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr "Tipo de pacote inválido"
|
||
|
||
#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
|
||
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
|
||
msgid "FPDoc files path"
|
||
msgstr "Caminho arquivos FPDoc"
|
||
|
||
#: lazarusidestrconsts.lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr "Biblioteca"
|
||
|
||
#: lazarusidestrconsts.lispckoptslicense
|
||
msgid "License:"
|
||
msgstr "Licença:"
|
||
|
||
#: lazarusidestrconsts.lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr "Vinculador"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr "Maior:"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr "Compilação manual (nunca automaticamente)"
|
||
|
||
#: lazarusidestrconsts.lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr "Menor:"
|
||
|
||
#: lazarusidestrconsts.lispckoptsobject
|
||
msgid "Object"
|
||
msgstr "Objeto"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr "Opções do Pacote"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackagetype
|
||
msgid "PackageType"
|
||
msgstr "Tipo de Pacote"
|
||
|
||
#: lazarusidestrconsts.lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr "Provisão"
|
||
|
||
#: lazarusidestrconsts.lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr "Lançamento"
|
||
|
||
#: lazarusidestrconsts.lispckoptsruntimeonly
|
||
msgid "Runtime only"
|
||
msgstr "Apenas em Tempo Execução"
|
||
|
||
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
||
msgstr "O pacote %s%s%s tem o \"flag\" de instalação automática.%sIsto significa que ele será instalado na IDE. Pacotes de Instalação%sdevem ser pacotes de Tempo Projeto."
|
||
|
||
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr "Este pacote provê o mesmo que os pacotes à seguir:"
|
||
|
||
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
||
msgid "Update/Rebuild"
|
||
msgstr "Atualizar/Reconstruir"
|
||
|
||
#: lazarusidestrconsts.lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr "Uso"
|
||
|
||
#: lazarusidestrconsts.lispdabort
|
||
msgctxt "lazarusidestrconsts.lispdabort"
|
||
msgid "Abort"
|
||
msgstr "Abortar"
|
||
|
||
#: lazarusidestrconsts.lispdprogress
|
||
msgid "Progress"
|
||
msgstr "Progresso"
|
||
|
||
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Uma unidade pascal deve ter extensão .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts.lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr "Conflito encontrado"
|
||
|
||
#: lazarusidestrconsts.lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr "Editar Unidade Virtual"
|
||
|
||
#: lazarusidestrconsts.lispefilename
|
||
msgid "Filename:"
|
||
msgstr "Arquivo:"
|
||
|
||
#: lazarusidestrconsts.lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr "Corrigir Caixa Nome Arquivos"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr "Nome de arquivo de unidade inválido"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr "Nome de unidade inválido"
|
||
|
||
#: lazarusidestrconsts.lispemovefiledown
|
||
msgid "Move file down"
|
||
msgstr "Mover arquivo abaixo"
|
||
|
||
#: lazarusidestrconsts.lispemovefileup
|
||
msgid "Move file up"
|
||
msgstr "Mover arquivo acima"
|
||
|
||
#: lazarusidestrconsts.lispesortfiles
|
||
msgid "Sort files"
|
||
msgstr "Ordenar arquivos"
|
||
|
||
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
|
||
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Já existe uma unidade com este nome.%sArquivo: %s"
|
||
|
||
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
|
||
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr "O nome de unidade não é um identificador pascal válido."
|
||
|
||
#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
|
||
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
|
||
msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgstr "O nome de unidade é usado quando a IDE extende a cláusula \"uses\"."
|
||
|
||
#: lazarusidestrconsts.lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr "Nome de unidade:"
|
||
|
||
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Nome de unidade e nome de arquivo não coincidem.%sEx: unit1.pas e Unit1"
|
||
|
||
#: lazarusidestrconsts.lispeviewtodolist
|
||
msgid "View ToDo list"
|
||
msgstr "Exibir lista para fazer (ToDo)"
|
||
|
||
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr "Caminho adicional para fontes compilados"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr "Diretório de saída"
|
||
|
||
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr "Marca do Diretório Fonte do Pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr "Caminho de unidade"
|
||
|
||
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr "Você deseja realmente ignorar todas as alterações no pacote %s e recarregá-lo do arquivo?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr "Nova unidade não está no caminho de unidades"
|
||
|
||
#: lazarusidestrconsts.lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr "Publicar Pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr "Reverter pacote?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
||
msgstr "O arquivo %s%s%s%snão está atualmente no caminho de unidades do pacote.%s%sAdicionar %s%s%s ao caminho de unidades?"
|
||
|
||
#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
|
||
msgid "Online Help not yet implemented"
|
||
msgstr "Ajuda Online não implementada ainda."
|
||
|
||
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
||
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
||
msgstr "Clique com o botão direito na árvore de itens para obter um menu com todas as funções do pacote disponíveis."
|
||
|
||
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
|
||
msgid "There are more functions in the popupmenu"
|
||
msgstr "Há mais funções no menu \"PopUp\""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypebinary
|
||
msgid "Binary"
|
||
msgstr "Binário"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr "Arquivo de Inclusão"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr "Despacha arquivo xml"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr "LFM - Lazarus Form Text (Formulários)"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr "LRS - Lazarus Resource (Recursos)"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypemainunit
|
||
msgid "Main Unit"
|
||
msgstr "Unidade Principal"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypetext
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
||
msgid "Text"
|
||
msgstr "Texto"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeunit
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
|
||
msgid "Unit"
|
||
msgstr "Unidade"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr "Unidade Virtual"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s%s"
|
||
msgstr "%sAdicionando nova dependência para o pacote %s: pacote %s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s%s"
|
||
msgstr "%sAdicionando nova dependência para o projeto %s: pacote %s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr "Adicionar unidade à cláusula \"uses\" do pacote. Desative isto apenas para unidades, que não devem ser compiladas em todos os casos."
|
||
|
||
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr "Unidade ambígua encontrado"
|
||
|
||
#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
|
||
msgid "A required packages was not found. See package graph."
|
||
msgstr "Um pacote requerido não foi encontrado. Veja o gráfico de pacotes."
|
||
|
||
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr "Pacotes instalados automaticamente"
|
||
|
||
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr "%sAmbos os pacotes estão vinculados. Isto significa que um pacote usa o outro, ou ambos são usados por um terceiro pacote."
|
||
|
||
#: lazarusidestrconsts.lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr "Dependência quebrada"
|
||
|
||
#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
|
||
msgid "Circle in package dependencies"
|
||
msgstr "Referência circular nas dependências do pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr "Falha na exclusão"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr "Excluir arquivo de pacote antigo?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file %s%s%s?"
|
||
msgstr "Excluir arquivo de pacote antigo %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr "Dependência sem proprietário: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr "Erro na leitura do arquivo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr "Erro na leitura do Pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Erro na escrita do arquivo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr "Erro na escrita do Pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr "Arquivo já está no pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr "Arquivo está no Projeto"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr "Nome do arquivo difere do Nome do Pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr "Nome de arquivo em uso por outro pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr "Nome de arquivo em uso pelo projeto"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotfound
|
||
msgid "File %s%s%s not found."
|
||
msgstr "Arquivo %s%s%s não encontrado."
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr "Arquivo não salvo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
|
||
msgid "Ignore and save package now"
|
||
msgstr "Ignorar e salvar o pacote agora"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr "Instalando o pacote %s instalará automaticamente o pacote:"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr "Instalando o pacote %s instalará automaticamente os pacotes:"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr "Nome de arquivo do compilador inválido"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr "Extensão de arquivo inválida"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr "Extensão do arquivo de pacote inválida"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr "Nome de arquivo do pacote inválido"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr "Nome de pacote inválido"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr "Nome de Pacote Inválido"
|
||
|
||
#: lazarusidestrconsts.lispkgmanglazarus
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
||
msgstr "Carregar o pacote %s substituirá o pacote %s%sdo arquivo %s.%sO pacote antigo pacote será alterado.%s%sSalvar pacote antigo %s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr "NovoPacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr "Pacote: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagechangedsave
|
||
msgid "Package %s%s%s changed. Save?"
|
||
msgstr "Pacote %s%s%s alterado. Salvar?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr "Conflitos de Pacotes"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagefilemissing
|
||
msgid "Package file missing"
|
||
msgstr "Arquivo pacote faltando"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
|
||
msgid "Package file not saved"
|
||
msgstr "Arquivo pacote não salvo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
|
||
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
||
msgstr "Pacote %s%s%s não tem um diretório de saída válido:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is no designtime package"
|
||
msgstr "Pacote não é de Tempo Projeto"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr "Pacote requerido"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr "arquivo fonte principal do pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr "O nome do pacote já existe"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr "Pacotes devem ter a extensão .LPK"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr "Favor salvar o arquivo antes de adicioná-lo a um pacote."
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
|
||
msgid "Please save the package first."
|
||
msgstr "Favor salvar o pacote primeiro."
|
||
|
||
#: lazarusidestrconsts.lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr "Projeto: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr "Reconstruir Lazarus?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrenamefileinpackage
|
||
msgid "Rename file in package?"
|
||
msgstr "Renomear arquivo no pacote?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr "Renomear Arquivo para minúsculas?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file %s%s%s?"
|
||
msgstr "Substituir arquivo existente %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr "Substituir Arquivo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackage
|
||
msgid "Save Package?"
|
||
msgstr "Salvar Pacote?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackage2
|
||
msgid "Save package?"
|
||
msgstr "Salvar pacote?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr "Salvar Pacote %s (*.lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
||
msgstr "O arquivo deve ser renomeardo para minúsculas para%s%s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr "Saltar este pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr "Arquivo de configuração de pacotes estáticos"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr "O arquivo de compilador para o pacote %s não é um executável válido:%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "O arquivo %s%s%s%sjá está no pacote %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
||
msgid "The file %s%s%s is not a lazarus package."
|
||
msgstr "O arquivo %s%s%s não é um pacote lazarus."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
||
msgstr "O nome de arquivo %s%s%s não corresponde ao nome de pacote %s%s%sno arquivo.%sAlterar nome do pacote para %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr "O nome de arquivo %s%s%s é parte do projeto atual.%sProjetos e Pacotes não devem compartilhar arquivos."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
||
msgstr "O nome de arquivo %s%s%s está em uso por %sno pacote %s%s%s%sno arquivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
|
||
msgid "The file %s%s%s%sof package %s is missing."
|
||
msgstr "O arquivo %s%s%s%sdo pacote %s está faltando."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
|
||
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
||
msgstr "O arquivo %s%s%s%s do pacote %s precisa ser salvo primeiro."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr "Falha ao carregar o seguinte pacote:"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr "Falha ao carregar os seguintes pacotes:"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
||
msgstr "%sAs seguintes unidades serão adicionadas a seção \"uses\" de%s%s:%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
||
msgstr "Falha ao compilar o pacote %s%s%s.%sRemovê-lo da lista de instalação?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
||
msgstr "O nome de arquivo do pacote %s%s%s em%s%s%s%s não é um nome de pacote lazarus válido."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
||
msgstr "O pacote %s é um pacote somente de tempo de execução.%sOs pacotes somente de tempo de execução, não podem ser instalados no IDE."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr "O pacote %s%s%s está marcado para instalaçãoo, mas não pode ser encontrado.%sRemover dependência da lista de instalação de pacotes?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr "O pacote %s é requerido por %s, que está marcado para instalação.%sVeja o gráfico de pacotes."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr "O nome de pacote %s%s%s não é válido%sFavor escolher outro nome (ex: package1.lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
||
msgstr "O nome de pacote %s%s%s de%sdo arquivo %s%s%s é inválido."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
|
||
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
||
msgstr "O pacote %s é proprietário do arquivo%s%s%s%s.%sDeve o arquivo ser renomeado também no pacote?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "O pacote %s%s%s foi marcado.%sAtualmente Lazarus apenas suporta pacotes estaticamente vinculados. A desinstalação real necessita reconstruir e reiniciar o Lazarus.%s%sReconstruir o Lazarus agora?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "O pacote %s%s%s foi marcado para instalação.%sAtualmente Lazarus apenas suporta pacotes estaticamente vinculados. A instalação real necessita reconstruir e reiniciar o Lazarus.%s%sReconstruir o Lazarus agora?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr "O Projeto requer o pacote %s%s%s.%sMas ele não foi encontrado. Veja Projeto -> Inspetor de Projetos."
|
||
|
||
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
||
msgstr "Há duas unidades com o mesmo nome:%s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
|
||
msgid "There is a circle in the required packages. See package graph."
|
||
msgstr "Há uma referência circular no pacote requerido. Veja o gráfico de pacotes."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
||
msgstr "Há uma unidade FPC com o mesmo nome do pacote:%s%s%s%s%s%s "
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
||
msgstr "Há uma unidade FPC com o mesmo nome como: %s%s%s%s%s de %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
||
msgstr "Há outro pacote com o nome %s%s%s.%sPacote em conflito: %s%s%s%sArquivo: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
||
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
||
msgstr "Há um pacote %s%s%s carregado%sdo arquivo %s%s%s.%sVeja Componentes -> Gráfico de Pacotes.%sImpossível substituir."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr "Há um pacote não salvo nos pacotes requeridos. Veja o gráfico de pacotes."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
||
msgstr "Há uma unidade com o mesmo nome do pacote:%s%s1. %s%s%s de %s%s2. %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
||
msgid "This file was automatically created by Lazarus. Do not edit!"
|
||
msgstr "Este arquivo foi automaticamente criado pelo Lazarus. Não edite!"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr "Este é um pacote virtual. Ele não tem um fonte ainda. Favor salvar o pacote primeiro."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
||
msgid "This source is only used to compile and install the package."
|
||
msgstr "Este fonte é usado apenas para compilar e instalar o pacote."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr "Impossível criar o diretório"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
||
msgstr "Impossível criar o diretório de saída %s%s%s%spara o pacote %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
||
msgstr "Impossível criar um diretório fonte de pacote %s%s%s%spara o pacote %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
||
msgstr "Impossível criar diretório alvo para lazarus:%s%s%s%s.%sEste diretório é necessário para a nova IDE alterada com seus pacotes personalizados."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file %s%s%s."
|
||
msgstr "Impossível excluir arquivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr "Impossível excluir arquivo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
||
msgstr "Impossível excluir arquivo de estado antigo %s%s%s%spara pacote %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr "Impossível carregar pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
||
msgstr "Impossível abrir o pacote %s%s%s.%sEsse pacote foi marcado para instalação."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Impossível ler arquivo de estado %s%s%s%sdo pacote %s.%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
||
msgstr "Impossível escrever pacote %s%s%s%spara o arquivo %s%s%s.%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Impossível escrever arquivo de estado %s%s%s%sdo pacote %s.%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr "Desinstalar pacote?"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr "Desinstalar pacote %s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr "Pacote não salvo"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr "Usar unidade"
|
||
|
||
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
||
msgstr "Aviso: O arquivo %s%s%s%spertence ao projeto atual."
|
||
|
||
#: lazarusidestrconsts.lispkgreg
|
||
msgid "Package Registration"
|
||
msgstr "Registro Pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Can not register components without unit"
|
||
msgstr "Não se pode registrar componentes sem unidade"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
||
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
||
msgstr "Ferramentas de código - ferramentas e funções para analisar, navegar e editar fontes Pascal"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class %s%s%s already defined"
|
||
msgstr "Classe de componente %s%s%s já definida"
|
||
|
||
#: lazarusidestrconsts.lispkgsysfilename
|
||
msgid "%s%sFile Name: %s%s%s"
|
||
msgstr "%s%sNome do Aquivo: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr "Classe de componente inválida"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr "Nome de unidade inválido: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr "Arquivo de pacote não encontrado"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr "Procedimento de Registro nulo (\"nil\")"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr "Unidade de Registro foi chamada, mas o nenhum pacote está registrando."
|
||
|
||
#: lazarusidestrconsts.lispkgsysregistrationerror
|
||
msgid "Registration Error"
|
||
msgstr "Erro de Registro"
|
||
|
||
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
|
||
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
||
msgstr "SynEdit - O componente Editor utilizado pelo Lazarus. http://sourceforge.net/projects/synedit/"
|
||
|
||
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
||
msgstr "A FCL - Free Pascal Component Library (Biblioteca de Componentes do Free Pascal) provê as classes básicas do Object Pascal."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
||
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
||
msgstr "A LCL - Lazarus Component Library (Biblioteca de Componentes do Lazarus) contém todos os componentes básicos para edição de formulários. "
|
||
|
||
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr "O pacote %s%s%s está instalado, mas nenhum arquivo de pacote válido (.LPK) foi encontrado.%sUm pacote fictício foi criado."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
||
msgstr "A RTL - Run-Time Library (Biblioteca de Tempo de Execução) é a base de todos os programas Free Pascal."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr "Este é o pacote padrão. Usado apenas para componentes sem um pacote. Estes componentes são obsoletos."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr "Este pacote está instalado, mas o arquivo LPK não foi encontrado. Todos os seus componentes estão desativados. Favor corrigir."
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitname
|
||
msgid "%s%sUnit Name: %s%s%s"
|
||
msgstr "%s%sNome da unidade: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitnotfound
|
||
msgid "Unit not found: %s%s%s"
|
||
msgstr "Unidade não encontrada: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
|
||
msgid "Unit %s%s%s was removed from package"
|
||
msgstr "Unidade %s%s%s foi removida do pacote"
|
||
|
||
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr "O arquivo não está em nenhum pacote carregado."
|
||
|
||
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file %s%s%s.%sError: %s"
|
||
msgstr "Impossível ler arquivo de pacote %s%s%s.%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lispldexists
|
||
msgid "Exists"
|
||
msgstr "Existe"
|
||
|
||
#: lazarusidestrconsts.lispldglobal
|
||
msgid "Global"
|
||
msgstr "Global"
|
||
|
||
#: lazarusidestrconsts.lispldonlyexistingfiles
|
||
msgid "Only existing files"
|
||
msgstr "Somente arquivos existentes"
|
||
|
||
#: lazarusidestrconsts.lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr "Vínculos Pacote"
|
||
|
||
#: lazarusidestrconsts.lispldshowgloballinks
|
||
msgid "Show global links"
|
||
msgstr "Mostrar vínculos globais"
|
||
|
||
#: lazarusidestrconsts.lispldshowuserlinks
|
||
msgid "Show user links"
|
||
msgstr "Mostrar vínculos usuário"
|
||
|
||
#: lazarusidestrconsts.lisplduser
|
||
msgid "User"
|
||
msgstr "Usuário"
|
||
|
||
#: lazarusidestrconsts.lispleasecheckthecompilername
|
||
msgid "Please check the compiler name"
|
||
msgstr "Favor verificar o nome do compilador"
|
||
|
||
#: lazarusidestrconsts.lispleasecheckthefpcsourcedirectory
|
||
msgid "Please check the freepascal source directory"
|
||
msgstr "Favor verificar o diretório do fonte do Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr "Favor abrir uma unidade antes de executar."
|
||
|
||
#: lazarusidestrconsts.lispleaseselectabuildmodefirst
|
||
msgid "Please select a build mode first."
|
||
msgstr "Favor selecionar primeiro um modo de contrução"
|
||
|
||
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr "Favor selecionar algum código para extrair um novo procedimento/método."
|
||
|
||
#: lazarusidestrconsts.lisplistall
|
||
msgid "<All>"
|
||
msgstr "<Todos>"
|
||
|
||
#: lazarusidestrconsts.lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr "Alterar Fonte"
|
||
|
||
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr "Copiar nome de método para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr "Filtrar comparando qualquer parte do método"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr "Filtrar comparando com início do método"
|
||
|
||
#: lazarusidestrconsts.lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr "Saltar para a seleção"
|
||
|
||
#: lazarusidestrconsts.lisplistnone
|
||
msgid "<None>"
|
||
msgstr "<Nenhum>"
|
||
|
||
#: lazarusidestrconsts.lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr "&Objetos"
|
||
|
||
#: lazarusidestrconsts.lisplistprocedurelist
|
||
msgid "Procedure List"
|
||
msgstr "Lista Procedimentos"
|
||
|
||
#: lazarusidestrconsts.lisplisttype
|
||
msgctxt "lazarusidestrconsts.lisplisttype"
|
||
msgid "Type"
|
||
msgstr "Tipo"
|
||
|
||
#: lazarusidestrconsts.lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr "Escolha o diretório do arquivo .po"
|
||
|
||
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr "Não salvar informações de sessão"
|
||
|
||
#: lazarusidestrconsts.lispointer
|
||
msgid "Pointer"
|
||
msgstr "Ponteiro"
|
||
|
||
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
||
msgid "Save in IDE config directory"
|
||
msgstr "Salvar no diretório da IDE"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr "Salvar em arquivo .lpi"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr "Salvar em arquivo .lps no diretório de projeto"
|
||
|
||
#: lazarusidestrconsts.lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr "Salvar informação de sessão em"
|
||
|
||
#: lazarusidestrconsts.lisprecedingword
|
||
msgid "Preceding word"
|
||
msgstr "Palavra precedente"
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr "diretório primário de configuração, onde Lazarus armazena seus arquivos de configuração. O padrão é "
|
||
|
||
#: lazarusidestrconsts.lisprint
|
||
msgid "Print"
|
||
msgstr "Imprimir"
|
||
|
||
#: lazarusidestrconsts.lisprivate
|
||
msgid "Private"
|
||
msgstr "Privado"
|
||
|
||
#: lazarusidestrconsts.lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr "Método Privado"
|
||
|
||
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
||
msgstr "Provavelmente você necessita instalar alguns pacotes antes de continuar.%s%sAviso:%sO projeto depende de alguns pacotes, que contenham unidades com procedimento de Registro. O procedimento de Regitro é automaticamente usado para instalar componentes na IDE. Mas as seguintes unidades pertencem a pacotes que ainda não estão instalados na IDE. Se você tentar abrir um formulário na IDE, que usa tais componentes, você receberá erros sobre componentes faltando e o carregamento do formulário provavelmente criará resultados desagradáveis.%s%sIsto não tem impacto ao abrir o projeto ou algum de seus fontes.%s%sIsto apenas significa: Não é uma boa ideia abrir formulários para edição, antes de instalar os pacotes que faltam.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprocedure
|
||
msgctxt "lazarusidestrconsts.lisprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Procedimento"
|
||
|
||
#: lazarusidestrconsts.lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr "Procedimento com interface"
|
||
|
||
#: lazarusidestrconsts.lisprogram
|
||
msgctxt "lazarusidestrconsts.lisprogram"
|
||
msgid "Program"
|
||
msgstr "Programa"
|
||
|
||
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
|
||
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Programa%sUm programa Free Pascal. O programa é automaticamente mantido pelo Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr "Programa detectado"
|
||
|
||
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
||
msgstr "O fonte do programa precisa ter uma extensão Pascal como .pas, .pp ou .lpr"
|
||
|
||
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
||
msgid "Add files to project"
|
||
msgstr "Adicionar arquivos ao projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojaddaddfiletoproject
|
||
msgid "Add file to project:"
|
||
msgstr "Adicionar arquivo ao projeto:"
|
||
|
||
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr "Já existe a dependência"
|
||
|
||
#: lazarusidestrconsts.lisprojaddeditorfile
|
||
msgid "Add editor files"
|
||
msgstr "Adicionar arquivos do editor"
|
||
|
||
#: lazarusidestrconsts.lisprojaddfiles
|
||
msgid "Add files"
|
||
msgstr "Adicionar arquivos"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr "Versão Min-Max inválida"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpackagename
|
||
msgid "Invalid packagename"
|
||
msgstr "Nome de pacote inválido"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
||
msgid "Invalid pascal unit name"
|
||
msgstr "Nome de unidade Pascal inválido"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr "Versão Inválida"
|
||
|
||
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr "Versão Máxima (opcional):"
|
||
|
||
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr "Versão Mínima (opcional):"
|
||
|
||
#: lazarusidestrconsts.lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr "Novo Requerimento"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr "Nome do Pacote:"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr "Pacote não encontrado"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
||
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
||
msgstr "A dependência %s%s%s não foi encontrada.%sFavor escolher um pacote existente."
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "A Versão Máxima %s%s%s é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "A Versão Máxima é menor que a Versão Mínima."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "A Versão Mínima %s%s%s é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
||
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
||
msgstr "O nome do pacote %s%s%s é inválido.%sPor favor escolha um pacote existente."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package %s%s%s."
|
||
msgstr "o projeto já tem uma dependência para o pacote %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
||
msgstr "O nome da unidade %s%s%s já existe no projeto%scom arquivo: %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
||
msgstr "O nome da unidade %s%s%s já existe na seleção%scom arquivo: %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
||
msgstr "O nome de unidade %s%s%s não é um identificador Pascal válido."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtoproject
|
||
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
||
msgid "Add to project"
|
||
msgstr "Adicionar ao Projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr "Nome da unidade já existe"
|
||
|
||
#: lazarusidestrconsts.lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr "Projeto alterado"
|
||
|
||
#: lazarusidestrconsts.lisprojectchangedondisk
|
||
msgid "Project changed on disk"
|
||
msgstr "Projeto alterado no disco"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectory
|
||
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Diretório do projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
||
msgid "Title in taskbar shows also directory path of the project"
|
||
msgstr "Título na Barra de Tarefas também mostra o caminho do projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr "Nome de arquivo do projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr "Caminho inclusões do projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr "Arquivo de informações de projeto detectado"
|
||
|
||
#: lazarusidestrconsts.lisprojectinformation
|
||
msgid "Project Information"
|
||
msgstr "Informação do Projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr "Projeto é executável"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr "Propriedades macro do projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacrounitpath
|
||
msgid "macro ProjectUnitPath"
|
||
msgstr "macro \"ProjectUnitPath\""
|
||
|
||
#: lazarusidestrconsts.lisprojectoutdir
|
||
msgid "Project Output directory (e.g. the ppu directory)"
|
||
msgstr "Diretório de saída do Projeto (ex. o diretório ppu)"
|
||
|
||
#: lazarusidestrconsts.lisprojectpath
|
||
msgid "Project Path:"
|
||
msgstr "Caminho Projeto:"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
||
msgid "Project %s raised exception class '%s'."
|
||
msgstr "Projeto %s elevou classe exceção '%s'."
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
||
msgid "Project %s raised exception class '%s' with message:%s%s"
|
||
msgstr "Projeto %s elevou classe exceção '%s' com a mensagem:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr "Caminho Fonte do Projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
|
||
#| msgid "Project %s%s%s successfully built. :)"
|
||
msgid "Project %s%s%s successfully built"
|
||
msgstr "Projeto %s%s%s criado com sucesso."
|
||
|
||
#: lazarusidestrconsts.lisprojectunit
|
||
msgid "project unit"
|
||
msgstr "unidade projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr "Caminho unidades do projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojectwizard
|
||
msgid "Project Wizard"
|
||
msgstr "Assistente de Projeto"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr "Confirmar exclusão de dependência"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr "Confirmar remoção arquivo"
|
||
|
||
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr "Excluir dependência para %s?"
|
||
|
||
#: lazarusidestrconsts.lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr "Inspetor de Projetos - %s"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
||
msgid "Removed required packages"
|
||
msgstr "Pacotes requeridos removidos"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr "Remover arquivo %s do projeto?"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr "Impossível ler arquivo de estado %s do projeto %s%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr "Impossível escrever arquivo de estado para o projeto %s%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr "Sempre construir (mesmo se nada for alterado)"
|
||
|
||
#: lazarusidestrconsts.lisprojoptserror
|
||
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
||
msgid "Error"
|
||
msgstr "Erro"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr "Impossível alterar a lista de auto-criação de formulários no fonte do programa.%sFavor corrigir os erros primeiro."
|
||
|
||
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr "Marca do Diretório Fonte do Projeto"
|
||
|
||
#: lazarusidestrconsts.lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr "Perguntar por valor"
|
||
|
||
#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
|
||
msgid "Properties of conditional compiler option"
|
||
msgstr "Propriedades das opções condicionais do compilador"
|
||
|
||
#: lazarusidestrconsts.lisprotected
|
||
msgid "Protected"
|
||
msgstr "Protegido"
|
||
|
||
#: lazarusidestrconsts.lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr "Método Protegido"
|
||
|
||
#: lazarusidestrconsts.lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr "Método Publico"
|
||
|
||
#: lazarusidestrconsts.lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr "Método Publicado"
|
||
|
||
#: lazarusidestrconsts.lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr "Diretório publicação do projeto"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
||
msgid "Invalid Exclude filter"
|
||
msgstr "Filtro de Exclusão inválido"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
||
msgid "Invalid Include filter"
|
||
msgstr "Filtro de Inclusão inválido"
|
||
|
||
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
||
msgid "Save .lrs files in the output directory"
|
||
msgstr "Salvar arquivo .LRS no diretório de saída."
|
||
|
||
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Uma unidade Pascal deve ter extensão .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts.lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr "Editar unidade virtual"
|
||
|
||
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
||
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Já existe uma unidade com este nome.%sArquivo: %s"
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr "O nome de unidade não é um identificador pascal válido."
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
||
msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgstr "O nome de unidade é usado quando a IDE extende a cláusula \"uses\"."
|
||
|
||
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Nome de unidade e Nome de arquivo não coincidem.%sEx: unit1.pas e Unit1"
|
||
|
||
#: lazarusidestrconsts.lispwconvertproject
|
||
msgid "Convert Delphi Project"
|
||
msgstr "Converter Projeto Delphi"
|
||
|
||
#: lazarusidestrconsts.lispwnewproject
|
||
msgid "New Project"
|
||
msgstr "Novo Projeto"
|
||
|
||
#: lazarusidestrconsts.lispwopenproject
|
||
msgid "Open Project"
|
||
msgstr "Abrir Projeto"
|
||
|
||
#: lazarusidestrconsts.lispwopenrecentproject
|
||
#| msgid "Open Recent"
|
||
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
||
msgid "Open Recent Project"
|
||
msgstr "Abrir Projeto Recente"
|
||
|
||
#: lazarusidestrconsts.lisquickfixes
|
||
msgid "Quick fixes"
|
||
msgstr "Reparos rápidos"
|
||
|
||
#: lazarusidestrconsts.lisquitlazarus
|
||
msgid "Quit Lazarus"
|
||
msgstr "Sair do Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisreaderror
|
||
msgid "Read Error"
|
||
msgstr "Erro de Leitura"
|
||
|
||
#: lazarusidestrconsts.lisrecordstruct
|
||
msgid "Record/Structure"
|
||
msgstr "Registro/Estrutura"
|
||
|
||
#: lazarusidestrconsts.lisregisters
|
||
msgctxt "lazarusidestrconsts.lisregisters"
|
||
msgid "Registers"
|
||
msgstr "Registradores"
|
||
|
||
#: lazarusidestrconsts.lisregistersdlgname
|
||
msgctxt "lazarusidestrconsts.lisregistersdlgname"
|
||
msgid "Name"
|
||
msgstr "Nome"
|
||
|
||
#: lazarusidestrconsts.lisregistersdlgvalue
|
||
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
|
||
msgid "Value"
|
||
msgstr "Valor"
|
||
|
||
#: lazarusidestrconsts.lisregularexpression
|
||
msgid "Regular expression"
|
||
msgstr "Expressão regular"
|
||
|
||
#: lazarusidestrconsts.lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr "Caminhos relativos"
|
||
|
||
#: lazarusidestrconsts.lisremove
|
||
msgid "remove"
|
||
msgstr "remover"
|
||
|
||
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr "Remover todas as propriedades inválidas"
|
||
|
||
#: lazarusidestrconsts.lisremoveallunits
|
||
msgid "Remove all units"
|
||
msgstr "Remover todas unidades"
|
||
|
||
#: lazarusidestrconsts.lisremovefromproject
|
||
msgid "Remove from project"
|
||
msgstr "Remover do projeto"
|
||
|
||
#: lazarusidestrconsts.lisremovefromsearchpath
|
||
msgid "Remove from search path"
|
||
msgstr "Remover do caminho de busca"
|
||
|
||
#: lazarusidestrconsts.lisremoveselectedunits
|
||
msgid "Remove selected units"
|
||
msgstr "Remover unidades selecionadas"
|
||
|
||
#: lazarusidestrconsts.lisremovethem
|
||
msgid "Remove them"
|
||
msgstr "Removê-los"
|
||
|
||
#: lazarusidestrconsts.lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr "Renomear arquivo?"
|
||
|
||
#: lazarusidestrconsts.lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr "Falha ao renomear arquivo"
|
||
|
||
#: lazarusidestrconsts.lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr "Renomear para minúsculas"
|
||
|
||
#: lazarusidestrconsts.lisreopenproject
|
||
msgid "Reopen project"
|
||
msgstr "Reabrir projeto"
|
||
|
||
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
||
msgid "Reopen with another encoding"
|
||
msgstr "Reabrir com outra codificação"
|
||
|
||
#: lazarusidestrconsts.lisrepeatcount
|
||
msgid "Repeat Count:"
|
||
msgstr "Núm. Repetição:"
|
||
|
||
#: lazarusidestrconsts.lisreplacementproptypes
|
||
msgid "Replacement Properties and Types"
|
||
msgstr "Substituição Propriedades e Tipos"
|
||
|
||
#: lazarusidestrconsts.lisreplaceremoveunknown
|
||
msgid "Replace unknown types and properties"
|
||
msgstr "Substituir tipos e propriedades desconhecidas"
|
||
|
||
#: lazarusidestrconsts.lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr "Substituição da seleção falhou."
|
||
|
||
#: lazarusidestrconsts.lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
|
||
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
|
||
msgid "Requires FPC 2.4 or above. Like Delphi resources"
|
||
msgstr "Requer FPC 2.4 ou maior. Como recursos Delphi"
|
||
|
||
#: lazarusidestrconsts.lisrescan
|
||
msgid "Rescan"
|
||
msgstr "Re-examinar"
|
||
|
||
#: lazarusidestrconsts.lisresourceloaderror
|
||
msgid "Resource load error"
|
||
msgstr "Erro no carregamento de recurso"
|
||
|
||
#: lazarusidestrconsts.lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr "Erro ao salvar recurso"
|
||
|
||
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
||
msgid "Resource type of project:"
|
||
msgstr "Tipo recurso do projeto:"
|
||
|
||
#: lazarusidestrconsts.lisresult
|
||
msgid "Result :="
|
||
msgstr "Resulta :="
|
||
|
||
#: lazarusidestrconsts.lisresult2
|
||
msgid "Result:"
|
||
msgstr "Resultado:"
|
||
|
||
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
||
msgid "returns list of all values of case variable in front of variable"
|
||
msgstr "retorna lista de todos os valores da variável \"case\" em frente da variável"
|
||
|
||
#: lazarusidestrconsts.lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr "Falha na reversão"
|
||
|
||
#: lazarusidestrconsts.lisright
|
||
msgctxt "lazarusidestrconsts.lisright"
|
||
msgid "Right"
|
||
msgstr "Direito"
|
||
|
||
#: lazarusidestrconsts.lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr "Ancoragem a direita"
|
||
|
||
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr "Espaço da borda Direita. Este valor será adicionado ao espaço da borda base e usado para o espaço direito do controle."
|
||
|
||
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
||
msgstr "Este é o controle irmão ao qual o lado direito está ancorado. Deixar vazio para o controle-pai."
|
||
|
||
#: lazarusidestrconsts.lisrightsides
|
||
msgid "Right sides"
|
||
msgstr "Lados Direito"
|
||
|
||
#: lazarusidestrconsts.lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr "Justificar à direita"
|
||
|
||
#: lazarusidestrconsts.lisroot
|
||
msgid "Root"
|
||
msgstr "Raiz"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr "Arquivo não executável"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application %s%s%s is not executable."
|
||
msgstr "A aplicação servidora %s%s%s não é executável."
|
||
|
||
#: lazarusidestrconsts.lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr "Falha executar até"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
||
msgid "Abstract methods - not yet overridden"
|
||
msgstr "Métodos abstratos - não sobrepostos ainda"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsof
|
||
msgid "Abstract methods of %s"
|
||
msgstr "Método abstrato de %s"
|
||
|
||
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr "Cursor não está em uma declaração de classe"
|
||
|
||
#: lazarusidestrconsts.lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr "IDE está ocupada"
|
||
|
||
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr "%s é uma classe abstrata, e tem %s métodos abstratos."
|
||
|
||
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr "Nenhum método abstrato encontrado"
|
||
|
||
#: lazarusidestrconsts.lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr "Sobrepor todos selecionados"
|
||
|
||
#: lazarusidestrconsts.lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr "Sobrepor primeiro selecionado"
|
||
|
||
#: lazarusidestrconsts.lissamselectnone
|
||
msgid "Select none"
|
||
msgstr "Selecionar nenhum"
|
||
|
||
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr "Existem %s métodos abstratos para sobrepor.%sSelecionar os métodos para os quais devem ser criados \"stubs\":"
|
||
|
||
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr "Não existem métodos abstrados sobrando para sobrepor."
|
||
|
||
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr "Este método não pode ser sobreposto porque está definido na classe atual"
|
||
|
||
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr "Impossível mostrar métodos abstratos da classe atual, porque"
|
||
|
||
#: lazarusidestrconsts.lissave
|
||
msgid "Save ..."
|
||
msgstr "Salvar ..."
|
||
|
||
#: lazarusidestrconsts.lissaveallmessagestofile
|
||
msgid "Save all messages to file"
|
||
msgstr "Salvar todas as mensagens para arquivo"
|
||
|
||
#: lazarusidestrconsts.lissaveallmodified
|
||
msgid "save all modified files"
|
||
msgstr "salvar todos os arquivos alterados"
|
||
|
||
#: lazarusidestrconsts.lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr "Salvar e fechar diálogo"
|
||
|
||
#: lazarusidestrconsts.lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr "Salvar e reconstruir IDE"
|
||
|
||
#: lazarusidestrconsts.lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "Salvar alterações?"
|
||
|
||
#: lazarusidestrconsts.lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr "Salvar alterações no projeto \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lissavecurrenteditorfile
|
||
msgid "save current editor file"
|
||
msgstr "salvar o arquivo atual do editor"
|
||
|
||
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr "Salvar informações do editor de arquivos que não são do projeto"
|
||
|
||
#: lazarusidestrconsts.lissavefileas
|
||
msgid "Save file as"
|
||
msgstr "Salvar arquivo como"
|
||
|
||
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
||
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
||
msgstr "Salvar arquivo %s%s%s%santes de fechar o formulário %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr "Salvar informações de arquivos fechados do editor"
|
||
|
||
#: lazarusidestrconsts.lissaveproject
|
||
msgid "Save project %s (*%s)"
|
||
msgstr "Salvar projeto %s (*%s)"
|
||
|
||
#: lazarusidestrconsts.lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "Salvar Configurações"
|
||
|
||
#: lazarusidestrconsts.lissavespace
|
||
msgid "Save "
|
||
msgstr "Salvar "
|
||
|
||
#: lazarusidestrconsts.lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr "Fator de Escala:"
|
||
|
||
#: lazarusidestrconsts.lissearchfor
|
||
msgid "Search For "
|
||
msgstr "Localizar por"
|
||
|
||
#: lazarusidestrconsts.lissearchunit
|
||
msgid "Search unit"
|
||
msgstr "Procurar unidade"
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr "diretório de configuração secundário, onde Lazarus procura por arquivos de configuração de modelos. Padrão é"
|
||
|
||
#: lazarusidestrconsts.lisseemessages
|
||
msgid "See messages."
|
||
msgstr "Veja mensagens."
|
||
|
||
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr "%sVer Projeto -> Inspetor de Projetos"
|
||
|
||
#: lazarusidestrconsts.lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr "Selecionar um item de ajuda:"
|
||
|
||
#: lazarusidestrconsts.lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "Selecione uma ramificação"
|
||
|
||
#: lazarusidestrconsts.lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr "Selecionar arquivos de formulários Delphi (*.dfm)"
|
||
|
||
#: lazarusidestrconsts.lisselected
|
||
msgid "Selected"
|
||
msgstr "Selecionado"
|
||
|
||
#: lazarusidestrconsts.lisselectedbottomneighbour
|
||
#, fuzzy
|
||
msgid "(selected bottom neighbour)"
|
||
msgstr "(vizinho dos fundos selecionado)"
|
||
|
||
#: lazarusidestrconsts.lisselectedleftneighbour
|
||
#, fuzzy
|
||
msgid "(selected left neighbour)"
|
||
msgstr "(vizinho da esquerda selecionado)"
|
||
|
||
#: lazarusidestrconsts.lisselectedrightneighbour
|
||
#, fuzzy
|
||
msgid "(selected right neighbour)"
|
||
msgstr "(vizinho da direita selecionado)"
|
||
|
||
#: lazarusidestrconsts.lisselectedtopneighbour
|
||
#, fuzzy
|
||
msgid "(selected top neighbour)"
|
||
msgstr "(vizinho do topo selecionado)"
|
||
|
||
#: lazarusidestrconsts.lisselectfile
|
||
msgid "Select the file"
|
||
msgstr "Selecionar o arquivo"
|
||
|
||
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr "Seleção excede a constante de sequência de caracteres"
|
||
|
||
#: lazarusidestrconsts.lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr "Ferramenta de seleção"
|
||
|
||
#: lazarusidestrconsts.lisselecttheactivebuildmode
|
||
msgid "Select the active build mode"
|
||
msgstr "Selecione o modo construção ativo"
|
||
|
||
#: lazarusidestrconsts.lissetdefault
|
||
msgid "Set default"
|
||
msgstr "Ajustar padrão"
|
||
|
||
#: lazarusidestrconsts.lissetvalue
|
||
msgid "Set value"
|
||
msgstr "Ajustar valor"
|
||
|
||
#: lazarusidestrconsts.lisshort
|
||
msgid "Short:"
|
||
msgstr "Curto:"
|
||
|
||
#: lazarusidestrconsts.lisshow
|
||
msgid "Show"
|
||
msgstr "Mostrar"
|
||
|
||
#: lazarusidestrconsts.lisshowemptyunitspackages
|
||
msgid "Show empty units/packages"
|
||
msgstr "Mostrar unidades/pacotes vazios"
|
||
|
||
#: lazarusidestrconsts.lisshowglyphsfor
|
||
msgid "Show Glyphs for:"
|
||
msgstr "Mostrar \"Glyphs\" para:"
|
||
|
||
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
||
msgid "Show gutter"
|
||
msgstr "Mostrar medianiz"
|
||
|
||
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
||
msgid "Show hints"
|
||
msgstr "Mostrar dicas no Inspetor de Objetos"
|
||
|
||
#: lazarusidestrconsts.lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr "Mostrar identificadores"
|
||
|
||
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
||
msgid "Show information box"
|
||
msgstr "Mostrar caixa de informação"
|
||
|
||
#: lazarusidestrconsts.lisshowoldtaborder
|
||
msgid "Show old tab order"
|
||
msgstr "Mostrar ordem de tabulação antiga"
|
||
|
||
#: lazarusidestrconsts.lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr "Mostrar pacotes"
|
||
|
||
#: lazarusidestrconsts.lisshowspecialcharacters
|
||
msgid "Show special characters"
|
||
msgstr "Mostrar caracteres especiais"
|
||
|
||
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
||
msgid "Show status bar"
|
||
msgstr "Mostrar barra de estado"
|
||
|
||
#: lazarusidestrconsts.lisshowunits
|
||
msgid "Show units"
|
||
msgstr "Mostrar unidades"
|
||
|
||
#: lazarusidestrconsts.lisshowversionandexit
|
||
msgid "show version and exit"
|
||
msgstr "mostrar versão e sair"
|
||
|
||
#: lazarusidestrconsts.lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr "Encolher ao menor"
|
||
|
||
#: lazarusidestrconsts.lissibling
|
||
msgid "Sibling"
|
||
msgstr "Irmão"
|
||
|
||
#: lazarusidestrconsts.lissimplesyntax
|
||
msgid "Simple Syntax"
|
||
msgstr "Sintaxe Simples"
|
||
|
||
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr "Saltar arquivo e continuar carregando"
|
||
|
||
#: lazarusidestrconsts.lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr "Ignorar carregamento do último projeto"
|
||
|
||
#: lazarusidestrconsts.lissmallerratherthanfaster
|
||
msgid "smaller rather than faster"
|
||
msgstr "Menor ao invés de mais rápido"
|
||
|
||
#: lazarusidestrconsts.lissmatches
|
||
msgid "Matches"
|
||
msgstr "Resultados"
|
||
|
||
#: lazarusidestrconsts.lissorrynotimplementedyet
|
||
msgid "Sorry, not implemented yet"
|
||
msgstr "Desculpe, não implementado ainda"
|
||
|
||
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr "Desculpe, este tipo ainda não foi implementado"
|
||
|
||
#: lazarusidestrconsts.lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "Ascendente"
|
||
|
||
#: lazarusidestrconsts.lissortselcancel
|
||
msgctxt "lazarusidestrconsts.lissortselcancel"
|
||
msgid "Cancel"
|
||
msgstr "Cancelar"
|
||
|
||
#: lazarusidestrconsts.lissortselcasesensitive
|
||
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
||
msgid "&Case Sensitive"
|
||
msgstr "&Sensível maiúsc./minúsc."
|
||
|
||
#: lazarusidestrconsts.lissortseldescending
|
||
msgid "Descending"
|
||
msgstr "Descendente"
|
||
|
||
#: lazarusidestrconsts.lissortseldomain
|
||
msgid "Domain"
|
||
msgstr "Domínio"
|
||
|
||
#: lazarusidestrconsts.lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr "Ignorar Espaço"
|
||
|
||
#: lazarusidestrconsts.lissortsellines
|
||
msgid "Lines"
|
||
msgstr "Linhas"
|
||
|
||
#: lazarusidestrconsts.lissortseloptions
|
||
msgctxt "lazarusidestrconsts.lissortseloptions"
|
||
msgid "Options"
|
||
msgstr "Opções"
|
||
|
||
#: lazarusidestrconsts.lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr "Parágrafos"
|
||
|
||
#: lazarusidestrconsts.lissortselpreview
|
||
msgctxt "lazarusidestrconsts.lissortselpreview"
|
||
msgid "Preview"
|
||
msgstr "Visualizar"
|
||
|
||
#: lazarusidestrconsts.lissortselsort
|
||
msgid "Accept"
|
||
msgstr "Aceitar"
|
||
|
||
#: lazarusidestrconsts.lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr "Ordenar Seleção"
|
||
|
||
#: lazarusidestrconsts.lissortselwords
|
||
msgctxt "lazarusidestrconsts.lissortselwords"
|
||
msgid "Words"
|
||
msgstr "Palavras"
|
||
|
||
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr "Fonte e Destino são os mesmos:%s%s"
|
||
|
||
#: lazarusidestrconsts.lissourcebreakpoint
|
||
msgid "&Source breakpoint"
|
||
msgstr "&Ponto de parada Fonte"
|
||
|
||
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
||
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
||
msgstr "Diretório Fonte %s%s%s%s e diretório destino %s%s%s%ssão os mesmos.%s%sTalvez você não tenha entendido este recurso.%sEle irá limpar/recriar o diretório destino%se copiar o pacote/projeto para lá."
|
||
|
||
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
||
msgid "Source directory %s%s%s does not exist."
|
||
msgstr "Diretório fonte %s%s%s não existe."
|
||
|
||
#: lazarusidestrconsts.lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr "Fonte modificado"
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
||
msgid "Source of page %s%s%s has changed. Save?"
|
||
msgstr "Fonte da página %s%s%s foi alterado. Salvar?"
|
||
|
||
#: lazarusidestrconsts.lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr "Caminhos dos fontes"
|
||
|
||
#: lazarusidestrconsts.lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr "Justificar"
|
||
|
||
#: lazarusidestrconsts.lissrcos
|
||
msgid "Src OS"
|
||
msgstr "SO Fonte"
|
||
|
||
#: lazarusidestrconsts.lisssearching
|
||
msgid "Searching"
|
||
msgstr "Localizando"
|
||
|
||
#: lazarusidestrconsts.lisssearchtext
|
||
msgid "Search text"
|
||
msgstr "Localizar texto"
|
||
|
||
#: lazarusidestrconsts.lisstartconversion
|
||
msgid "Start Conversion"
|
||
msgstr "Iniciar Conversão"
|
||
|
||
#: lazarusidestrconsts.lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr "Iniciar um novo projeto"
|
||
|
||
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr "Parar a depuração atual e reconstruir o projeto?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr "Parar Depuração?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr "Parar depuração?"
|
||
|
||
#: lazarusidestrconsts.lisstoponexception
|
||
msgid "Stop on exception"
|
||
msgstr "Parar em exceções"
|
||
|
||
#: lazarusidestrconsts.lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr "Parar a depuração?"
|
||
|
||
#: lazarusidestrconsts.lisstrangelpifile
|
||
msgid "Strange lpi file"
|
||
msgstr "Arquivo lpi estranho"
|
||
|
||
#: lazarusidestrconsts.lisstreamerror
|
||
msgid "Stream Error"
|
||
msgstr "Erro de Fluxo"
|
||
|
||
#: lazarusidestrconsts.lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr "Erro de Fluxo"
|
||
|
||
#: lazarusidestrconsts.lisstring
|
||
msgid "String"
|
||
msgstr "Sequência de caracteres"
|
||
|
||
#: lazarusidestrconsts.lisstyle
|
||
msgctxt "lazarusidestrconsts.lisstyle"
|
||
msgid "Style"
|
||
msgstr "Estilo"
|
||
|
||
#: lazarusidestrconsts.lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr "Sub procedimento"
|
||
|
||
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr "Sub procedimento no mesmo nível"
|
||
|
||
#: lazarusidestrconsts.lissuccess
|
||
msgid "Success"
|
||
msgstr "Sucesso"
|
||
|
||
#: lazarusidestrconsts.lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr "Revisão SVN: "
|
||
|
||
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr "Nome de variável inválido"
|
||
|
||
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
||
msgid "%s%s%s is not a valid identifier."
|
||
msgstr "%s%s%s não é um identificador válido."
|
||
|
||
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr "Sobrepor variável de sistema"
|
||
|
||
#: lazarusidestrconsts.lissynedit
|
||
msgid "SynEdit"
|
||
msgstr "SynEdit"
|
||
|
||
#: lazarusidestrconsts.lissyntaxmode
|
||
msgid "Syntax mode"
|
||
msgstr "Modo sintaxe"
|
||
|
||
#: lazarusidestrconsts.listab
|
||
msgid "Tab"
|
||
msgstr "Tabulação"
|
||
|
||
#: lazarusidestrconsts.listaborderof
|
||
msgid "Tab Order of"
|
||
msgstr "Order tabulação de"
|
||
|
||
#: lazarusidestrconsts.listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr "CPU Alvo"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr "Nome de arquivo alvo do projeto"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr "Nome Arquivo Alvo + parâmetros"
|
||
|
||
#: lazarusidestrconsts.listargetos
|
||
msgctxt "lazarusidestrconsts.listargetos"
|
||
msgid "Target OS"
|
||
msgstr "SO Alvo"
|
||
|
||
#: lazarusidestrconsts.listcompilerinternalerror
|
||
msgid "Internal compiler error! (%d)"
|
||
msgstr "Erro interno do compilador (%d)"
|
||
|
||
#: lazarusidestrconsts.listddinserttodo
|
||
msgid "Insert ToDo"
|
||
msgstr "Inserir Para Fazer (ToDo)"
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcell
|
||
msgid "Editable Cell"
|
||
msgstr "Célula Editável"
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
||
msgid ""
|
||
"Inserts an editable Cell, with a default value\n"
|
||
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
|
||
"\"default\",Sync, to Sync with a previous cell of equal default\n"
|
||
msgstr ""
|
||
"Insere uma Célula editável, com um valor padrão\n"
|
||
"\"\",Sync=n (,S=n), para Sincr. com uma célula anterior (n=1 maior célula anterior\n"
|
||
"\"padrão\",Sync, para Sincr. com uma célula anterior de igual padrão\n"
|
||
|
||
#: lazarusidestrconsts.listestdirectory
|
||
msgid "Test directory"
|
||
msgstr "Diretório de teste"
|
||
|
||
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
||
msgstr "A classe %s%s%s é um TControl e não pode ser colada em um objeto que não é um controle.%sImpossível colar."
|
||
|
||
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
||
msgid "The codetools found an error:%s%s%s"
|
||
msgstr "As ferramentas de código encontraram um erro:%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
||
msgid "The command after %s%s%s is not executable."
|
||
msgstr "O comando posterior %s%s%s não é executável."
|
||
|
||
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s%s%s%s"
|
||
msgstr "O comando após a publicação é inválido:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
||
msgid "The component %s can not be deleted, because it is not owned by %s."
|
||
msgstr "O componente %s não pode ser excluído, porque é propriedade de %s."
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
||
msgstr "O editor de componente da classe %s%s%s criou o erro:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
||
msgstr "O componente editor da classe %s%s%schamado com o verbob #%s %s%s%s%sfoi criado com o erro:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
||
msgstr "O componente %s é herdado de %s.%sPara excluir o componente herdado, abra o ancestral e exclua de lá."
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
||
msgstr "O componente %s é herdado de %s.%sPara renomear um componente herdado abra seu ancestral e renomei-o lá."
|
||
|
||
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
||
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
|
||
msgstr "O nome do componente deve ser único entre todos os componentes no formulário/\"datamodule\".O nome é comparado de forma insensível à caixa como um identificador pascal normal."
|
||
|
||
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "O nome de arquivo atual do compilador %s%s%s%s não é um executável válido.%sClique Ok para escolher o padrão %s%s%s.%sCaso contrário verifique Ambiente -> Opções de Ambiente -> Arquivos"
|
||
|
||
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "O nome de arquivo atual do compilador %s%s%s%snão é um executável válido.%sFavor verificar Ambiente -> Opções de Ambiente -> Arquivos"
|
||
|
||
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "O diretório atual do fonte do Free Pascal %s%s%s%snão parece correto.%sClique Ok para escolher o padrão %s%s%s.%sCaso contrário verifique Ambiente -> Opções de Ambiente -> Arquivos"
|
||
|
||
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "O diretório atual do fonte do Free Pascal %s%s%s%snão parece correto.%sVerifique Ambiente -> Opções de Ambiente -> Arquivos"
|
||
|
||
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "O diretório atual do Lazarus %s%s%s%snão parece correto.%sSem ele você não poderá criar aplicações LCL.%sClique Ok para escolher o padrão %s%s%s.%sCaso contrário verifique Ambiente -> Opções de Ambiente -> Arquivos"
|
||
|
||
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "O diretório atual do Lazarus %s%s%s%snão parece correto.%sSem ele você não poderá criar aplicações LCL.%sVerifique Ambiente -> Opções de Ambiente -> Arquivos"
|
||
|
||
#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
|
||
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
||
msgstr "O caminho de unidades atual para o arquivo%s%s%s%s é %s%s%s%s.%sO caminho para unidades LCL %s%s%s está faltando.%s%sDica para novatos:%sCrie uma aplicação Lazarus e coloque o arquivo em um diretório de projeto."
|
||
|
||
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
||
msgstr "O depurador %s%s%s%snão existe ou não é executável.%s%sVeja Ambiente -> Opções do Depurador"
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s%s%s%s does not exist."
|
||
msgstr "O diretório de destino%s%s%s%s não existe."
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
||
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
||
msgstr "O diretório destino %s%s%s não existe.%sFavor verificar o nome do arquivo alvo do projeto. Menu -> Projeto -> Opções Projeto."
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
||
msgstr "O diretório %s%s%s não é mais necessário no caminho das unidades.%sRemovê-lo?"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
||
msgid "The directory %s%s%s is not writable."
|
||
msgstr "O diretório %s%s%s não é gravável"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
||
msgstr "O diretório %s%s%s ainda não está no caminho de unidades.%sAdicioná-lo?"
|
||
|
||
#: lazarusidestrconsts.listhedirectorywasnotfound
|
||
msgid "The directory %s was not found."
|
||
msgstr "O diretório %s não foi encontrado."
|
||
|
||
#: lazarusidestrconsts.listhefile
|
||
msgid "The file %s%s%s"
|
||
msgstr "O arquivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
||
msgid "The file %s does not look like a lpi file."
|
||
msgstr "O arquivo %s não parece ser um arquivo lpi."
|
||
|
||
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
||
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
||
msgstr "O arquivo %s%s%s é um vínculo simbólico;%s%sAbrir %s%s% ao invés dele?"
|
||
|
||
#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
|
||
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
||
msgstr "O arquivo %s%s%s não é um projeto Delphi (.dpr)"
|
||
|
||
#: lazarusidestrconsts.listhefileisnotadelphiunit
|
||
msgid "The file %s%s%s is not a Delphi unit."
|
||
msgstr "O arquivo %s%s%s não é uma unidade Delphi."
|
||
|
||
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
||
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
|
||
msgstr "O arquivo %s%s%s não é um projeto lazarus.%sCriar um novo projeto para este %s?"
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr "O arquivo %s%s%s%sparece ser um programa. Feche o projeto atual e crie um novo projeto Lazarus para esse programa:%s\"Não\" carregará o arquivo como um fonte normal."
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
||
msgstr "O arquivo %s parece ser um arquivo de programa de um projeto Lazarus existente."
|
||
|
||
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
||
msgstr "O arquivo %s%s%s%s foi encontrado em um dos diretórios fontes do pacote %s e parece uma unidade compilada. Unidades compiladas devem estar no diretório de saída do pacote, caso contrário outros pacotes podem ter problemas ao usar este.%s%sExcluir arquivo ambíguo?"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
||
msgstr "O arquivo %s%s%s%s não foi encontrado.%sDeseja localizá-lo você mesmo?%s"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr "O arquivo %s%s%s%s não foi encontrado.%sIgnorar continuará carregando o projeto,%sAbortar irá parar o carregamento."
|
||
|
||
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
||
msgstr "Os seguintes métodos usados por %s não estão no fonte%s%s%s%s%s%sRemover as referências pendentes?"
|
||
|
||
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
||
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
||
msgstr "O compilador Free Pascal (nome do arquivo: %s) não foi encontrado.%sRecomenda-se que você instale o fpc."
|
||
|
||
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
||
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
||
msgstr "O diretório do fonte Free Pascal não foi encontrado.%sAlgumas funções não funcionarão.%sRecomenda-se que você os instale e ajuste o caminho%sAmbiente -> Opções de Ambiente -> Arquivos"
|
||
|
||
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
||
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
||
msgstr "O identificador é uma unidade. Favor usar Salvar Arquivo como função para renomear a unidade."
|
||
|
||
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
||
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
|
||
msgstr "A tecla %s%sjá está atribuída para %s;%s%sRemover a atribuição antiga e atribuir a tecla para a nova função%s%s?"
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
||
msgstr "A Aplicação encartada %s%snecessária para execução não existe ou não é executável.%sDeseja criar uma?%s%sVeja Projeto -> Opções de Projeto -> Aplicação para ajustes."
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
||
msgstr "A aplicação iniciando %s%s%s%s não existe ou não é executável.%s%sVeja Executar -> Parâmetros de Execução -> Local"
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
||
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "O diretório Lazarus não foi encontrado.%sVocê não poderá criar aplicações LCL.%sFavor verificar Ambiente -> Opções de Ambiente -> Arquivos"
|
||
|
||
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
||
msgstr "O arquivo LFM (Formulário Lazarus) contém propriedades inválidas. Isto significa por ex., que ele contém algumas propriedades/classes, que não existem na LCL atual. A correção natural é remover essas propriedades do LFM e corrigir o código Pascal manualmente."
|
||
|
||
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
|
||
msgid "The name %s%s%s is not a valid pascal identifier."
|
||
msgstr "O nome %s%s%s não é um identificador Pascal válido."
|
||
|
||
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgstr "A nova unidade ainda não está no caminho de unidades.%sAdicionar diretório %s?"
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
||
msgid "The output directory %s%s%s is missing."
|
||
msgstr "O diretório de saída %s%s%s está faltando."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
||
msgid "The output directory of %s is listed in the include search path of %s."
|
||
msgstr "O diretório de saída de %s está listado no caminho de busca de inclusões de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
||
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
||
msgstr "O diretório de saída de %s está listado no caminho de busca herdada de inclusões de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
||
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
||
msgstr "O diretório de saída de %s está listado no caminho de busca herdada de unidade de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
||
msgid "The output directory of %s is listed in the unit search path of %s."
|
||
msgstr "O diretório de saída de %s está listado no caminho de busca de unidade de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
||
msgid " The output directory should be a separate directory and not contain any source files."
|
||
msgstr "O diretório de saída deve ser separado e não deve conter quaisquer arquivos fonte."
|
||
|
||
#: lazarusidestrconsts.listheownerclasshasthisname
|
||
msgid "The owner class has this name"
|
||
msgstr "A classe proprietária tem este nome"
|
||
|
||
#: lazarusidestrconsts.listheownerhasthisname
|
||
msgid "The owner has this name"
|
||
msgstr "O proprietário tem este nome"
|
||
|
||
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr "O pacote já contém uma unidade com este nome."
|
||
|
||
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
||
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
|
||
msgstr "O pacote %s não pode ser desinstalado, porque é necessário pela própria IDE."
|
||
|
||
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
||
msgstr "O programa %s\"make\"%s não foi encontrado.%s Esta ferramenta é necessária para construir o lazarus.%s"
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
||
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
|
||
msgstr "O projeto não usa a unidade interfaces LCL, mas parece que necessita dela.%sVocê obterá erros estranhos do vinculador se utilizar formulários LCL sem interfaces."
|
||
|
||
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
||
msgstr "O arquivo de informações de projeto %s%s%s%sé o mesmo que o fonte principal do projeto!"
|
||
|
||
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
||
msgid "The project information file %s%s%s%shas changed on disk."
|
||
msgstr "O arquivo de informações projeto %s%s%s%sfoi alterado no disco."
|
||
|
||
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr "O projeto deve ser salvo antes de construir%sSe você ajustar o diretório de Teste nas opções de ambiente,%svocê poderá criar novos projetos e contruí-los imediatamente.%sSalvar projeto?"
|
||
|
||
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
||
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
||
msgstr "O projeto usa SO alvo=%s e CPU=%s.%s O \"system.ppu\" para este alvo não foi encontrado no diretório binário do FPC. %sCertifique-se que o FPC está instalado corretamente para este alvo e que \"fpc.cfg\" contenha os diretórios certos."
|
||
|
||
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
|
||
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
|
||
msgstr "O projeto usa os novos recursos FPC, que requer ao menos FPC 2.4"
|
||
|
||
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr "Há outros arquivos no diretório com o mesmo nome,%sque apenas diferem em:%s%s%sExcluí-los?"
|
||
|
||
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
||
msgstr "Há um arquivo com o mesmo nome e extensão similar no disco:%sArquivo: %s%sArquivo Ambíguo: %s%s%sExcluir arquivo ambíguo?"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyabuildvarwiththename
|
||
msgid "There is already a build variable with the name %s%s%s."
|
||
msgstr "Já existe uma variável construção com o nome %s%s%s."
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
||
msgid "There is already a component with this name"
|
||
msgstr "Já existe um componente com este nome"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name %s%s%s"
|
||
msgstr "Já existe um formulário com o nome %s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "Já existe uma unidade com o nome %s%s%s. Identificadores Pascal devem ser únicos."
|
||
|
||
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
||
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
||
msgstr "Há uma unidade com o nome %s%s%s no projeto.%sFavor escolher um nome diferente"
|
||
|
||
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
||
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
||
msgstr "A classe do recurso %s%s%s descende de %s%s%s. Provavelmente isto é um tipo para \"TForm\";"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr "Ocorreu um erro durante a escrita do componente selecionado %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr "Ocorreu um erro ao converter o fluxo binário do componente selecionado %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr "Ocorreu um erro ao copiar o fluxo do componente para Área de Transferência:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
||
msgid "The root component can not be deleted."
|
||
msgstr "O componente raiz não pode ser excluído."
|
||
|
||
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
||
msgid "These settings are stored with the project."
|
||
msgstr "Estes ajustes são armazenados com o projeto."
|
||
|
||
#: lazarusidestrconsts.listheseunitswerenotfound
|
||
msgid "These units were not found:"
|
||
msgstr "Estas unidades não foram encontradas:"
|
||
|
||
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
|
||
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
||
msgstr "O Diretório de Teste não pode ser encontrado:%s%s%s%s%s(veja opções de ambiente)"
|
||
|
||
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
|
||
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
||
msgstr "A unidade %s%s%s já existe.%sIgnorar forçará a renomeação,%sCancelar cancelará o salvamento deste fonte e%sAbortar abortará todo o salvamento."
|
||
|
||
#: lazarusidestrconsts.listheunitbelongstopackage
|
||
msgid "The unit belongs to package %s."
|
||
msgstr "A unidade pertence ao pacote %s."
|
||
|
||
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr "A unidade %s existe duas vezes no caminho de unidades da %s:"
|
||
|
||
#: lazarusidestrconsts.listheunithasthisname
|
||
msgid "The unit has this name"
|
||
msgstr "Uma unidade tem este nome"
|
||
|
||
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
||
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
|
||
msgstr "O nome de arquivo da unidade %s%s%s não está em minúsculas.%sO compilador Free Pascal não é indiferente a maiúsc./minúsc. É recomendado usar nomes de arquivos em minúsculas.%s%sRenomear arquivo para minúsculas?"
|
||
|
||
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
||
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
||
msgstr "A unidade %s é usada por outro arquivo.%sAtualizar referências automaticamente?"
|
||
|
||
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "A própria unidade já tem o nome %s%s%s. Identificadores Pascal devem ser únicos."
|
||
|
||
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
||
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
||
msgstr "O caminho de busca unidade de %s%s%s contém o diretório fonte %s%s%s do pacote %s"
|
||
|
||
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
||
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
||
msgstr "O diretório de trabalho %s%s%s não existe.%sFavor verificar no Menu -> Executar -> Parâmetros de Execução."
|
||
|
||
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
||
msgid "This function needs an open .lfm file in the source editor."
|
||
msgstr "Esta função requer um arquivo .lfm aberto no editor código."
|
||
|
||
#: lazarusidestrconsts.listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr "esta mensagem de ajuda"
|
||
|
||
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr "Este parece um arquivo Pascal.%sE recomendado usar nomes de arquivo em minúsculas, para evitar vários problemas em alguns sistemas de arquivos e compiladores diferentes.%sRenomeá-lo usando minúsculas?"
|
||
|
||
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
||
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
||
msgstr "Este conjunto de opções para contrução Lazarus não é suportado por esta instalação.%sO diretório %s%s%s não é gravável.%sConsulte a página internet do Lazarus para outras maneiras de instalação."
|
||
|
||
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr "Esta declaração não pode ser extraída.%sFavor selecionar algum código para extrair um novo procedimento/método."
|
||
|
||
#: lazarusidestrconsts.listinfobuildautocloseonsuccess
|
||
msgid "&Automatically close on success"
|
||
msgstr "Fechar &automaticamente em caso de sucesso"
|
||
|
||
#: lazarusidestrconsts.listinfobuildcompiling
|
||
msgid "Compiling:"
|
||
msgstr "Compilando:"
|
||
|
||
#: lazarusidestrconsts.listitle
|
||
msgid "&Title"
|
||
msgstr "&Título"
|
||
|
||
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
||
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
||
msgstr "Título na barra de tarefas mostra por exemplo: project1.lpi - Lazarus"
|
||
|
||
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
||
msgid "Title (leave empty for default)"
|
||
msgstr "Título (deixar vazio para padrão)"
|
||
|
||
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr "Função: adicionar o delimitador de caminho"
|
||
|
||
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
||
msgid "Function: chomp path delimiter"
|
||
msgstr "Função: retirar o delimitador de caminho"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr "Função: extrair extensão do arquivo"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr "Função: extrair nome+extensão do arquivo"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr "Função: extrair apenas nome do arquivo"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr "Função: extrair caminho do arquivo"
|
||
|
||
#: lazarusidestrconsts.listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(macro desconhecida: %s)"
|
||
|
||
#: lazarusidestrconsts.listodoexport
|
||
msgctxt "lazarusidestrconsts.listodoexport"
|
||
msgid "Export"
|
||
msgstr "Exportar"
|
||
|
||
#: lazarusidestrconsts.listodogoto
|
||
msgid "Goto"
|
||
msgstr "Ir para"
|
||
|
||
#: lazarusidestrconsts.listodoldescription
|
||
msgctxt "lazarusidestrconsts.listodoldescription"
|
||
msgid "Description"
|
||
msgstr "Descrição"
|
||
|
||
#: lazarusidestrconsts.listodoldone
|
||
msgid "Done"
|
||
msgstr "Feito"
|
||
|
||
#: lazarusidestrconsts.listodolfile
|
||
msgctxt "lazarusidestrconsts.listodolfile"
|
||
msgid "Module"
|
||
msgstr "Módulo"
|
||
|
||
#: lazarusidestrconsts.listodolistcaption
|
||
msgctxt "lazarusidestrconsts.listodolistcaption"
|
||
msgid "ToDo List"
|
||
msgstr "Lista ToDo (Para Fazer)"
|
||
|
||
#: lazarusidestrconsts.listodolistgotoline
|
||
msgid "Goto selected source line"
|
||
msgstr "Ir para linha de código selecionada"
|
||
|
||
#: lazarusidestrconsts.listodolistoptions
|
||
msgid "ToDo options..."
|
||
msgstr "Opções ToDo (Para Fazer)..."
|
||
|
||
#: lazarusidestrconsts.listodolistprintlist
|
||
msgid "Print todo items"
|
||
msgstr "Imprimir items ToDo (Para Fazer)"
|
||
|
||
#: lazarusidestrconsts.listodolistrefresh
|
||
msgid "Refresh todo items"
|
||
msgstr "Atualizar items ToDo (Para Fazer)"
|
||
|
||
#: lazarusidestrconsts.listodolline
|
||
msgctxt "lazarusidestrconsts.listodolline"
|
||
msgid "Line"
|
||
msgstr "Linha"
|
||
|
||
#: lazarusidestrconsts.listodolowner
|
||
msgid "Owner"
|
||
msgstr "Proprietário"
|
||
|
||
#: lazarusidestrconsts.listodolpriority
|
||
msgctxt "lazarusidestrconsts.listodolpriority"
|
||
msgid "Priority"
|
||
msgstr "Prioridade"
|
||
|
||
#: lazarusidestrconsts.listofpcpath
|
||
msgid "Path:"
|
||
msgstr "Caminho:"
|
||
|
||
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
||
msgid "Toggle showing filenames with full path or with relative path"
|
||
msgstr "Alterar mostrar nomes de arquivo com caminho completo ou relativo"
|
||
|
||
#: lazarusidestrconsts.listop
|
||
msgctxt "lazarusidestrconsts.listop"
|
||
msgid "Top"
|
||
msgstr "Topo"
|
||
|
||
#: lazarusidestrconsts.listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr "Ancoragem superior"
|
||
|
||
#: lazarusidestrconsts.listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr "Espaço da Borda Superior. Este valor será adicionado ao espaço da borda base e usado para o espaço superior do controle."
|
||
|
||
#: lazarusidestrconsts.listops
|
||
msgid "Tops"
|
||
msgstr "Topos"
|
||
|
||
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
||
msgstr "Este é o controle irmão o qual o lado superior está ancorado. Deixar vazio para o controle-pai."
|
||
|
||
#: lazarusidestrconsts.listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr "Justificar acima"
|
||
|
||
#: lazarusidestrconsts.listreeneedsrefresh
|
||
msgid "Tree needs refresh"
|
||
msgstr "Árvore necessita atualização"
|
||
|
||
#: lazarusidestrconsts.listtodolcategory
|
||
msgctxt "lazarusidestrconsts.listtodolcategory"
|
||
msgid "Category"
|
||
msgstr "Categoria"
|
||
|
||
#: lazarusidestrconsts.listurbopascal
|
||
msgid "Turbo Pascal"
|
||
msgstr "Turbo Pascal"
|
||
|
||
#: lazarusidestrconsts.lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr "Não mostrar esta mensagem novamente."
|
||
|
||
#: lazarusidestrconsts.lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr "Error em expressão regular"
|
||
|
||
#: lazarusidestrconsts.lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr "Fonte sem UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisuegotoline
|
||
#| msgid "Goto line :"
|
||
msgid "Goto line:"
|
||
msgstr "Ir para Linha :"
|
||
|
||
#: lazarusidestrconsts.lisuemodeseparator
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: lazarusidestrconsts.lisuenotfound
|
||
msgid "Not found"
|
||
msgstr "Não encontrado"
|
||
|
||
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
||
msgstr "Substituir esta ocorrência de %s%s%s%s com %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr "Localizando: %s"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr "Sequência \"%s\" não encontrada!"
|
||
|
||
#: lazarusidestrconsts.lisuethecurre
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
||
msgstr "A fonte atual do editor não suporta UTF-8, mas seu sistema parece utilizá-la.%sIsto significa que caracteres não ASCII provavelmente serão vistos incorretamente.%sVocê pode selecionar outra fonte nas opções do editor."
|
||
|
||
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr "Limpar cache de inclusões"
|
||
|
||
#: lazarusidestrconsts.lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "%s bytes"
|
||
|
||
#: lazarusidestrconsts.lisuidclear
|
||
msgid "Clear"
|
||
msgstr "Limpar"
|
||
|
||
#: lazarusidestrconsts.lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr "Incluído por:"
|
||
|
||
#: lazarusidestrconsts.lisuidinproject
|
||
msgid "in Project:"
|
||
msgstr "no Projeto:"
|
||
|
||
#: lazarusidestrconsts.lisuidlines
|
||
msgctxt "lazarusidestrconsts.lisuidlines"
|
||
msgid "Lines:"
|
||
msgstr "Linhas:"
|
||
|
||
#: lazarusidestrconsts.lisuidname
|
||
msgctxt "lazarusidestrconsts.lisuidname"
|
||
msgid "Name:"
|
||
msgstr "Nome:"
|
||
|
||
#: lazarusidestrconsts.lisuidno
|
||
msgid "no"
|
||
msgstr "não"
|
||
|
||
#: lazarusidestrconsts.lisuidok
|
||
msgctxt "lazarusidestrconsts.lisuidok"
|
||
msgid "Ok"
|
||
msgstr "Ok"
|
||
|
||
#: lazarusidestrconsts.lisuidpathsreadonly
|
||
msgid "Paths (Read Only)"
|
||
msgstr "Caminhos (Somente Leitura)"
|
||
|
||
#: lazarusidestrconsts.lisuidsize
|
||
msgid "Size:"
|
||
msgstr "Tamanho:"
|
||
|
||
#: lazarusidestrconsts.lisuidsrc
|
||
msgid "Src"
|
||
msgstr "Src"
|
||
|
||
#: lazarusidestrconsts.lisuidtype
|
||
msgid "Type:"
|
||
msgstr "Tipo:"
|
||
|
||
#: lazarusidestrconsts.lisuidunit
|
||
msgctxt "lazarusidestrconsts.lisuidunit"
|
||
msgid "Unit"
|
||
msgstr "Unidade"
|
||
|
||
#: lazarusidestrconsts.lisuidyes
|
||
msgid "yes"
|
||
msgstr "sim"
|
||
|
||
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr "Mostrar Valores de Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr "Impossível converter fluxo binário em texto"
|
||
|
||
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr "Impossível copiar componentes para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Impossível adicionar comentário de cabeçalho de recurso no arquivo de recurso %s%s%s%s.%sProvavelmente um erro de syntaxe."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Impossível adicionar recurso T%s:FORMDATA para arquivo de recurso %s%s%s%s.Provavelmente um erro de sintaxe."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddsetting
|
||
msgid "Unable to add setting"
|
||
msgstr "Incapaz de adicionar ajuste"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr "Impossível adicionar %s ao projeto, porque já existe uma unidade com o mesmo nome no Projeto."
|
||
|
||
#: lazarusidestrconsts.lisunabletobackupfileto
|
||
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
||
msgstr "Impossível fazer cópia de segurança do arquivo %s%s%s para %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr "%s%sImpossível alterar classe de %s para %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr "Impossível limpar o diretório de destino"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
||
msgstr "Impossível limpar %s%s%s.%sFavor verificar as permissões."
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr "Impossível converter texto componente em formato binário:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
||
msgid "Unable to convert file %s%s%s%sError: %s"
|
||
msgstr "Impossível converter arquivo %s%s%s%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
|
||
msgid "Unable to convert lfm to lrs and write lrs file."
|
||
msgstr "Impossível converter LFM para LRS e escrever arquivo LRS"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
||
msgstr "Impossível converter os dados texto do arquivo %s%s%s%s em um fluxo binário (%s)"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr "Impossível copiar arquivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
||
msgstr "Impossível copiar o arquivo %s%s%spara %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto2
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
||
msgstr "Impossível copiar o arquivo %s%s%s%spara %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory %s%s%s."
|
||
msgstr "Impossível criar diretório de cópia de segurança %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory
|
||
msgid "Unable to create directory %s%s%s."
|
||
msgstr "Impossível criar diretório %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory2
|
||
msgid "Unable to create directory %s%s%s"
|
||
msgstr "Impossível criar diretório %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr "Impossível criar arquivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile2
|
||
msgid "Unable to create file %s%s%s"
|
||
msgstr "Impossível criar arquivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile3
|
||
msgid "Unable to create file%s%s%s%s"
|
||
msgstr "Impossível criar arquivo%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefilename
|
||
msgid "Unable to create file %s%s%s."
|
||
msgstr "Impossível criar arquivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
||
msgid "Unable to create link %s%s%s with target %s%s%s"
|
||
msgstr "Impossível criar vínculo %s%s%s com alvo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
|
||
msgid "Unable to create new method. Please fix the error shown in the message window."
|
||
msgstr "Impossível criar novo método. Favor corrigir o erro mostrado na janela de mensagens."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr "Impossível criar \"buffer\" LFM temporário."
|
||
|
||
#: lazarusidestrconsts.lisunabletodelete
|
||
msgid "Unable to delete"
|
||
msgstr "Incapaz de excluir"
|
||
|
||
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file %s%s%s"
|
||
msgstr "Impossível excluir arquivo ambíguo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr "Impossível localizar uma seção de recurso de sequência de caracteres nesta ou em qualquer outra unidade usada."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in %s%s%s"
|
||
msgstr "Impossível localizar um nome de classe válido em %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfile
|
||
msgid "Unable to find file %s%s%s."
|
||
msgstr "Impossível localizar o arquivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
||
msgstr "Impossível localizar arquivo %s%s%s.%sSe ele pertence ao seu projeto, verifique caminho de busca em%sProjeto->Opções Compilador...->Caminhos de Busca->Outros Arquivos Unidade. Se ele pertence a um pacote, verifique as opções de compilador do pacote apropriadas. Se ele pertence ao Lazarus, tenha certeza de uma compilação limpa. Se ele pertence ao FPC, verifique \"fpc.cfg\". Se não tiver certeza, verifique Projeto -> Opções Compilador... -> Teste"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr "Impossível localizar %s no Fluxo LFM"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to find method. Please fix the error shown in the message window."
|
||
msgstr "Impossível localizar método. Favor corrigir o erro mostrado na janela de mensagens."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
||
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
|
||
msgstr "Impossível localizar unidade pascal (.pas,.pp) para arquivo .lfm %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
|
||
msgid "Unable to find the unit of component class %s%s%s."
|
||
msgstr "Impossível localizar unidade de classe do componente %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr "Impossível coletar alterações do editor."
|
||
|
||
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr "Impossível obter o fonte para o editor."
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
|
||
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
||
msgstr "Impossível carregar o arquivo antigo de recurso.%sO arquivo de recurso é o primeiro arquivo de inclusãoo na%s seção de inicialização.%sPor exemplo {$I %s.lrs}.%sProvável erro de sintaxe."
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadpackage
|
||
msgid "Unable to load package %s%s%s"
|
||
msgstr "Impossível carregar pacote %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
||
msgstr "Impossível carregar classe componente %s%s%s, porque ele depedente dele mesmo."
|
||
|
||
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
||
msgid "Unable to open ancestor component"
|
||
msgstr "Impossível abrir componente ancestral"
|
||
|
||
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr "Impossível abrir editor.%sA classe %s não descende de uma classe designável como \"TForm\" ou \"TDataModule\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletoread
|
||
msgid "Unable to read %s"
|
||
msgstr "Impossível ler %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr "Impossível ler arquivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile2
|
||
msgid "Unable to read file %s%s%s!"
|
||
msgstr "Impossível ler arquivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfileerror
|
||
msgid "Unable to read file %s%s%s%sError: %s"
|
||
msgstr "Impossível ler arquivo %s%s%s%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfilename
|
||
msgid "Unable to read file %s%s%s."
|
||
msgstr "Impossível ler arquivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
||
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
||
msgid "Unable to read the project info file%s%s%s%s."
|
||
msgstr "Impossível ler arquivo informações projeto%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
|
||
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
|
||
msgid "Unable to read the project info file%s%s%s%s."
|
||
msgstr "Impossível ler arquivo informações projeto%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file %s%s%s!"
|
||
msgstr "Impossível remover arquivo antigo da cópia de segurança %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
||
msgstr "Impossível renomear arquivo ambíguo %s%s%s%spara %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr "Impossível renomear arquivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto
|
||
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
||
msgstr "Impossível renomear arquivo %s%s%s para %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto2
|
||
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
||
msgstr "Impossível renomear arquivo %s%s%s%spara %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr "Impossível renomear formulário no fonte."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr "Impossível renomear método. Favor corrigir o erro mostrado na janela de mensagens."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr "Impossível renomear variíavel no fonte."
|
||
|
||
#: lazarusidestrconsts.lisunabletorun
|
||
msgid "Unable to run"
|
||
msgstr "Impossível executar"
|
||
|
||
#: lazarusidestrconsts.lisunabletosavefile
|
||
msgid "Unable to save file %s%s%s"
|
||
msgstr "Impossível salvar arquivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr "Impossível ajustar lado ancoragem do controle."
|
||
|
||
#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to show method. Please fix the error shown in the message window."
|
||
msgstr "Impossível mostrar método. Favor corrigir o erro mostrado na janela de mensagens."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr "Impossível obter fluxo dos componentes selecionados."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr "Impossível obter fluxo dos componentes selecionados."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr "Impossível obter fluxo %s:T%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr "Impossível transformar fluxo binário do componente de %s:T%s em texto."
|
||
|
||
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr "Impossível atualizar declaração \"CreateForm\" no fonte do projeto"
|
||
|
||
#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
|
||
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
|
||
msgstr "Impossível atualizar arquivo de recurso binário %s%s%s do arquivo de recurso texto%s%s%s%sProvavelmente o arquivo texto está corrompido."
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite
|
||
msgid "Unable to write %s%s%s%s%s."
|
||
msgstr "Impossível escrever %s%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite2
|
||
msgid "Unable to write %s%s%s"
|
||
msgstr "Impossível escrever %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr "Impossível escrever arquivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefileerror
|
||
msgid "Unable to write file %s%s%s%sError: %s"
|
||
msgstr "Impossível escrever arquivo %s%s%s%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
||
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
|
||
msgstr "Incapaz de gravar o arquivo info. projeto%s%s%s%s.%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile
|
||
#| msgid "Unable to write to file %s%s%s!"
|
||
msgid "Unable to write to file %s%s%s."
|
||
msgstr "Impossível gravar para arquivo %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr "Impossível escrever fluxo xml para %s%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lisuninstallimpossible
|
||
msgid "Uninstall impossible"
|
||
msgstr "Impossível desinstalar"
|
||
|
||
#: lazarusidestrconsts.lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr "Desinstalar seleção"
|
||
|
||
#: lazarusidestrconsts.lisunithaschangedsave
|
||
msgid "Unit %s%s%s has changed. Save?"
|
||
msgstr "Unidade %s%s%s foi alterada. Salvar?"
|
||
|
||
#: lazarusidestrconsts.lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr "Identificador de unidade existe"
|
||
|
||
#: lazarusidestrconsts.lisunitinpackage
|
||
msgid "%s unit %s in package %s%s"
|
||
msgstr "%s unidade %s no pacote %s%s"
|
||
|
||
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr "Nome de unidade já existe no projeto"
|
||
|
||
#: lazarusidestrconsts.lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr "Nome unidade começa com ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr "Nome unidade contém ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnotfound
|
||
#| msgid "Unit not found"
|
||
msgid "A unit not found in"
|
||
msgstr "Uma unidade não encontrada em"
|
||
|
||
#: lazarusidestrconsts.lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr "Diretório de saída de unidade"
|
||
|
||
#: lazarusidestrconsts.lisunitpath
|
||
msgid "unit path"
|
||
msgstr "caminho das unidades"
|
||
|
||
#: lazarusidestrconsts.lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr "Caminho das unidades"
|
||
|
||
#: lazarusidestrconsts.lisunitsnotfound2
|
||
#| msgid "Units not found"
|
||
msgid "Units not found in"
|
||
msgstr "Unidades não encontradas em"
|
||
|
||
#: lazarusidestrconsts.lisunusedunits
|
||
msgid "Unused units"
|
||
msgstr "Unidades não usadas"
|
||
|
||
#: lazarusidestrconsts.lisupdatepreview
|
||
msgid "Update preview"
|
||
msgstr "Atualiza visualização"
|
||
|
||
#: lazarusidestrconsts.lisupdatereferences
|
||
msgid "Update references?"
|
||
msgstr "Atualizar referências?"
|
||
|
||
#: lazarusidestrconsts.lisuppercasestring
|
||
msgid "uppercase string"
|
||
msgstr "seq.caracteres maiúsculas"
|
||
|
||
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
||
msgid "Uppercase string given as parameter"
|
||
msgstr "Seq.caracteres maiúsculas dada como parâmetro"
|
||
|
||
#: lazarusidestrconsts.lisusagemessagehoption
|
||
msgid "Usage message (-h option)"
|
||
msgstr "Mensagem forma de uso (opção -h)"
|
||
|
||
#: lazarusidestrconsts.lisuseexcludefilter
|
||
msgid "Use Exclude Filter"
|
||
msgstr "Usar Filtro de Exclusão"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifier
|
||
msgid "Use identifier"
|
||
msgstr "Usar identificador"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifierinat
|
||
msgid "Use identifier %s in %s at %s"
|
||
msgstr "Usar identificador %s em %s no %s"
|
||
|
||
#: lazarusidestrconsts.lisuseincludefilter
|
||
msgid "Use Include Filter"
|
||
msgstr "Usar Filtro de Inclusão"
|
||
|
||
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr "Inicializando aplicação"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage
|
||
msgid "Use package %s in package %s"
|
||
msgstr "Usar pacote %s no pacote %s"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage2
|
||
msgid "Use package in package"
|
||
msgstr "Usar pacote no pacote"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject
|
||
msgid "Use package %s in project"
|
||
msgstr "Usar pacote %s no projeto"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject2
|
||
msgid "Use package in project"
|
||
msgstr "Usar pacote no projeto"
|
||
|
||
#: lazarusidestrconsts.lisusershomedirectory
|
||
msgid "User's home directory"
|
||
msgstr "Diretório padrão do usuário"
|
||
|
||
#: lazarusidestrconsts.lisuseunitinunit
|
||
msgid "Use unit %s in unit %s"
|
||
msgstr "Usar unidade %s na unidade %s"
|
||
|
||
#: lazarusidestrconsts.lisutf8withbom
|
||
msgid "UTF-8 with BOM"
|
||
msgstr "UTF-8 com Marca Ordem \"Byte\" (BOM)"
|
||
|
||
#: lazarusidestrconsts.lisvalue
|
||
msgid "Value:"
|
||
msgstr "Valor:"
|
||
|
||
#: lazarusidestrconsts.lisvalue2
|
||
msgid "Value%s"
|
||
msgstr "Valor%s"
|
||
|
||
#: lazarusidestrconsts.lisvalues
|
||
msgid "Values"
|
||
msgstr "Valores"
|
||
|
||
#: lazarusidestrconsts.lisverifymethodcalls
|
||
msgid "Verify method calls"
|
||
msgstr "Verificar chamadas de método"
|
||
|
||
#: lazarusidestrconsts.lisversion
|
||
msgid "Version"
|
||
msgstr "Versão"
|
||
|
||
#: lazarusidestrconsts.lisvertical
|
||
msgid "Vertical"
|
||
msgstr "Vertical"
|
||
|
||
#: lazarusidestrconsts.lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr "Copiar informações de versão para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.lisviewbreakpointproperties
|
||
msgid "View Breakpoint Properties"
|
||
msgstr "Exibir Propriedades Pontos de Paradas"
|
||
|
||
#: lazarusidestrconsts.lisviewprojectunits
|
||
msgid "View Project Units"
|
||
msgstr "Exibir Unidades do Projeto"
|
||
|
||
#: lazarusidestrconsts.lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr "Exibir Fonte (.lfm)"
|
||
|
||
#: lazarusidestrconsts.lisvsrforwardsearch
|
||
msgid "Forward Search"
|
||
msgstr "Localizar adiante"
|
||
|
||
#: lazarusidestrconsts.lisvsrresetresultlist
|
||
msgid "Reset Result List"
|
||
msgstr "Reiniciar Lista Resultados"
|
||
|
||
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
||
msgstr "Aviso: arquivo ambíguo encontrado: %s%s%s. Arquivo fonte é : %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liswatch
|
||
msgid "&Watch"
|
||
msgstr "&Observar"
|
||
|
||
#: lazarusidestrconsts.liswatchpropert
|
||
msgid "Watch Properties"
|
||
msgstr "Propriedades Observador"
|
||
|
||
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
||
msgid "When a unit is renamed, update references ..."
|
||
msgstr "Quando uma unidade for renomeada, atualizar referências ..."
|
||
|
||
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
||
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
|
||
msgstr "Quando habilitado as opções atuais são salvas para um modelo, que é usado ao criar novos projetos"
|
||
|
||
#: lazarusidestrconsts.liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr "Com pacotes requeridos"
|
||
|
||
#: lazarusidestrconsts.liswladd
|
||
msgid "&Add"
|
||
msgstr "&Adicionar"
|
||
|
||
#: lazarusidestrconsts.liswldelete
|
||
msgid "&Delete"
|
||
msgstr "&Excluir"
|
||
|
||
#: lazarusidestrconsts.liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr "E&liminar tudo"
|
||
|
||
#: lazarusidestrconsts.liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr "D&esabilitar Tudo"
|
||
|
||
#: lazarusidestrconsts.liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr "H&abillitar tudo"
|
||
|
||
#: lazarusidestrconsts.liswlenabled
|
||
msgid "&Enabled"
|
||
msgstr "&Habilitado"
|
||
|
||
#: lazarusidestrconsts.liswlexpression
|
||
msgid "Expression"
|
||
msgstr "Expressão"
|
||
|
||
#: lazarusidestrconsts.liswlproperties
|
||
msgid "&Properties"
|
||
msgstr "&Propriedades"
|
||
|
||
#: lazarusidestrconsts.liswlwatchlist
|
||
msgid "Watch list"
|
||
msgstr "Lista observadores"
|
||
|
||
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr "Palavra sob o cursor no editor atual"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr "Diretório de trabalho para construção"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr "Diretório de trabalho para execução"
|
||
|
||
#: lazarusidestrconsts.liswriteerror
|
||
msgid "Write Error"
|
||
msgstr "Erro de Escrita"
|
||
|
||
#: lazarusidestrconsts.liswriteerrorfile
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr "Erro escrita: %s%sArquivo: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr "Erro XML"
|
||
|
||
#: lazarusidestrconsts.lisxmlfiles
|
||
msgid "XML files"
|
||
msgstr "Arquivos XML"
|
||
|
||
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr "Erro análise XML no arquivo %s%sErro: %s"
|
||
|
||
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You can not build lazarus while debugging or compiling."
|
||
msgstr "Você não pode reconstruir o Lazarus enquanto estiver depurando ou compilando."
|
||
|
||
#: lazarusidestrconsts.locwndsrceditor
|
||
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
||
msgid "Source Editor"
|
||
msgstr "Editor de Código"
|
||
|
||
#: lazarusidestrconsts.podaddpackageunittousessection
|
||
msgid "Add package unit to uses section"
|
||
msgstr "Adicionar unidade pacote à cláusula \"uses\""
|
||
|
||
#: lazarusidestrconsts.rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr "Adicionar Reverso"
|
||
|
||
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr "Aumentar número construção automaticamente"
|
||
|
||
#: lazarusidestrconsts.rsavailablescanners
|
||
msgid "Available scanners"
|
||
msgstr "\"Scanners\" disponíveis"
|
||
|
||
#: lazarusidestrconsts.rsbuild
|
||
#| msgid "Build:"
|
||
msgid "&Build:"
|
||
msgstr "&Construir"
|
||
|
||
#: lazarusidestrconsts.rscharacterset
|
||
msgid "Character set:"
|
||
msgstr "Conjunto caracteres:"
|
||
|
||
#: lazarusidestrconsts.rsclosecurrentpage
|
||
msgid "Close current page"
|
||
msgstr "Fechar página atual"
|
||
|
||
#: lazarusidestrconsts.rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr "Definições condicionais"
|
||
|
||
#: lazarusidestrconsts.rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr "Criar nova definição"
|
||
|
||
#: lazarusidestrconsts.rscreatingdirfailed
|
||
msgid "Creating directory \"%s\" failed!"
|
||
msgstr "Criação diretório \"%s\" falhou!"
|
||
|
||
#: lazarusidestrconsts.rscreatingsymlinkfailed
|
||
msgid "Creating symbolic link \"%s\" failed!"
|
||
msgstr "Criação vínculo simbólico \"%s\" falhou!"
|
||
|
||
#: lazarusidestrconsts.rscreatingsymlinknotsupported
|
||
msgid "Creating symbolic link is not supported on this platform!"
|
||
msgstr "Criação de vínculos simbólicos não suportada por esta plataforma!"
|
||
|
||
#: lazarusidestrconsts.rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr "Habilitar \"i18n\""
|
||
|
||
#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
|
||
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
|
||
msgstr "Digite uma ou mais frases que deseja Localizar ou Filtrar na lista, separadas por espaço ou vírgula"
|
||
|
||
#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
|
||
msgid "Filter the list with the current filter expression"
|
||
msgstr "Filtrar a lista com a expressão atual de filtro"
|
||
|
||
#: lazarusidestrconsts.rsformdatafiledfm
|
||
msgid "Form data file (*.dfm)|*.dfm"
|
||
msgstr "Arquivo dados de formulário (*.dfm)|*.dfm"
|
||
|
||
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
||
msgid "Found, but not listed here: "
|
||
msgstr "Encontrado, mas não listado aqui:"
|
||
|
||
#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
|
||
msgid "Go to the next item in the search list"
|
||
msgstr "Vá para o próximo item na lista de busca"
|
||
|
||
#: lazarusidestrconsts.rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr "Opções \"i18n\""
|
||
|
||
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
||
msgid "Include Version Info in executable"
|
||
msgstr "Inclua informações de Versão no executável"
|
||
|
||
#: lazarusidestrconsts.rsiwpcustomposition
|
||
msgid "Custom position"
|
||
msgstr "Posição personalizada"
|
||
|
||
#: lazarusidestrconsts.rsiwpdefault
|
||
msgctxt "lazarusidestrconsts.rsiwpdefault"
|
||
msgid "Default"
|
||
msgstr "Padrão"
|
||
|
||
#: lazarusidestrconsts.rsiwpdocked
|
||
msgid "Docked"
|
||
msgstr "Aportado"
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Restaurar geometria da janela"
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowsize
|
||
msgid "Restore window size"
|
||
msgstr "Restaurar tamanho da janela"
|
||
|
||
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
|
||
msgid "Use windowmanager setting"
|
||
msgstr "Usar configuração do ger. de janelas"
|
||
|
||
#: lazarusidestrconsts.rskey
|
||
msgctxt "lazarusidestrconsts.rskey"
|
||
msgid "Key"
|
||
msgstr "Tecla"
|
||
|
||
#: lazarusidestrconsts.rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr "Africâner"
|
||
|
||
#: lazarusidestrconsts.rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr "Árabe"
|
||
|
||
#: lazarusidestrconsts.rslanguageautomatic
|
||
msgid "Automatic (or english)"
|
||
msgstr "Automático (ou inglês)"
|
||
|
||
#: lazarusidestrconsts.rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr "Catalão"
|
||
|
||
#: lazarusidestrconsts.rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "Chinês"
|
||
|
||
#: lazarusidestrconsts.rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr "Holandês"
|
||
|
||
#: lazarusidestrconsts.rslanguageenglish
|
||
msgid "English"
|
||
msgstr "Inglês"
|
||
|
||
#: lazarusidestrconsts.rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr "Finlandês"
|
||
|
||
#: lazarusidestrconsts.rslanguagefrench
|
||
msgid "French"
|
||
msgstr "Francês"
|
||
|
||
#: lazarusidestrconsts.rslanguagegerman
|
||
msgid "German"
|
||
msgstr "Alemão"
|
||
|
||
#: lazarusidestrconsts.rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "Hebraíco"
|
||
|
||
#: lazarusidestrconsts.rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr "Indonésio"
|
||
|
||
#: lazarusidestrconsts.rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "Italiano"
|
||
|
||
#: lazarusidestrconsts.rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr "Japonês"
|
||
|
||
#: lazarusidestrconsts.rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr "Lituano"
|
||
|
||
#: lazarusidestrconsts.rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr "Opções idioma"
|
||
|
||
#: lazarusidestrconsts.rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "Polonês"
|
||
|
||
#: lazarusidestrconsts.rslanguageportugues
|
||
msgid "Portuguese"
|
||
msgstr "Português"
|
||
|
||
#: lazarusidestrconsts.rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "Russo"
|
||
|
||
#: lazarusidestrconsts.rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr "Seleção idioma:"
|
||
|
||
#: lazarusidestrconsts.rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr "Eslovaco"
|
||
|
||
#: lazarusidestrconsts.rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr "Espanhol"
|
||
|
||
#: lazarusidestrconsts.rslanguageturkish
|
||
msgid "Turkish"
|
||
msgstr "Turco"
|
||
|
||
#: lazarusidestrconsts.rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr "Ucraniano"
|
||
|
||
#: lazarusidestrconsts.rsmajorversion
|
||
msgid "&Major version:"
|
||
msgstr "Versão &Maior:"
|
||
|
||
#: lazarusidestrconsts.rsminorversion
|
||
msgid "Mi&nor version:"
|
||
msgstr "Versão Me&nor:"
|
||
|
||
#: lazarusidestrconsts.rsok
|
||
msgid "ok"
|
||
msgstr "ok"
|
||
|
||
#: lazarusidestrconsts.rsotherinfo
|
||
msgid "Other info"
|
||
msgstr "Outras informações"
|
||
|
||
#: lazarusidestrconsts.rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr "Diretório de saída PO"
|
||
|
||
#: lazarusidestrconsts.rsremove
|
||
msgid "&Remove"
|
||
msgstr "&Remover"
|
||
|
||
#: lazarusidestrconsts.rsresetfilter
|
||
msgid "Reset filter"
|
||
msgstr "Reiniciar filtro"
|
||
|
||
#: lazarusidestrconsts.rsrevision
|
||
msgid "&Revision:"
|
||
msgstr "&Revisão:"
|
||
|
||
#: lazarusidestrconsts.rsscanners
|
||
msgid "Scanners"
|
||
msgstr "\"Scanners\""
|
||
|
||
#: lazarusidestrconsts.rsselectaninheritedentry
|
||
msgid "Select an inherited entry"
|
||
msgstr "Selecionar uma entrada herdada"
|
||
|
||
#: lazarusidestrconsts.rsstartanewsearch
|
||
msgid "Start a new search"
|
||
msgstr "Iniciar nova busca"
|
||
|
||
#: lazarusidestrconsts.rsvalue
|
||
msgctxt "lazarusidestrconsts.rsvalue"
|
||
msgid "Value"
|
||
msgstr "Valor"
|
||
|
||
#: lazarusidestrconsts.rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr "Numeração versão"
|
||
|
||
#: lazarusidestrconsts.srkmalreadyconnected
|
||
msgid " The key \"%s\" is already connected to \"%s\"."
|
||
msgstr " A chave \"%s\" já está conectada à \"%s\"."
|
||
|
||
#: lazarusidestrconsts.srkmalternkey
|
||
msgid "Alternative key (or 2 keys combination)"
|
||
msgstr "Tecla alternativa (ou combinação de 2 teclas)"
|
||
|
||
#: lazarusidestrconsts.srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr "Comandos do menu Ajuda"
|
||
|
||
#: lazarusidestrconsts.srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr "Comandos de Comando"
|
||
|
||
#: lazarusidestrconsts.srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr "Comandos das Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.srkmcatcolselection
|
||
msgid "Text column selection commands"
|
||
msgstr "Comandos seleção coluna texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr "Comandos de movimentação do Cursor"
|
||
|
||
#: lazarusidestrconsts.srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr "Comandos de Edição de Texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatenvmenu
|
||
msgid "Environment menu commands"
|
||
msgstr "Comandos do menu Ambiente"
|
||
|
||
#: lazarusidestrconsts.srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr "Comandos do menu Arquivo"
|
||
|
||
#: lazarusidestrconsts.srkmcatfold
|
||
msgid "Text folding commands"
|
||
msgstr "Comandos retração texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatmarker
|
||
msgid "Text marker commands"
|
||
msgstr "Comandos do Marcador Texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr "Comandos do menu Pacotes"
|
||
|
||
#: lazarusidestrconsts.srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr "Comandos do menu Projeto"
|
||
|
||
#: lazarusidestrconsts.srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr "Comandos do menu Executar"
|
||
|
||
#: lazarusidestrconsts.srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr "Comandos de busca e substituição de Texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr "Comandos de seleção de texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr "Comandos Fonte do \"Notebook\""
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroedit
|
||
msgid "Syncron Editing"
|
||
msgstr "Edição Síncrona"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
||
msgid "Syncron Editing (not in Cell)"
|
||
msgstr "Edição Síncrona (fora Célula)"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
||
msgid "Syncron Editing (while selecting)"
|
||
msgstr "Edição Síncrona (enquanto selecionando)"
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateedit
|
||
msgid "Template Editing"
|
||
msgstr "Edição Modelo"
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateeditoff
|
||
msgid "Template Editing (not in Cell)"
|
||
msgstr "Edição Modelo (fora Célula)"
|
||
|
||
#: lazarusidestrconsts.srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr "Comandos do menu Ferramentas"
|
||
|
||
#: lazarusidestrconsts.srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr "Comandos do menu Exibir"
|
||
|
||
#: lazarusidestrconsts.srkmcommand
|
||
msgctxt "lazarusidestrconsts.srkmcommand"
|
||
msgid "Command:"
|
||
msgstr "Comando:"
|
||
|
||
#: lazarusidestrconsts.srkmcommand1
|
||
msgid " command1 \""
|
||
msgstr " comando 1 \""
|
||
|
||
#: lazarusidestrconsts.srkmcommand2
|
||
msgid " command2 \""
|
||
msgstr " comando2 \""
|
||
|
||
#: lazarusidestrconsts.srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Conflito "
|
||
|
||
#: lazarusidestrconsts.srkmconflicw
|
||
msgid " conflicts with "
|
||
msgstr " conflitos com "
|
||
|
||
#: lazarusidestrconsts.srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr "abortar construção"
|
||
|
||
#: lazarusidestrconsts.srkmecaddjumppoint
|
||
msgid "Add jump point"
|
||
msgstr "Adicionar ponto de salto"
|
||
|
||
#: lazarusidestrconsts.srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr "adicionar observador"
|
||
|
||
#: lazarusidestrconsts.srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr "Complemento modelo de código"
|
||
|
||
#: lazarusidestrconsts.srkmecblockcopy
|
||
msgid "Copy Block"
|
||
msgstr "Copiar Bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblockdelete
|
||
msgid "Delete Block"
|
||
msgstr "Excluir Bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotobegin
|
||
msgid "Goto Block begin"
|
||
msgstr "Ir para início Bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotoend
|
||
msgid "Goto Block end"
|
||
msgstr "Ir para final Bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblockhide
|
||
msgid "Hide Block"
|
||
msgstr "Ocultar Bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr "Recuar bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblockmove
|
||
msgid "Move Block"
|
||
msgstr "Mover Bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetbegin
|
||
msgid "Set block begin"
|
||
msgstr "Ajustar início bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetend
|
||
msgid "Set block end"
|
||
msgstr "Ajustar final bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblockshow
|
||
msgid "Show Block"
|
||
msgstr "Mostrar Bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblocktogglehide
|
||
msgid "Toggle block"
|
||
msgstr "Alternar bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr "Retirar recuo bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr "Construir programa/projeto"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildall
|
||
msgid "build all files of program/project"
|
||
msgstr "Construir todos os arquivos do programa/projeto"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr "Construir arquivo"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildlazarus
|
||
msgid "Build lazarus"
|
||
msgstr "Construir Lazarus"
|
||
|
||
#: lazarusidestrconsts.srkmecchar
|
||
msgid "Char"
|
||
msgstr "Caractere"
|
||
|
||
#: lazarusidestrconsts.srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr "Excluir todo o texto"
|
||
|
||
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
|
||
msgid "Codetools defines editor"
|
||
msgstr "Editor Definições das Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.srkmeccodetoolsoptions
|
||
msgid "Codetools options"
|
||
msgstr "Opções das Ferramentas de Código"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseldown
|
||
msgid "Column Select Down"
|
||
msgstr "Selecionar coluna abaixo"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
||
msgid "Column Select to absolute end"
|
||
msgstr "Selecionar final absoluto da coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditortop
|
||
msgid "Column Select to absolute beginning"
|
||
msgstr "Selecionar ínicio absoluto da coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselleft
|
||
msgid "Column Select Left"
|
||
msgstr "Seleciona coluna esquerda"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellineend
|
||
msgid "Column Select Line End"
|
||
msgstr "Selecionar fim linha coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinestart
|
||
msgid "Column Select Line Start"
|
||
msgstr "Selecionar início linha coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
||
msgid "Column Select to text start in line"
|
||
msgstr "Seleção Coluna para início do texto na linha"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagebottom
|
||
msgid "Column Select Page Bottom"
|
||
msgstr "Selecionar fundo página coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagedown
|
||
msgid "Column Select Page Down"
|
||
msgstr "Selecionar página abaixo coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagetop
|
||
msgid "Column Select Page Top"
|
||
msgstr "Selecionar topo página coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpageup
|
||
msgid "Column Select Page Up"
|
||
msgstr "Selecionar página acima coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselright
|
||
msgid "Column Select Right"
|
||
msgstr "Selecionar coluna direita"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselup
|
||
msgid "Column Select Up"
|
||
msgstr "Selecionar coluna acima"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordleft
|
||
msgid "Column Select Word Left"
|
||
msgstr "Selecionar palavra esquerda coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordright
|
||
msgid "Column Select Word Right"
|
||
msgstr "Selecionar palavra direita coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr "Modo de seleção de coluna"
|
||
|
||
#: lazarusidestrconsts.srkmeccompileroptions
|
||
msgid "compiler options"
|
||
msgstr "opções do compilador"
|
||
|
||
#: lazarusidestrconsts.srkmeccompletecode
|
||
msgid "Complete code"
|
||
msgstr "Completar código"
|
||
|
||
#: lazarusidestrconsts.srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr "configurar arquivo de construção"
|
||
|
||
#: lazarusidestrconsts.srkmeccopy
|
||
msgid "Copy selection to clipboard"
|
||
msgstr "Copiar seleção para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
||
msgid "Copy editor to new window"
|
||
msgstr "Copiar editor para nova janela"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
||
msgid "Copy editor to next free window"
|
||
msgstr "Copiar editor para nova janela livre"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
||
msgid "Copy editor to prior free window"
|
||
msgstr "Copia editor para janela livre anterior"
|
||
|
||
#: lazarusidestrconsts.srkmeccustomtool
|
||
msgid "Custom tool %d"
|
||
msgstr "Ferramenta personalizada %d"
|
||
|
||
#: lazarusidestrconsts.srkmeccut
|
||
msgid "Cut selection to clipboard"
|
||
msgstr "Recortar seleção para Área de Transferência"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr "Excluir até o início da linha"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr "Excluir caractere sob o cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr "Excluir até o final da linha"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr "Excluir último caractere"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr "Excluir até o início da palavra"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr "Excluir linha atual"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr "Excluir até o final da palavra"
|
||
|
||
#: lazarusidestrconsts.srkmecdiff
|
||
msgctxt "lazarusidestrconsts.srkmecdiff"
|
||
msgid "Diff"
|
||
msgstr "Diferenciar (Diff)"
|
||
|
||
#: lazarusidestrconsts.srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr "Mover o cursor para o final absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr "Mover o cursor para o início absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmecenvironmentoptions
|
||
msgid "IDE options"
|
||
msgstr "Opções IDE"
|
||
|
||
#: lazarusidestrconsts.srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr "avaliar/modificar"
|
||
|
||
#: lazarusidestrconsts.srkmecextractproc
|
||
msgid "Extract procedure"
|
||
msgstr "Extrair procedimento"
|
||
|
||
#: lazarusidestrconsts.srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr "Ferramenta externa %d"
|
||
|
||
#: lazarusidestrconsts.srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr "Configuração de ferramentas externas"
|
||
|
||
#: lazarusidestrconsts.srkmecfind
|
||
msgid "Find text"
|
||
msgstr "Localizar texto"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr "Localizar final do bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr "Localizar início do bloco"
|
||
|
||
#: lazarusidestrconsts.srkmecfinddeclaration
|
||
msgid "Find declaration"
|
||
msgstr "Localizar declaração"
|
||
|
||
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
||
msgid "Find identifier references"
|
||
msgstr "Localizar referências do identificador"
|
||
|
||
#: lazarusidestrconsts.srkmecfindinfiles
|
||
msgid "Find in files"
|
||
msgstr "Localizar em arquivos"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnext
|
||
msgid "Find next"
|
||
msgstr "Localizar próximo"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
||
msgid "Find next word occurrence"
|
||
msgstr "Localizar próxima ocorrência da palavra"
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloads
|
||
msgid "Find overloads"
|
||
msgstr "Localizar sobreposições"
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevious
|
||
msgid "Find previous"
|
||
msgstr "Localizar anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
||
msgid "Find previous word occurrence"
|
||
msgstr "Localizar ocorrência anterior da palavra"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
||
msgid "Find procedure definiton"
|
||
msgstr "Localizar definição de procedimento"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduremethod
|
||
msgid "Find procedure method"
|
||
msgstr "Procurar método de procedimento"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldcurrent
|
||
msgid "Fold at Cursor"
|
||
msgstr "Retrair sob o cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldlevel
|
||
msgid "Fold to Level %d"
|
||
msgstr "Retrair ao nível %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr "Ir para editor %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoincludedirective
|
||
msgid "Go to to include directive of current include file"
|
||
msgstr "Ir para diretiva de inclusão do arquivo de inclusão atual"
|
||
|
||
#: lazarusidestrconsts.srkmecgotolinenumber
|
||
msgid "Go to line number"
|
||
msgstr "Ir para o número da linha"
|
||
|
||
#: lazarusidestrconsts.srkmecgotomarker
|
||
msgid "Go to Marker %d"
|
||
msgstr "Ir para Marcador %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr "Ir para XY"
|
||
|
||
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
||
msgid "Guess misplaced $IFDEF"
|
||
msgstr "Adivinhar $IFDEF mal colocado"
|
||
|
||
#: lazarusidestrconsts.srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr "Ime Str"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr "Inserir entrada Registro de Alterações"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr "Inserir do Mapa de Caracteres"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr "Inserir palavra-chave CVS \"Author\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr "Inserir palavra-chave CVS \"Date\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr "Inserir palavra-chave CVS \"Header\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr "Inserir palavra-chave CVS \"ID\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr "Inserir palavra-chave CVS \"Log\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr "Inserir palavra-chave CVS \"Name\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr "Inserir palavra-chave CVS \"Revision\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr "Inserir palavra-chave CVS \"Source\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr "Inserir data e hora atual"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr "Inserir nota GPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr "Inserir um \"GUID\""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr "Inserir nota LGPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "Interromper linha, manter o cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr "Modo de Inserção"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr "Inserir nota LGPL modificada"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr "Inserir nome de usuário atual"
|
||
|
||
#: lazarusidestrconsts.srkmecinspect
|
||
msgid "inspect"
|
||
msgstr "inspecionar"
|
||
|
||
#: lazarusidestrconsts.srkmecinvertassignment
|
||
msgid "Invert assignment"
|
||
msgstr "Inverter atribuição"
|
||
|
||
#: lazarusidestrconsts.srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "Interromper linha e mover o cursor"
|
||
|
||
#: lazarusidestrconsts.srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr "Mover o cursor para o final da linha"
|
||
|
||
#: lazarusidestrconsts.srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr "Modo de seleção de linha"
|
||
|
||
#: lazarusidestrconsts.srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr "Mover cursor para o início da linha"
|
||
|
||
#: lazarusidestrconsts.srkmeclinetextstart
|
||
msgid "Move cursor to text start in line"
|
||
msgstr "Mover cursor para início do texto na linha"
|
||
|
||
#: lazarusidestrconsts.srkmeclockeditor
|
||
msgid "Lock Editor"
|
||
msgstr "Bloquear Editor"
|
||
|
||
#: lazarusidestrconsts.srkmecmakeresourcestring
|
||
msgid "Make resource string"
|
||
msgstr "Criar recurso de sequência de caracteres"
|
||
|
||
#: lazarusidestrconsts.srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr "Ir para o parêntese correspondente"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr "Mover editor a esquerda"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr "Mover editor extremo esquerdo"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
||
msgid "Move editor to new window"
|
||
msgstr "Mover editor para nova janela"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
||
msgid "Move editor to next free window"
|
||
msgstr "Mover editor para próxima janela livre"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
||
msgid "Move editor to prior free window"
|
||
msgstr "Mover editor para janela anterior livre"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr "Mover editor a direita"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr "Mover editor extremo direito"
|
||
|
||
#: lazarusidestrconsts.srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr "Próximo Marcador"
|
||
|
||
#: lazarusidestrconsts.srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr "Ir para o próximo editor"
|
||
|
||
#: lazarusidestrconsts.srkmecnextsharededitor
|
||
msgid "Go to next editor with same Source"
|
||
msgstr "Ir para o próximo editor com o mesmo Fonte"
|
||
|
||
#: lazarusidestrconsts.srkmecnextwindow
|
||
msgid "Go to next window"
|
||
msgstr "Ir para nova janela"
|
||
|
||
#: lazarusidestrconsts.srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr "Modo de seleção normal"
|
||
|
||
#: lazarusidestrconsts.srkmecopenfileatcursor
|
||
msgid "Open file at cursor"
|
||
msgstr "Abrir arquivo sob o cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr "Modo Sobrescrever"
|
||
|
||
#: lazarusidestrconsts.srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr "Mover o cursor para rodapé da página"
|
||
|
||
#: lazarusidestrconsts.srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr "Mover o cursor uma página abaixo"
|
||
|
||
#: lazarusidestrconsts.srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr "Mover cursor uma página a esquerda"
|
||
|
||
#: lazarusidestrconsts.srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr "Mover cursor uma página a direita"
|
||
|
||
#: lazarusidestrconsts.srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr "Mover cursor para cabeçalho da página"
|
||
|
||
#: lazarusidestrconsts.srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr "Mover o cursor uma página acima"
|
||
|
||
#: lazarusidestrconsts.srkmecpaste
|
||
msgid "Paste clipboard to current position"
|
||
msgstr "Colar conteúdo Área de Transferência na posição atual"
|
||
|
||
#: lazarusidestrconsts.srkmecpause
|
||
msgid "pause program"
|
||
msgstr "pausar programa"
|
||
|
||
#: lazarusidestrconsts.srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr "Marcador Anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr "Ir para o editor anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecprevsharededitor
|
||
msgid "Go to prior editor with same Source"
|
||
msgstr "Ir para editor anterior com o mesmo Fonte"
|
||
|
||
#: lazarusidestrconsts.srkmecprevwindow
|
||
msgid "Go to prior window"
|
||
msgstr "Ir para janela anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecprocedurelist
|
||
msgid "Procedure List ..."
|
||
msgstr "Lista de Procedimentos..."
|
||
|
||
#: lazarusidestrconsts.srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr "compilação rápida, sem vinculação"
|
||
|
||
#: lazarusidestrconsts.srkmecremovebreakpoint
|
||
msgid "remove break point"
|
||
msgstr "remover ponto de parada"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveemptymethods
|
||
msgid "Remove empty methods"
|
||
msgstr "Remover métodos vazios"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveunusedunits
|
||
msgid "Remove unused units"
|
||
msgstr "Remover unidades não usadas"
|
||
|
||
#: lazarusidestrconsts.srkmecrenameidentifier
|
||
msgid "Rename identifier"
|
||
msgstr "Renomear identificador"
|
||
|
||
#: lazarusidestrconsts.srkmecreplace
|
||
msgid "Replace text"
|
||
msgstr "Substituir texto"
|
||
|
||
#: lazarusidestrconsts.srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr "reiniciar depurador"
|
||
|
||
#: lazarusidestrconsts.srkmecrun
|
||
msgid "run program"
|
||
msgstr "executar programa"
|
||
|
||
#: lazarusidestrconsts.srkmecrunfile
|
||
msgid "run file"
|
||
msgstr "executar arquivo"
|
||
|
||
#: lazarusidestrconsts.srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr "parâmetros de execução"
|
||
|
||
#: lazarusidestrconsts.srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr "Deslizar uma linha abaixo"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr "Deslizar um caractere a esquerda"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr "Deslizar um caractere a direita"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr "Deslizar uma linha acima"
|
||
|
||
#: lazarusidestrconsts.srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr "Selecinar abaixo"
|
||
|
||
#: lazarusidestrconsts.srkmecselectall
|
||
msgctxt "lazarusidestrconsts.srkmecselectall"
|
||
msgid "Select All"
|
||
msgstr "Selecionar Tudo"
|
||
|
||
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr "Converter tabulações em espaços na seleção"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr "Selecionar o final absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr "Selecionar o início absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr "Selecionar ir para XY"
|
||
|
||
#: lazarusidestrconsts.srkmecselleft
|
||
msgid "SelLeft"
|
||
msgstr "SelLeft"
|
||
|
||
#: lazarusidestrconsts.srkmecsellineend
|
||
msgid "Select Line End"
|
||
msgstr "Selecionar o final da linha"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinestart
|
||
msgid "Select Line Start"
|
||
msgstr "Selecionar o início da Linha"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinetextstart
|
||
msgid "Select to text start in line"
|
||
msgstr "Selecionar para ínicio do texto na linha"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagebottom
|
||
msgid "Select Page Bottom"
|
||
msgstr "Selecionar rodapé da página"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr "Selecionar página abaixo"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr "Selecionar página a esquerda"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr "Selecionar página a direita"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagetop
|
||
msgid "Select Page Top"
|
||
msgstr "Selecionar cabeçalho da página"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr "Selecionar página acima"
|
||
|
||
#: lazarusidestrconsts.srkmecselright
|
||
msgid "SelRight"
|
||
msgstr "SelRight"
|
||
|
||
#: lazarusidestrconsts.srkmecselup
|
||
msgid "Select Up"
|
||
msgstr "Selecionar acima"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordleft
|
||
msgid "Select Word Left"
|
||
msgstr "Selecionar palavra a esquerda"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordright
|
||
msgid "Select Word Right"
|
||
msgstr "Selecionar palavra a direita"
|
||
|
||
#: lazarusidestrconsts.srkmecsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Ajustar um Marcador livre"
|
||
|
||
#: lazarusidestrconsts.srkmecsetmarker
|
||
msgid "Set Marker %d"
|
||
msgstr "Ajustar Marcador %d"
|
||
|
||
#: lazarusidestrconsts.srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr "Shift Tab"
|
||
|
||
#: lazarusidestrconsts.srkmecshowabstractmethods
|
||
msgid "Show abstract methods"
|
||
msgstr "Mostrar métodos abstratos"
|
||
|
||
#: lazarusidestrconsts.srkmecshowcodecontext
|
||
msgid "Show code context"
|
||
msgstr "Mostrar contexto código"
|
||
|
||
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
||
msgid "show execution point"
|
||
msgstr "mostrar ponto execução"
|
||
|
||
#: lazarusidestrconsts.srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr "parar programa"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr "Ir para última posição na célula"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr "Ir para primeira posição na célula"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
||
msgid "Select Cell"
|
||
msgstr "Selecionar Célula"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
||
msgid "Escape"
|
||
msgstr "Escape"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
||
msgid "Next Cell"
|
||
msgstr "Próxima Célula"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr "Próxima Célula (tudo selecionado)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr "Célula Anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr "Célula Anterior (tudo selecionado)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
||
msgid "Start Syncro edit"
|
||
msgstr "Iniciar edição Sincro"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr "Ir para última posição na célula"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr "Ir para primeira posição na célula"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
||
msgid "Select cell"
|
||
msgstr "Selecionar célula"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
||
msgid "Escape"
|
||
msgstr "Escape"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
||
msgid "Finish"
|
||
msgstr "Encerrar"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
||
msgid "Next Cell"
|
||
msgstr "Próxima Célula"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
||
msgid "Next Cell (rotate)"
|
||
msgstr "Próxima Célula (rotacionar)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr "Próxima Célula (tudo selecionado)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
||
msgid "Next Cell (rotate / all selected)"
|
||
msgstr "Próxima Célula (rotacionar / tudo selecionado)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr "Célula Anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr "Célula Anterior (tudo selecionado)"
|
||
|
||
#: lazarusidestrconsts.srkmecsyntaxcheck
|
||
msgid "Syntax check"
|
||
msgstr "Verificação de Sintaxe"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleassembler
|
||
msgid "View assembler"
|
||
msgstr "Exibir assembler"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoint
|
||
msgid "toggle break point"
|
||
msgstr "alternar ponto de parada"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr "Exibir Pontos de parada"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr "Exibir chamada de pilha"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr "Exibir navegador de código"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr "Exibir Explorador de Código"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr "Exibir paleta de componentes"
|
||
|
||
#: lazarusidestrconsts.srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr "Exibir saída do depurador"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr "Alternar entre formulários e unidades"
|
||
|
||
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr "Exibir Editor de Documentação"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
||
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
||
msgid "View IDE speed buttons"
|
||
msgstr "Exibir botões da IDE"
|
||
|
||
#: lazarusidestrconsts.srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr "Exibir variáveis locais"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarker
|
||
msgid "Toggle Marker %d"
|
||
msgstr "Alternar Marcador %d"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarkupword
|
||
msgid "Toggle Current-Word highlight"
|
||
msgstr "Alternar realce Palavra Atual"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr "Exibir mensagens"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr "Modo alternado"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr "Exibir Inspetor de Objetos"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleregisters
|
||
msgid "View registers"
|
||
msgstr "Exibir registradores"
|
||
|
||
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr "Exibir navegador de restrições"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr "Exibir Resultados da Pesquisa"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "Exibir Editor de Código"
|
||
|
||
#: lazarusidestrconsts.srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr "Exibir observadores"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldall
|
||
msgid "Unfold all"
|
||
msgstr "Desdobrar tudo"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldcurrent
|
||
msgid "Unfold at Cursor"
|
||
msgstr "Desdobrar sob o Cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr "editor de comando desconhecido"
|
||
|
||
#: lazarusidestrconsts.srkmecuserfirst
|
||
msgid "User First"
|
||
msgstr "Primeiro Usuário"
|
||
|
||
#: lazarusidestrconsts.srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr "Exibir editor de âncoras"
|
||
|
||
#: lazarusidestrconsts.srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr "Exibir componentes"
|
||
|
||
#: lazarusidestrconsts.srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr "Exibir formulários"
|
||
|
||
#: lazarusidestrconsts.srkmecviewtodolist
|
||
msgid "View todo list"
|
||
msgstr "Exibir lista para fazer (ToDo)"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr "Exibir dependências da unidade"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr "Exibir informações da unidade"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunits
|
||
msgid "View units"
|
||
msgstr "Exibir unidades"
|
||
|
||
#: lazarusidestrconsts.srkmecwordcompletion
|
||
msgid "Word completion"
|
||
msgstr "Complemento palavras"
|
||
|
||
#: lazarusidestrconsts.srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr "Mover cursor uma palavra a esquerda"
|
||
|
||
#: lazarusidestrconsts.srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr "Mover cursor uma palavra a direita"
|
||
|
||
#: lazarusidestrconsts.srkmeditforcmd
|
||
msgid "Edit keys of command"
|
||
msgstr "Editar teclas do comando"
|
||
|
||
#: lazarusidestrconsts.srkmeditkeys
|
||
msgid "Edit Keys"
|
||
msgstr "Teclas de Edição"
|
||
|
||
#: lazarusidestrconsts.srkmgrabkey
|
||
msgid "Grab key"
|
||
msgstr "Captura tecla"
|
||
|
||
#: lazarusidestrconsts.srkmgrabsecondkey
|
||
msgid "Grab second key"
|
||
msgstr "Capturar segunda tecla"
|
||
|
||
#: lazarusidestrconsts.srkmkey
|
||
msgid "Key (or 2 keys combination)"
|
||
msgstr "Tecla (ou combinação de 2 teclas)"
|
||
|
||
#: lazarusidestrconsts.srkmpresskey
|
||
msgid "Please press a key ..."
|
||
msgstr "Favor pressionar uma tecla ..."
|
||
|
||
#: lazarusidestrconsts.uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr "Arquivo é somente leitura"
|
||
|
||
#: lazarusidestrconsts.uefilerotext1
|
||
msgid "The file \""
|
||
msgstr "O arquivo \""
|
||
|
||
#: lazarusidestrconsts.uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr "\" não pode ser escrito."
|
||
|
||
#: lazarusidestrconsts.uelocked
|
||
msgid "Locked"
|
||
msgstr "Bloqueado"
|
||
|
||
#: lazarusidestrconsts.uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "Adicionar &Observador sob o Cursor"
|
||
|
||
#: lazarusidestrconsts.uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "Marcador"
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpages
|
||
msgid "Close All &Other Pages"
|
||
msgstr "Fechar todas as &Outras Páginas"
|
||
|
||
#: lazarusidestrconsts.uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "&Fechar Página"
|
||
|
||
#: lazarusidestrconsts.uemcompletecode
|
||
msgctxt "lazarusidestrconsts.uemcompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Código completo"
|
||
|
||
#: lazarusidestrconsts.uemcopy
|
||
msgctxt "lazarusidestrconsts.uemcopy"
|
||
msgid "Copy"
|
||
msgstr "Copiar"
|
||
|
||
#: lazarusidestrconsts.uemcopyfilename
|
||
#| msgid "Copy filename"
|
||
msgid "Copy Filename"
|
||
msgstr "Copiar nome de arquivo"
|
||
|
||
#: lazarusidestrconsts.uemcopytonewwindow
|
||
#| msgid "Copy to new Window"
|
||
msgid "Clone to new Window"
|
||
msgstr "Clonar para nova Janela"
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindow
|
||
#| msgid "Copy to other Window"
|
||
msgid "Clone to other Window"
|
||
msgstr "Clonar para outra Janela"
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
||
msgid "New Window"
|
||
msgstr "Nova Janela"
|
||
|
||
#: lazarusidestrconsts.uemcut
|
||
msgctxt "lazarusidestrconsts.uemcut"
|
||
msgid "Cut"
|
||
msgstr "Recortar"
|
||
|
||
#: lazarusidestrconsts.uemdebugword
|
||
msgid "Debug"
|
||
msgstr "Depurar"
|
||
|
||
#: lazarusidestrconsts.uemeditorproperties
|
||
msgid "Editor properties"
|
||
msgstr "Propriedades do Editor"
|
||
|
||
#: lazarusidestrconsts.uemencloseselection
|
||
msgctxt "lazarusidestrconsts.uemencloseselection"
|
||
msgid "Enclose Selection"
|
||
msgstr "Circundar Seleção"
|
||
|
||
#: lazarusidestrconsts.uemencoding
|
||
msgid "Encoding"
|
||
msgstr "Codificação"
|
||
|
||
#: lazarusidestrconsts.uemevaluatemodify
|
||
msgid "&Evaluate/Modify..."
|
||
msgstr "&Avaliar/Modificar..."
|
||
|
||
#: lazarusidestrconsts.uemextractproc
|
||
msgctxt "lazarusidestrconsts.uemextractproc"
|
||
msgid "Extract Procedure"
|
||
msgstr "Extrair Procedimento"
|
||
|
||
#: lazarusidestrconsts.uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "&Localizar Declaração"
|
||
|
||
#: lazarusidestrconsts.uemfindidentifierreferences
|
||
msgid "Find Identifier References"
|
||
msgstr "Localizar Referências do Identificador"
|
||
|
||
#: lazarusidestrconsts.uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "&Ir para Marcador"
|
||
|
||
#: lazarusidestrconsts.uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr "Realçador"
|
||
|
||
#: lazarusidestrconsts.ueminserttodo
|
||
msgid "Insert Todo"
|
||
msgstr "Inserir para fazer (ToDo)"
|
||
|
||
#: lazarusidestrconsts.ueminspect
|
||
msgid "&Inspect..."
|
||
msgstr "&Inspecionar..."
|
||
|
||
#: lazarusidestrconsts.ueminvertassignment
|
||
msgid "Invert Assignment"
|
||
msgstr "Inverter Atribuição"
|
||
|
||
#: lazarusidestrconsts.uemlineending
|
||
msgid "Line ending"
|
||
msgstr "Finalização linha"
|
||
|
||
#: lazarusidestrconsts.uemlockpage
|
||
msgid "&Lock Page"
|
||
msgstr "&Bloquear Página"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleft
|
||
msgid "Move page left"
|
||
msgstr "Mover página esquerda"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleftmost
|
||
msgid "Move page leftmost"
|
||
msgstr "Mover página extrema esquerda"
|
||
|
||
#: lazarusidestrconsts.uemmovepageright
|
||
msgid "Move page right"
|
||
msgstr "Mover página direita"
|
||
|
||
#: lazarusidestrconsts.uemmovepagerightmost
|
||
msgid "Move page rightmost"
|
||
msgstr "Mover página extrema direita"
|
||
|
||
#: lazarusidestrconsts.uemmovetonewwindow
|
||
msgid "Move to new Window"
|
||
msgstr "Mover para nova Janela"
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindow
|
||
msgid "Move to other Window"
|
||
msgstr "Mover para outra Janela"
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
||
msgid "New Window"
|
||
msgstr "Nova Janela"
|
||
|
||
#: lazarusidestrconsts.uemnextbookmark
|
||
msgid "Goto next Bookmark"
|
||
msgstr "Ir para o próximo Marcador"
|
||
|
||
#: lazarusidestrconsts.uemodified
|
||
msgid "Modified"
|
||
msgstr "Modificado"
|
||
|
||
#: lazarusidestrconsts.uemopenfileatcursor
|
||
msgid "&Open file at cursor"
|
||
msgstr "&Abrir Arquivo sob o Cursor"
|
||
|
||
#: lazarusidestrconsts.uempaste
|
||
msgctxt "lazarusidestrconsts.uempaste"
|
||
msgid "Paste"
|
||
msgstr "Colar"
|
||
|
||
#: lazarusidestrconsts.uemprevbookmark
|
||
msgid "Goto previous Bookmark"
|
||
msgstr "Ir para o Marcador Anterior"
|
||
|
||
#: lazarusidestrconsts.uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr "Saltar para Procedimento"
|
||
|
||
#: lazarusidestrconsts.uemreadonly
|
||
msgctxt "lazarusidestrconsts.uemreadonly"
|
||
msgid "Read Only"
|
||
msgstr "Somente Leitura"
|
||
|
||
#: lazarusidestrconsts.uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr "Refatorar"
|
||
|
||
#: lazarusidestrconsts.uemrenameidentifier
|
||
msgid "Rename Identifier"
|
||
msgstr "Renomear Identificador"
|
||
|
||
#: lazarusidestrconsts.uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "&Executar até o Cursor"
|
||
|
||
#: lazarusidestrconsts.uemsetbookmark
|
||
msgid "&Set Bookmark"
|
||
msgstr "&Ajustar Marcador"
|
||
|
||
#: lazarusidestrconsts.uemsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Ajustar um Marcador livre"
|
||
|
||
#: lazarusidestrconsts.uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr "Mostrar Número de Linhas"
|
||
|
||
#: lazarusidestrconsts.uemshowunitinfo
|
||
msgid "Unit Info"
|
||
msgstr "Informações da Unidade"
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmark
|
||
msgid "&Toggle Bookmark"
|
||
msgstr "&Alternar Marcador"
|
||
|
||
#: lazarusidestrconsts.uemtogglebreakpoint
|
||
msgid "&Toggle Breakpoint"
|
||
msgstr "&Alternar Pontos de Parada"
|
||
|
||
#: lazarusidestrconsts.uemviewcallstack
|
||
msgid "View Call Stack"
|
||
msgstr "Exibir Chamada de Pilha"
|
||
|
||
#: lazarusidestrconsts.uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr "Não implementado ainda"
|
||
|
||
#: lazarusidestrconsts.uenotimplcapagain
|
||
msgid "I told You: Not implemented yet"
|
||
msgstr "Já lhe disse: não foi implementado ainda"
|
||
|
||
#: lazarusidestrconsts.uenotimpltext
|
||
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
||
msgstr "Se você puder nos ajudar a implementar este recurso, envie um e-mail para lazarus@miraclec.com"
|
||
|
||
#: lazarusidestrconsts.uepins
|
||
msgid "INS"
|
||
msgstr "INS"
|
||
|
||
#: lazarusidestrconsts.uepovr
|
||
msgid "OVR"
|
||
msgstr "OVR"
|
||
|
||
#: lazarusidestrconsts.uepreadonly
|
||
msgid "Readonly"
|
||
msgstr "Somente Leitura"
|
||
|
||
#: lazarusidestrconsts.versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr "Informações versão"
|
||
|