lazarus/languages/lazaruside.nl.po
2010-04-02 22:30:09 +00:00

14956 lines
410 KiB
Plaintext

msgid ""
msgstr ""
"Project-Id-Version: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2007-06-05 09:18+0100\n"
"Last-Translator: Darius Blaszijk <dhkblaszyk@zeelandnet.nl>\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Algemeen"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr ""
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Niet wijzigbaar"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Kleine letters, eerste letter hoofdletter"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Regel"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr ""
#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Additionele bron zoek pad voor alle projecten (.pp, .pas)"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr ""
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Bewerk bovenste lijn"
#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Alle bestanden"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabetisch"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr ""
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Dubbelzinnig bestand actie:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Waarschuw voor compilatie"
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Applicatie instellingen"
#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "Standaard"
#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "Gebruik assertie code"
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automatisch maken van formulieren"
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Nieuwe forms toevoegen aan de \"auto-created forms\""
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Verwijder bestand automatisch"
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr ""
#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr ""
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Automatisch hernoemen bestand naar kleine letters"
#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Automatisch saven"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Beschikbare Forms:"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Achtergrond"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(geen subdirectory)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Dezelfde naam (in subdirectorie)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Achter methoden"
#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr ""
#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr "Blok inspringen"
#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr ""
#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "TP/BP 7.0 Compatibel"
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""
#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr ""
#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Toepassen"
#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Annuleren"
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr ""
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr ""
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Klassevolgorde"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Laatste"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "Kleine letters"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Voorbeeld (Max regellengte = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Lees voorloop"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Opgeslagen postfix"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "HOOFDLETTERS"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Variabele prefix"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Schrijf voorvoegsel"
#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Centreer Cursor line"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Opslaan als - Pascal bestands namen converteren naar kleine letters."
#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Controleer consistentie"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr ""
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Kies code sjabloonbestand (*.dci)"
#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Klassegedeelte toevoegingsbeleid"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Toon sluitknoppen in notebook"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Kleuren schema"
#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "C -stijl macro's (globaal)"
#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Gebruik ANSI strings"
#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "As-Is"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr ""
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "Controleert:"
#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Compilatie"
#: lazarusidestrconsts.dlgcoconditionals
msgid "Conditionals"
msgstr ""
#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "C -stijl Operators (*=, +=, /= and -=)"
#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr ""
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Maak MakeFile"
#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr ""
#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr ""
#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "genereer Debugging info voor DBX (Compileert langzamer)"
#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "Debugging:"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Debugger pad toevoeging (geen):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Codecreatie"
#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr ""
#: lazarusidestrconsts.dlgcodegeneration
msgid "Code"
msgstr "Code"
#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "CodeTools instellingen"
#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "Snellere Code"
#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Genereer Debugging info voor GDB (Compileert langzamer)"
#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "Genereer:"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Gebruik Heaptrc unit"
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Include bestanden (-Fi):"
#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Overerfd"
#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr ""
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Bibliotheken (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Linken"
#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Laden/Bewaren"
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr ""
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr ""
#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr ""
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Command line parameters (zonder applicatie naam)"
#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr ""
#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr ""
#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr ""
#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr ""
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Compileropties"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Completeer properties"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "Configuratiebestanden:"
#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr "Normale code"
#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Opties:"
#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Ander"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Overloop"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Ontleden"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr ""
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""
#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Bereik"
#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "Toon fouten"
#: lazarusidestrconsts.dlgcoshowoptions
#, fuzzy
#| msgid "Show Options"
msgid "&Show Options"
msgstr "Toon opties"
#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "Kleinere code"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Slim te linken"
#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Andere Bronnen (.pp / .pas bestanden, alleen door IDE gebruikt)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Stack"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Verwijderen symbolen uit het uitvoerbaar bestand."
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "Unitstijl:"
#: lazarusidestrconsts.dlgcouseasdefault
msgid "Use these compiler options as default for new projects"
msgstr ""
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Genereer code voor valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr ""
#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "C++-achtige INLINE"
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Cursor voorbij EOL"
#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor:"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr ""
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Door gebruiker gedefinieerde extensie (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Debuggertype en pad"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Standaard editorfont"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Standaardwaarde"
#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Delphi 2 extensies"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Verwijder template"
#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Delphi compatibel"
#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Bureaublad"
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr ""
#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "Bureaubladbestanden"
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr ""
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr ""
#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr ""
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Richting"
#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Folder bestaat niet"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr ""
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr ""
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr ""
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr ""
#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr ""
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr ""
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr ""
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr ""
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "Omlaag"
#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr "Toevoegen ..."
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Terug"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Vet"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Subdirectorie"
#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Broncode templates"
#: lazarusidestrconsts.dlgedcolor
#, fuzzy
#| msgid "Syntax highlight"
msgctxt "lazarusidestrconsts.dlgedcolor"
msgid "Colors"
msgstr "Kleur"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Complete blocks"
msgstr ""
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Door gebruiker gedefinieerde extensie"
#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Vertraging"
#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr "Verwijder"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Beeld"
#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr "Bewerken ..."
#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "Editor bestanden"
#: lazarusidestrconsts.dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr "Hint: klik op de actie die u wilt bewerken"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Identifier completering"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr ""
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Italic"
#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Editor Fonts"
#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "Tekstverwerker lettertype hoogte"
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr ""
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr ""
#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "Geen fouten in toets mapping gevonden."
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr ""
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr ""
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Onderstreep"
#: lazarusidestrconsts.dlgedusedefcolor
msgid "Use default color"
msgstr "Gebruik standaard kleur"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr ""
#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr ""
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Vraag"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Toelichting: Project bestanden zijn alle bestanden in de project directorie"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Backup"
#: lazarusidestrconsts.dlgenvcolors
msgctxt "lazarusidestrconsts.dlgenvcolors"
msgid "Colors"
msgstr "Kleuren"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Bestanden"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Raster"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Taal"
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Richtlijnen"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Overige"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Geen"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "Andere bestanden"
#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Project"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Type"
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr ""
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr ""
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Extra regel afstand"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr ""
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Bestands extensie"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Zoek Tekst (op cursor)"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr ""
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Programma"
#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr ""
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcomment
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlnode
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr ""
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Voorgrond kleur"
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Wijze van procedures toevoegen"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Houd procedure volgorde aan"
#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Compilerpad (%s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "FPC broncode directory"
#: lazarusidestrconsts.dlgframecolor
msgid "Frame color"
msgstr ""
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Formulierbewerker"
#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr ""
#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Opties"
#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr ""
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "positie"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr ""
#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "GPC (GNU Pascal Compiler) Compatibel"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Genereer code voor gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Kleur opnemen"
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Rasterkleur"
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Rastergrootte X"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Horizontale rasterafstand"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Rastergrootte Y"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Vertikale stapgrootte van raster"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr ""
#: lazarusidestrconsts.dlggroupdebugger
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr ""
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Omgeving"
#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "Help"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr ""
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Toon steunlijnen"
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Goot kleur"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr ""
#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Goot breedte"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Halve pagina scroll"
#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "Heap grootte"
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Hoogte:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Verberg IDE vensters bij uitvoeren"
#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr ""
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr ""
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr ""
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Toon Hints voor parameter \"Sender\" niet gebruikt"
#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Toon Hints voor ongebruikte units in de hoofd broncode"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home toets springt naar dichtsbijzijnde begin"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Host applicatie"
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Identifier completering"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Identifier beleid"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr ""
#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Negeren"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Include systeemvariabelen"
#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Laat code inspringen tot"
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Indent and Tabs:"
msgstr ""
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Voor methoden"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Constructor naam moet zijn 'init' (destructor moet zijn 'done')"
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Spatie achter invoegen"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Spatie voor invoegen"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Interval in seconden"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Springen ('Method Jumping')"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr ""
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Toets mapping"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Toets mapping fouten"
#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Toets mapping schema"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Sleutelwoord policy"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Sta LABEL en GOTO toe"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Taal"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Laatste (einde broncode)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Lazarus directory (standaard voor alle projecten)"
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Links:"
#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "Kleur voor links, boven"
#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr ""
#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Level 0 (geen extra optimalisaties)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Regel splitsen"
#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr "Linkstijl"
#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "Slim linken"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Toon regelnummers in Run-time Error Backtraces"
#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Laad desktop instelling van een bestand"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Hoofd menu"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Toon Project Forms"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr ""
#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Toon Project Units"
#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Make pad"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Marge en goot"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Marker kleur"
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim Spaces (when highlighting current selection)"
msgstr ""
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximum teller"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Max regellengte"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Max aantal recente bestanden"
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Max aantal recente projecten"
#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Wijze van methode toevoegen"
#: lazarusidestrconsts.dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr "Alles minimaliseren bij het minimaliseren van het hoofdscherm"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mix methodes en properties"
#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "Ingeschakeld"
#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldgroup2
msgid "Setting 2"
msgstr ""
#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse:"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "Toevoegen"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "Annuleren"
#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr "Verwijder"
#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "Omlaag"
#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnok
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "Wijzig"
#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "Naar boven"
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Volgorde"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Selectie"
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Meervoudige selectie"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Naamgeving"
#: lazarusidestrconsts.dlgnoautomaticrenaming
#, fuzzy
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "niet automatisch hernoemen"
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr ""
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr ""
#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Splits een regel niet na :"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Splits een regel niet voor :"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr ""
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Item hoogte"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Overige"
#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Opties"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr ""
#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "Optimaliseringen:"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Andere unit bestanden (-Fu)"
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr ""
#: lazarusidestrconsts.dlgpackagegraph
msgid "Package Graph"
msgstr ""
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Hints voor componenten palet"
#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Standaard pascal extenties"
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Geef opties door aan de linker (Spatie is scheidingsteken)"
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr ""
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr ""
#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr ""
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Applicatie"
#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr ""
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Forms"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr ""
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr ""
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr ""
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr ""
#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr ""
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Overige"
#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Uitvoer Instellingen"
#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr ""
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sessie"
#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Doelbestandsnaam:"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titel:"
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr ""
#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest file to enable themes (windows only)"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Project Opties"
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr ""
#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "Project bestanden"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr ""
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Propertie completering"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Propertie naam"
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Open laatste project bij start"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Toon \"\"border spacing\"\""
#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr ""
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Toon grid"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Aan raster plakken"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referentie"
#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr ""
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Vervang &alles"
#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "&Vervang Door"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Rapporteer"
#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "Kleur voor rechts, onder"
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "Rechts klikken selecteert"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Rechter marge"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Werkdirectory"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr ""
#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Creatie"
#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Selectie"
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Display (niet voor win32, bv. 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Omgeving"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Lokaal"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Systeem variabelen"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Gebruik display"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Gebruiker voorkeuren"
#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr ""
#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "Variabele"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Start parameters"
#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Desktop instelling opslaan in een bestand"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Bewaar bewerker informatie voor gesloten bestanden"
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Sla alleen bewerker informatie op voor project bestanden"
#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Scope"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Scroll met een minder"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling:"
msgstr ""
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Scroll voorbij het einde van het bestand"
#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Scroll voorbij het eind van de regel"
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Zoekopdracht afgebroken door de gebruiker"
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "Bezig met zoeken ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Paden:"
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr ""
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Geef alle element standaardwaarde"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Geef element standaardwaarde"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Geef property variabele een waarde"
#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Toon component titels"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Toon gecompileerde procedures"
#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Toon compiler opties"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Toon voorwaarden"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Toon debug informatie"
#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Toon gedefinieerde macros"
#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Toon bewerker hints"
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Toon alles"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Toon info uitvoerbaar bestand (Win32)"
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Toon algemene info"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Toon goot hints"
#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Toon Hints"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Toon regelnummers"
#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Toon notities"
#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Toon niets (alleen fouten)"
#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Toon alle procs bij een fout"
#: lazarusidestrconsts.dlgshowscrollhint
msgid "Show scroll hint"
msgstr "Toon scroll hint"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Toon samenvatting"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Toon geteste bestanden"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Toon gebruikte bestanden"
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Toon waarschuwingen"
#: lazarusidestrconsts.dlgskipforwarddeclarations
msgid "Skip forward declarations"
msgstr ""
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Slimme tabs"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbool erachter (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Teller (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbool ervoor (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Aan steunlijnen plakken"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Spatie"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Hints voor snelknoppen in hoofdbalk (openen, opslaan, ...)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Oorsprong"
#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "\"Static\"-sleutelwoord in objecten"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Stop na aantal fouten:"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr ""
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Syntax opties"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab laat blokken inspringen"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr ""
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabs naar spaties"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr ""
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr ""
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr ""
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr "Doelplatform:"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr ""
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Folder voor bouwen van test projecten"
#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "&Zoek tekst"
#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "De directorie \""
#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "sec"
#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Tooltip expressie evaluatie"
#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Tooltip symbool Hulpmiddelen"
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Top:"
#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Template bestandsnaam"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr ""
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Spatie aan het eind verwijderen"
#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Onzekere optimalisaties"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Ongedaan maken na Opslaan"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo:"
msgstr ""
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limiet ongedaan maken"
#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr ""
#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Unit afhankelijkheden"
#: lazarusidestrconsts.dlgunitdeprefresh
msgid "Refresh"
msgstr "Verversen"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr ""
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr ""
#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "Naar boven"
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "Code inschuiven"
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional Compiler Config File"
msgstr ""
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr ""
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Gebruik standaard compiler configuratie bestand (fpc.cfg)"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Gebruik start programma"
#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr ""
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Gebruik syntax highlighting"
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Waarde"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Aantal melding tijdens compilatie:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Zichtbare goot"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Zichtbare rechter marge"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr ""
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Breedte:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Venster"
#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Venster Posities"
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Woorden"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Voorbeeld"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Maak een FPC logo"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Meervoudig geselecteerd componenten moeten van een enkel form zijn"
#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "Lijn uit"
#: lazarusidestrconsts.fdmdeleteselection
#, fuzzy
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Verwijder selectie"
#: lazarusidestrconsts.fdmmirrorhorizontal
#, fuzzy
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Spiegel horizontaal"
#: lazarusidestrconsts.fdmmirrorvertical
#, fuzzy
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Spiegel vertikaal"
#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Volgorde"
#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Een terug"
#: lazarusidestrconsts.fdmorderforwardone
#, fuzzy
#| msgid "Forward one"
msgid "Forward One"
msgstr "Een vooruit"
#: lazarusidestrconsts.fdmordermovetoback
#, fuzzy
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Breng naar achter"
#: lazarusidestrconsts.fdmordermovetofront
#, fuzzy
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Breng naar voren"
#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as xml"
msgid "Save form as XML"
msgstr "Sla formulier als xml op"
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Schaal"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Selecteer Alles"
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Grootte"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Optie: Snap to grid"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Optie: snap naar guide lijnen"
#: lazarusidestrconsts.fdmtaborder
#, fuzzy
#| msgid "Tab order..."
msgid "Tab Order..."
msgstr "Tab volgorde..."
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr ""
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""
#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Bestand toevoegen"
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Bestanden toevoegen"
#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Voeg bestanden toe aan pakket"
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Voeg .lfm- of .lrs-bestanden toe, indien ze bestaan"
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Voeg aan pakket toe"
#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Unit Toevoegen"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Dubbelzinnig ancestor type"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Dubbelzinnige klasse naam"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Dubbelzinnige unit naam"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Ancestor Type"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Gebroken Afhankelijkheden"
#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr ""
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Klassenaam bestaat reeds"
#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr "Maak een nieuw bestand"
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Afhankelijkheid"
#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sBestaand bestand: %s%s%s"
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Bestand bestaat reeds"
#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Bestand %s%s%s bestaat reeds in het project."
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Bestand al aanwezig in pakket"
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Bestand wordt gebruikt"
#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Bestandsnaam:"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Bestandsnaam"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Bestand is geen unit"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Ongeldige Ancestor Type"
#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Ongeldige Cirkel"
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Ongeldige Class naam"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Ongeldig bestand"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Ongeldige bestandsnaam"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Ongeldige unit naam"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s is geen geldige unit naam."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nieuwe Class naam:"
#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "Nieuw Component"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nieuw bestand"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Geen pakket gevonden voor afhankelijkheid %s%s%s.%sKies een bestaand pakket."
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Naam van pagina te lang"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Palette pagina:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascal units moeten de .pp of .pas extensie hebben"
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Bewaar bestand dialoogvenster"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Verkort of verleng bestandsnaam"
#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr "Toon alles"
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Wissel paden om"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Het type van de ancestor %s%s%s heeft dezelfde naam als%sde unit %s%s%s."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Het type van de ancestor %s%s%s is geen geldige pascal identifier."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "De naam van de klasse %s%s%s en het type van de ancestor %s%s%s zijn gelijk."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "De naam van de klasse %s%s%s bestaat al in%sPackage %s%sBestand: %s%s%s"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "De naam van de klasse %s%s%s is dezelfde als%sde unit %s%s%s."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "De naam van de klasse %s%s%s is geen geldige pascal identifier."
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Het bestand %s%s%s maakt al deel uit van het package."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Het bestand %s%s%s is onderdeel van het huidige project.%sHet is niet aan te raden bestanden te delen tussen project en packages."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "De bestandsnaam %s%s%s is onduidelijk, omdat het package geen standaard directorie heeft.%sGeef een bestandsnaam inclusief het pad."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Het package heeft al een afhankelijkheid van package %s%s%s."
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Het package %s%s%s is niet geldig.%sKies een bestaand package."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "De naam van de pagina %s%s%s is te lang (max. 100 letters)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "De unitnaam %s%s%s bestaat al in het package:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "De unitnaam %s%s%s bestaat al in dit package."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "De naam van de unit %s%s%s%sen de bestandsnaam %s%s%s verschillen"
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "De unitnaam %s%s%s correspondeert niet met de bestandsnaam."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "De unitnaam %s%s%s is gelijk aan die van een geregistreerd component.%Dit kan tot vreemde foutmeldingen leiden."
#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Unit bestandsnaam:"
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Unit bestand naam:"
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Unitnaam:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Unitnaam bestaat al"
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Unitnaam ongeldig"
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Zoek in de Unit naar de unit Naam en Register procedure"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr ""
#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr ""
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Alles afbreken"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Het laden afbreken"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Het laden van het project afbreken"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr ""
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr ""
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Informatie over Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr ""
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Kan de lijst van medewerkers niet vinden."
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr ""
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "A %s kan geen TControls bevatten.%sU kunt er alleen niet-visuele componenten op plaatsen."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr ""
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr ""
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Activeer reguliere-expressiesyntax voor tekst en vervanging"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr ""
#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr ""
#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr ""
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Additionele compiler opties gelijk aan die van packages"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr ""
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr ""
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "%s aan het project toevoegen?"
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr ""
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr ""
#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr ""
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Voeg bestand aan pakket toe"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Doelpakket"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Bestandstype"
#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Heeft Register procedure"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Ongeldig Package"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Ongeldige package ID: %s%s%s"
#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Virtuele unit (broncode is geen onderdeel van package"
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Pakket niet wijzigbaar"
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Pakket %s%s%s niet gevonden."
#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "Toon alles"
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Het package %s is niet wijzigbaar"
#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "Unitnaam: "
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Een bestand %s%s%s bestaat al.%sOverschrijven?"
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Uitlijning"
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Alle blokken zien er goed uit"
#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Alle bestanden"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr ""
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr ""
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Sta het zoeken naar meerdere lijnen toe"
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr ""
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr ""
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Dubbelzinnig bestand gevonden"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Dubbelzinnig bestand gevonden: %s%s%s%sDit bestand kan worden verward met %s%s%s%s%sHet dubbelzinnige bestand verwijderen?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Dubbelzinnige bestanden gevonden"
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Dubbelzinnige unit gevonden"
#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Anker bewerker - geen control geselecteerd"
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ankers van geselecteerde controls"
#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Anker naar onderzijde van verwante, behoud randruimte"
#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Anker naar linkerzijde van verwante, behoud randruimte"
#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Anker naar rechterzijde van verwante, behoud randruimte"
#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Anker naar bovenzijde van verwante, behoud randruimte"
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Bij het laden van %s is er laatst een fout opgetreden!%s%sDit project opnieuw laden?"
#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr ""
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr "Applicatie%sEen grafisch lcl/freepascal programma. Het bestand wordt automatisch door Lazarus bijgehouden."
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr ""
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr ""
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr ""
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Randruimte rond het control. De andere vier randruimtes worden opgeteld aan deze waarde."
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Een simpel pascal programma bestand.%sDeze kan gebruikt worden voor een snelle test.%sHet is beter een nieuw project te maken."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Vraag voor het vervangen van gevonden tekst"
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr ""
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr ""
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr ""
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr ""
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr ""
#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr ""
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Automatic features"
msgstr "Automatische kenmerken"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr ""
#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Beschikbare pakketten"
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr ""
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Backup bestand gefaald"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Wijzigen van de package naam of de versie verbreekt afhankelijkheden. Moeten deze afhankelijkheden ook worden gewijzigd?%sKies Ja om alle weergegeven afhankelijkheden te wijzigen.%sKies Negeren om de afhankelijkheden te verbreken."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "begint met"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr ""
#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "Bouw"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr ""
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr ""
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr ""
#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "Starten"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Run commando"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr ""
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr ""
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr ""
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr ""
#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr "Randruimte"
#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Bodem randruimte. Deze waarde wordt toegevoegd aan de basis randruimte en gebruikt voor de ruimte onder het control."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Bodem ankering"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Bodems"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Dit is het verwante control waaraan de bodemzijde is verankerd. Laat het leeg voor ouders."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Bodem gelijk gespaceerd"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr ""
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr ""
#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Blader voor Compiler (%s)"
#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr ""
#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "Doorgaan"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr ""
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr ""
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr ""
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr ""
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr ""
#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr ""
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Bouw nieuw project"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr "Bouw Number"
#: lazarusidestrconsts.lisbuildvariables
msgid "Build variables"
msgstr ""
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr ""
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Annuleren"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr ""
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Laden van de unit annuleren"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Hernoemen annuleren"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Kan top-level component niet kopiëren."
#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Kan bestand %s%s%s niet maken"
#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Kan Lazarus Starter niet vinden:%s%s"
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Alleen the class van TComponents kan gewijzigd worden."
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr ""
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr ""
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""
#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr ""
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr ""
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr ""
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Fout"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr ""
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr ""
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr ""
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr ""
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr ""
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr ""
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr ""
#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr ""
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr ""
#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr ""
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr ""
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr ""
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr ""
#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr ""
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr ""
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr ""
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr ""
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr ""
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr ""
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr ""
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr ""
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr ""
#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr "(Filter)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Volg cursor"
#: lazarusidestrconsts.liscein
msgid "%s in %s"
msgstr ""
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr ""
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr ""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr ""
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr ""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr ""
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr ""
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr ""
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr ""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr ""
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr ""
#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr ""
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centreer in window"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Middenpunten"
#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr ""
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr ""
#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr ""
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nooit, alleen handmatig"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "On idle"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Automatisch verversen"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Ander"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Update"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Bij het wisselen van bestand in de bewerker"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr ""
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr ""
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr ""
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr ""
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr ""
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr ""
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr ""
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr ""
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr ""
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr ""
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr ""
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Wijzig Class"
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr ""
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr ""
#: lazarusidestrconsts.lischangeparent
msgid "Change Parent..."
msgstr ""
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr ""
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Karakter tabel"
#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Controleer wijzigingen op schijf tijdens het laden"
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr ""
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Kies een andere naam"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr ""
#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr ""
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr ""
#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Kies compilerbestandsnaam (%s)"
#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Kies debuggerbestandsnaam"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Kies Delphi-unit (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Kies directory"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Kies FPC-directory"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Kies Lazarus-directory"
#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Kies maakpad"
#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Kies een van deze items om een nieuw bestand te maken"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Kies een van deze items om een nieuw Package te maken"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Kies een van deze items om een nieuw Project te maken"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Kies programmabroncode (*.pp, *.pas, *.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Kies structuur om selectie te omsluiten"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr ""
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr ""
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr ""
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Class %s%s%s is geen geregistreerde componentklasse.%sKan niet plakken."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Klasse niet gevonden"
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Maak directory schoon"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Maak sub directory schoon"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Behoud alle Tekst bestanden"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Bewaar bestanden die aan het filter voldoen"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Overeenkomende bestanden verwijderen"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Eenvoudige syntax (* i.p.v. .*)"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Maak Lazarus-broncode schoon"
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Unit pad opschonen?"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr ""
#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr ""
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""
#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "&Sluiten"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "LCL Interface specifieke opties:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parameter"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr ""
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr ""
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr ""
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr ""
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Dubbelzinnige, extra compiler configuratie bestand"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Aanroepen bij:"
#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "Bouw"
#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "Compileren"
#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "Starten"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sKlik op OK als je zeker weet dat je dat wilt doen."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Opdracht:"
#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr ""
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "standaard (%s)"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr ""
#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Voeg link toe"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Pad toevoegen"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr ""
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr ""
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Verwijder link"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Verwijder pad"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr ""
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr ""
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Voorbeeld"
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Voeg \"code\" opmaak-tag in"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Voeg \"schuin\" opmaak-tag in"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Voeg opmerking opmaak-tag in"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Voeg \"onderstreep\" opmaak-tag in"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Voeg var opmaak-tag in"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Overerfd"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr ""
#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr ""
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<GEEN>"
#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr ""
#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr ""
#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr ""
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Zie ook"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Kort"
#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr ""
#: lazarusidestrconsts.liscodehelpshowunusedunits
msgid "Show unused units"
msgstr ""
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr ""
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr ""
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr ""
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr ""
#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "Toevoegen"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Codesjabloon toevoegen"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr " Het teken %s%s%s bestaat al !"
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr ""
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Wijzig"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Commentaar:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Bewerk code template"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Fout"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Teken:"
#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Actie: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Automatisch gemaakte nodes kunnen niet bewerkt worden,%tevens kunnen ze geen automatisch gemaakte Child nodes bevatten."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, automatisch gegenereerd"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Automatisch gegenereerde nodes kunnen niet bewerkt worden."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor voor codeerhulpmiddelendefinities"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Voorbeeld codeerhulpmiddelendefinities"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "Pad naar compiler"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Converteer node"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Maak definities voor %s folder"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Maak definities voor Free Pascal Compiler"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Maak definities voor Free Pascal SVN broncode"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Maak definities voor Lazarusfolder"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Maak definities voor %s Project"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Maak FPC-macro's en paden voor een fpc-projectfolder"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definieer"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definieer recursief"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Verwijder node"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "The %s hoofddirectory,%swaar Borland alle %s broncode installeert.%sBijvoorbeeld C:/Program Files/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert,%sdie worden gebruikt door dit %s project.%sBijvoorbeeld: C:/Program Files/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Beschrijving:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s directory"
#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Bewerken"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Fout bij lezen %s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Fout bij lezen project info bestand %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Fout bij het schrijven %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Fout tijdens het schrijven project info file %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "Verlaat"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Verlaat zonder Opslaan"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "FPC SVN broncode directory"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Folder"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Delphi 5 Compiler Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Delphi 5 Directorie Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Delphi 5 Project Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Delphi 6 Compiler Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Delphi 6 Directorie Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Delphi 6 Project Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Delphi 7 Compiler Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Delphi 7 Directorie Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Delphi 7 Project Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Invoegen FP Compiler Template"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Invoegen FP project Template"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Voeg Free Pascal SVN broncode template in"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Kylix 3 Compiler template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Kylix 3 Directorie template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Kylix 3 Project template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Lazarus Directorie Template invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Node als \"child\" invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Node onder invoegen"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Invoegen Template"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Ongeldige parent"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Ongeldige parent node"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Vorige node is ongeldig"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert.%sBijvoorbeeld: /home/user/kylis%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert,%sdie worden gebruikt door dit %s project.%sBijvoorbeeld: /home/user/kylis%s"
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Lazarus directorie"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Verplaats node omlaag"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Verplaats node een level omlaag"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Verplaats node een level omhoog"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Verplaats node omhoog"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Naam:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "NieuweNode"
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Node en de child-nodes alleen geldig voor dit project"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Node is niet wijzigbaar"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "geen geselecteerd"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Parent node kan geen child nodes bevatten."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Vorige node kan geen child nodes bevatten"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s projectdirectory"
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Leesfout"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Opslaan en Afsluiten"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Geselecteerde node:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "De Free Pascal SVN-broncode directory. Niet verplicht. Het verbetert het declaraties zoeken en debuggen."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "De Free Pascal project directorie."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "De Free Pascal SVN-broncode directory."
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "De hoofddirectorie van Lazarus"
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Het pad naar de Free Pascal compiler.%s Bijv: %s/usr/bin/%s -n%s of %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Het pad naar de free pascal compiler voor dit project. Alleen nodig als je de bron FPC SVN hieronder zet. Wordt gebuikt om automatisch macros te maken."
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "De %s project directorie,%waar de .dpr, .dpk bestanden staan."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Ondefinieer"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Ondefinieer alles"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Ondefinieer recursie"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Waarde als tekst"
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variabele:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Schrijffout"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Bij"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Dubbele punt"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Komma"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identifier"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Sleutelwoord"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nieuwe regel"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Geen"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Nummer"
#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Punt"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Puntkomma"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Spatie"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "String constante"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbool"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Voer uit Na"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Voer uit Voor"
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr ""
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr ""
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr ""
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Commando-uitvoer"
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Opdracht na ongeldig"
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Opdracht na publiceren module"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Command line parameters van het programma"
#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Compileer IDE (zonder Linking)"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compiler"
#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "Compilerfout"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Error: ongeldige compiler: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Compilerbestandsnaam"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Hint: u kunt het pad naar de compiler opgeven in Omgeving -> Omgevingsopties -> Bestanden -> Compiler Pad"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Opmerking: Configuratie bestand voor code tools niet gevonden - de standaard wordt gebruikt"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Opmerking: Oude configuratie bestand voor code tools wordt geladen: "
#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Compileropties voor project: %s"
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (compileren ...)"
#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr ""
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Componentnaam %s%s%s is sleutelwoord"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Component Naam %s%s%s is geen geldige identifier"
#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "Vind component"
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Open een Pakket"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Open unit"
#: lazarusidestrconsts.liscomptest
#, fuzzy
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "Test"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr ""
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Lazarus configuratie directorie"
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr ""
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Bevestig wijzigingen"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr ""
#: lazarusidestrconsts.lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus?"
msgstr "Wil je Lazarus opnieuw bouwen?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr ""
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr ""
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "bevat"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr ""
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Doorgaan"
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Doorgaan zonder het form te laden"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Medewerkers"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Parent vereist voor control"
#: lazarusidestrconsts.lisconvautoremoveproperties
msgid "Automatic removal of unknown properties"
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Conversiefout"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr ""
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr ""
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr ""
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr ""
#: lazarusidestrconsts.lisconverttarget1
msgid "Lazarus/LCL"
msgstr ""
#: lazarusidestrconsts.lisconverttarget2
msgid "Lazarus/LCL for Windows only"
msgstr ""
#: lazarusidestrconsts.lisconverttarget3
msgid "Both Lazarus/LCL and Delphi"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunitstypesproperties
msgid "Units, Types and Properties"
msgstr ""
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr ""
#: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard
msgid "Copy all and hidden messages to clipboard"
msgstr "Kopieer alle (ook verborgen) berichten naar het klembord"
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr "Kopieer alle berichten naar klipbord"
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Kopieerfout"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Kopieerfout"
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Een geheel formulier kopiëren is niet geimplementeerd."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Kopieer de geselecteerde boodschap naar het klembord"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Zoek naar FPC meldingen"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Zoek naar Make meldingen"
#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Toon alle berichten"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Sla compiler aanroep over"
#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Doel-OS-specifieke opties"
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr ""
#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (diversen)"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Waarschuwing: Het extra compiler configuratie bestand heeft dezelfde naam als een van de standaard configuratie bestanden waar de FreePascal compiler naar zoekt. Dit kan leiden tot het alleen verwerken van het extra configuratie bestand en het overslaan van de standaard configuraite."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Open Pakket %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Open unit %s"
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Maak eerst een project!"
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr ""
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr ""
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr ""
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr ""
#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr "Maak nieuw bestand"
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr ""
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Kies directory"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Codeerhulpmiddelen mappen instellingen"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definieer templates"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Geen variabele geselecteerd>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Open voorbeeld"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Hulpmiddelen"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Variabele: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Variabelenaam"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Templates"
#: lazarusidestrconsts.lisctinsertmacro
msgid "Insert Macro"
msgstr "Macro invoegen"
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "selecteer een macro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Selecteer Code Macro"
#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr ""
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Cursor kolom in huidige editor"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Cursor rij in huidige editor"
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "aanpasbare opties"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Aanpasbare Opties"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Aanpasbaar Programma"
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr "Aanpasbaar Programma%sEen Freepascalprogramma."
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr ""
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Datum"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Geen debugger aangegeven"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Zet toch een breekpunt"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Er is geen debugger ingesteld.%Het plaatsen van breakpoints heeft geen effect totdat je een debugger hebt aangegeven in de Debugger Instellingen in het menu."
#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "Debuggerfout"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Debugger error%sOeps, de debugger is gecrashed%sSla uw werk op!%sKies Stop, en hoop voor het beste!"
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Debugger ongeldig"
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (aan het debuggen ...)"
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Additioneel zoekpad"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Breekpunt"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Maak schoon log on run"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Algemene debugger opties"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Specifieke opties debugger (hangt af van het type debugger)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgid "Event Log"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Negeer deze exceptions"
#: lazarusidestrconsts.lisdebugoptionsfrminterface
msgid "Interface"
msgstr "Interface"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Taal uitzonderingen"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Beperk regeltelling tot"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr "Naam"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proces"
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Hervat"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Ga verder"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Ga verder met overige"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Toon meldingen bij stoppen"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signalen"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"
#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr "Venster"
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Kan het bestand niet laden"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Kan het bestand %s%s%s niet laden."
#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr ""
#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr ""
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr ""
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Al deze bestanden verwijderen?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Verwijder dubbelzinnig bestand?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""
#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr ""
#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr ""
#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeletebuildvar
msgid "Delete build variable %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Verwijderen bestand mislukt"
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Verwijder oud bestand %s%s%s?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr ""
#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr ""
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr ""
#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr ""
#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr ""
#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Verwijderen van bestand %s%s%s mislukt."
#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr ""
#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr ""
#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Delphi project"
#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr ""
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Doeldirectorie"
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Doelfolder %s%s%s is ongeldig.%sKies a.u.b. een geldig pad."
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Hoofd/kleine letter ongevoelig"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Negeer toevoegingen en verwijderingen van lege regels"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Negeer verschillen in regeleinden (bv. #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Aantal te negeren spaties"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Negeer spaties (regelscheiding karakters niet meegeteld)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Negeer spaties aan regeleinde"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Negeer spaties aan begin van regel"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Alleen de selectie"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Toon verschillen in bewerker"
#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Tekst1"
#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Tekst2"
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr ""
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr ""
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr ""
#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr ""
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Wijzigingen verwerpen"
#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Gewijzigde bestanden:"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Klik op een van de bovenstaande items om het verschil te zien"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Fout bij lezen bestand: %s"
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Negeer wijzigingen op disk"
#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Opnieuw laden van schijf"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Bepaalde bestanden zijn gewijzigd op schijf:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Maak onderscheid tussen hoofd- en kleine letters. Bijv. A en a"
#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Documentatie bewerker"
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "IDE niet sluiten"
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Sluit project niet"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr ""
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Splashscherm niet tonen"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr ""
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kopieer geselecteerde componenten naar klipbord"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Knip geselecteerde componenten naar klipbord"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Verplaats component een terug"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Verplaats component een vooruit"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Stuur component naar achteren"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Breng component naar voren"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Plak geselecteerde componenten van het klembord"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Selecteer het parent component"
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr ""
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr ""
#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Kies schema"
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Alle pakketten"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Huidig project"
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Huidige project folder"
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Globaal Broncode Pad toevoeging"
#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Project IncPath"
#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Project SrcPath"
#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Project Unit pad"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Alle projecten"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "zet FPC DELPHI-mode aan"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "zet FPC GPC-mode aan"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "zet FPC TP-mode aan"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "zet IO-controles aan"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "zet OVERFLOW controles aan"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "zet RANGE controles aam"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "gebruik HeapTrc-unit"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "gebruik LineInfo-unit"
#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Een geldige Tool heeft tenminste een titel en een bestandsnaam nodig."
#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Bewerk Tool"
#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "Invoegen"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Toets"
#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "Macros"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parameters:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Programma bestandsnaam:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Doorzoek output op Free Pascal Compiler meldingen"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Doorzoek outpput op make meldingen"
#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titel en bestandsnaam nodig"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Werkdirectory:"
#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr ""
#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr ""
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr ""
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr ""
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr ""
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr ""
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr ""
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr ""
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr ""
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr ""
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Ingeschakeld"
#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr ""
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Schakel Macro's in"
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Omsluit"
#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr "Kies taal"
#: lazarusidestrconsts.lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr "Dubble klik regel op een bericht springt (anders: enkele klik)"
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr ""
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Folder niet gevonden"
#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "FPC directory \"%s\" niet gevonden."
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Ongeldige compiler bestandsnaam"
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Het compiler bestand \"%s\" is niet uitvoerbaar."
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Ongeldige debugger bestandsnaam"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Het debuggerbestand \"%s\" is niet uitvoerbaar."
#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgstr ""
#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "De Lazarus directorie \"%s\" lijkt fout te zijn. Normaliter bevat het directories zoals lcl, debugger, designer, components, ... ."
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Ongeldige Maak bestandsnaam"
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Het make bestand \"%s\" is niet uitvoerbaar."
#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Lazarus directorie \"%s\" niet gevonden."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Test directory \"%s\" niet gevonden."
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "Opmerking: slechts absolute paden worden nu ondersteund"
#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "Tab grootte"
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Ongeldige optie op positie %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr ""
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr ""
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Fout:"
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Fout bij maken bestand"
#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Fout bij maken lrs"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Fout bij verwijderen bestand"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Fout in %s"
#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Fout tijdens initialiseren van programma%s%s%s%s%sFout: %s"
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr ""
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Fout bij verplaatsen component"
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Fout bij verplaatsen component %s;%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr ""
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr ""
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Fout bij het verwerken van de lfm componenten stream."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Error bij lezen pakket lijst uit bestand%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr ""
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Fout bij herbenoemen bestand"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Fouten"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Error bij schrijven pakketlijst naar bestand%s%s%s%s"
#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr ""
#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr ""
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr ""
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr ""
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr ""
#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr ""
#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr "Uitzonderingen filter"
#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Voer het commando uit Na"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Voer het commando uit Voor"
#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Uitvoering gepauzeerd"
#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "uitvoering gepauzeerd%s Adres: $%s%s Procedure: %s%s Bestand: %s%s(Hier komt t.z.t. een assembler window)%s"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Uitvoering afgebroken"
#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr ""
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr ""
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr ""
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Volledige bestandsnaam van huidige editor bestand"
#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "Exporteer ..."
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Export lijst"
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr ""
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Unit path uitbreiden?"
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Destilleer"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "Externe gereedschappen"
#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Fout bij uitvoeren tool"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Maximum aantal Hulpmiddelen bereikt"
#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "Omlaag"
#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "Naar boven"
#: lazarusidestrconsts.lisexttoolremove
msgid "Remove"
msgstr "Verwijder"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Er is een maximum van %s hulpmiddelen"
#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr ""
#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Kan het hulpmiddel %s%s%s:%s%s niet uitvoeren"
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr ""
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Beperk het opnieuw tekenen"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Teken designer items in idle tijd (reduceert overhead voor langzame computers)"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Bestand %s%s%s%slijkt niet op een tekst bestand.%sToch openen?"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Bestand %s%s%s%slijkt niet op een tekst bestand.%sToch openen?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr ""
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Bestand is niet wijzigbaar"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr ""
#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Bestand %s%s%s is Virtual."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr ""
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Bestand niet gevonden"
#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Bestand %s%s%s niet gevonden.%s"
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Bestand %s%s%s niet gevonden.%sWilt u het bestand maken?%s"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Bestand niet met kleine letters"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Bestand is geen tekst"
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "bestand, waar de debug uitvoer naar geschreven wordt. Als dit niet wordt gegeven, wordt de uitvoer naar de console geschreven."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr ""
#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr ""
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr ""
#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Folder opties"
#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Bestandsfilter (*;*.*;*.bak?)"
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Include sub directories"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Alleen tekst bestanden"
#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr ""
#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "Te zoeken tekst"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Waar"
#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr ""
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr ""
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr ""
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr ""
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Repareer .lfm-bestand"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Hernoemen afdwingen"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr ""
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Formatteerfout"
#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "Fout bij laden formulier"
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr ""
#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Componenten"
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr ""
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "FPC directory fout"
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr ""
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr ""
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr ""
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Vind palette component"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr ""
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr ""
#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr ""
#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "FP compiler niet gevonden"
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "FreePascal bronnen directory"
#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "FreePascal bron bestand"
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "FP bronnen niet gevonden"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr ""
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Additionele bestanden om te zoeken (d.w.z. /pad/*.pas, /pad2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Vind of hernoem identifier"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Zoek referenties"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identifier: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "in alle geopende packages en projecten"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "in huidige unit"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "in hoofd project"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "in het project/package waar de huidige unit toebehoort"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Ongeldige Identifier"
#: lazarusidestrconsts.lisfrirename
msgid "Rename"
msgstr "Hernoemen"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Hernoem alle referenties"
#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Hernoem naar"
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Zoek ook in commentaar"
#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Zoek waar"
#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr ""
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr ""
#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr ""
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr ""
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Header commentaar voor klasse"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr ""
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Help selecteren"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr ""
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr ""
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr ""
#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Openen"
#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr ""
#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "Starten"
#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr ""
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Alles Opslaan"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Step Into"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr ""
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Step Over"
#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "Stoppen"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr ""
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Hint: De maak resourcestring functie verwacht een string constante.%sSelecteer a.u.b. alleen een string expressie en probeer nogmaals."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Schakel tussen Form/Unit"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Toon Forms"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Toon Units"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr ""
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Databases"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Help Opties"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Properties"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Viewers"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "FPC Doc HTML pad"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontaal"
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr ""
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr ""
#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr ""
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr ""
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr ""
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr ""
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "IDE opties:"
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr ""
#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr ""
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Fout laden xml"
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr ""
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Laad van bestand"
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Open of laad Compiler opties"
#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Open recent"
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Recente bestanden"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Sla bestand op"
#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr ""
#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr ""
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr ""
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr ""
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Negeer binaire bestanden"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr ""
#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Negeer afwezig bestand"
#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr ""
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr ""
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr ""
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Import lijst"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr ""
#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr "Include filter"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "pad gebruiken"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Include pad"
#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr ""
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr ""
#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr ""
#: lazarusidestrconsts.lisinfobuildbuild
msgctxt "lazarusidestrconsts.lisinfobuildbuild"
msgid "Build"
msgstr "Bouw"
#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr ""
#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr ""
#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr ""
#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Regels:"
#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Afbreken"
#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr ""
#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr ""
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr ""
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informatie over %s"
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr ""
#: lazarusidestrconsts.lisinheritedcomponent
msgid "Inherited Component"
msgstr ""
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr ""
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr ""
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr ""
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr ""
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr ""
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr ""
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr ""
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr ""
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr ""
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr ""
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr ""
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr ""
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr ""
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr ""
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Installatie mislukt"
#: lazarusidestrconsts.lisinstalledpackages
msgid "Installed Packages"
msgstr "Geinstalleerde pakketten"
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Installeer selectie"
#: lazarusidestrconsts.lisinvalidbuildvarthebuildvarmustbeapascalidentifie
msgid "Invalid build variable %s%s%s. The build variable must be a pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr ""
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Ongeldig commando"
#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr ""
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Ongeldige verwijdering"
#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Ongeldige destinatie directory"
#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Ongeldige expressie.%sHint: De \"Make Resourcestring\" Functie verwacht een string in een enkel bestand. Selecteer de expressie en probeer het opnieuw."
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr ""
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Ongeldige Free Pascal broncode directory"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Ongeldige meervoudige selectie"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr ""
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr ""
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Ongeldige Pascal Identifier"
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "De naam \"%s\" is geen geldige pascal identifier."
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Ongeldige proc naam"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Ongeldige project bestandsnaam"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Ongeldige selectie"
#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr ""
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s is al deel van het project."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s is geen geldige projectnaam.%s(Geldig is bijvoorbeeld: project1.lpi)"
#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr ""
#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr ""
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Houd naam"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr ""
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Aanpasbare commando's"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Designer acties"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Object Inspecteur commando's"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr ""
#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr ""
#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr ""
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr ""
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klassiek"
#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "Sluit alles"
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Sluit project"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr ""
#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "Compiler opties"
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr ""
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr ""
#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "Configureer help"
#: lazarusidestrconsts.liskmconfigureinstalledpackages
msgid "Configure installed packages"
msgstr "Configureer geinstalleerde paketten"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Context gevoellige help"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Converteer Delphi pakket naar Lazarus pakket"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Converteer Delphi project naar Lazarus project"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Converteer Delphi unit naar Lazarus unit"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "Converteer DFM bestand naar LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Verwijder laatste karakter"
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr ""
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Bewerk Code Templates"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr ""
#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr ""
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr ""
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Evalueer/bewerk"
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr ""
#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Ga naar marker 0"
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Ga naar marker 1"
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Ga naar marker 2"
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Ga naar marker 3"
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Ga naar marker 4"
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Ga naar marker 5"
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Ga naar marker 6"
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Ga naar marker 7"
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Ga naar marker 8"
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Ga naar marker 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr ""
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Voeg datum en tijd in"
#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr "Voeg $IFDEF in"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Voeg gebruikersnaam in"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspecteer"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Toets mapping schema"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr ""
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr ""
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr ""
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr ""
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nieuw project"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nieuw project van bestand"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr ""
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr ""
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Open pakket bestand"
#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr ""
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Plak componenten van clipboard"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Pauseer programma"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publiceer project"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""
#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Verwijder actieve unit van project"
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Run programma"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr ""
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr ""
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Sla project op"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Sla project op als"
#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr ""
#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr ""
#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr ""
#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr ""
#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr ""
#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr ""
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Zet marker 0"
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Zet marker 1"
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Zet marker 2"
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Zet marker 3"
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Zet marker 4"
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Zet marker 5"
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Zet marker 6"
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Zet marker 7"
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Zet marker 8"
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Zet marker 9"
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr "Stop programma"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr ""
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr ""
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr ""
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr ""
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr ""
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Starten applicatie is ongeldig"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Commandoregel voor het starten van programma"
#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Lazarus Desktop instellingen"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Lazarus directory"
#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Lazarus directory niet gevonden"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr ""
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr ""
#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr "Lazarus bestand"
#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Lazarus form"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Lazarus include bestand"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Lazarus taal ID (en, de, fi, etc.)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Lazarus taal naam (Engels, Duits, etc.)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opties] <project-bestandsnaam>"
#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Lazarus pakket"
#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Lazarus project"
#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Lazarus Project informatie bestand"
#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Lazarus project broncode"
#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Lazarus unit"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""
#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr ""
#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "Bouw"
#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Bouw CodeTools"
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "Bouw IDE"
#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Bouw JITForm"
#: lazarusidestrconsts.lislazbuildbuildoptions
msgid "Build Options"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Bouw SynEdit"
#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Annuleren"
#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "Maak alles schoon"
#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Maak schoon + Bouw"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before rebuilding Lazarus"
msgstr ""
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Fout bij schrijven bestand"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr ""
#: lazarusidestrconsts.lislazbuildlclinterface
msgid "LCL interface"
msgstr "LCL interface"
#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "Geen"
#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opties:"
#: lazarusidestrconsts.lislazbuildqboapplcltarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildother
msgctxt "lazarusidestrconsts.lislazbuildqbobuildother"
msgid "Other"
msgstr "Ander"
#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr ""
#: lazarusidestrconsts.lislazbuildquickbuildoptions
msgid "Quick Build Options"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after successful Build"
msgstr ""
#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr "Sla instellingen op"
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Doel processor"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Doel OS:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr ""
#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr ""
#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr ""
#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Pad naar LCL unit ontbreekt"
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "LCL Widget Type"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr ""
#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr ""
#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""
#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Laat leeg voor het standaard .po bestand"
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Linker randruimte. Wordt opgeteld met basis randruimte en gebruikt voor de ruimte links van het control."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Linker ankering"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Dit is het verwante control waaraan de linkerzijde is verankerd. Laat het leeg voor ouders"
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Linker zijden"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Linker kant evenredig verdelen"
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Niveaus"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM bestand"
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Corrupt LFM bestand"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr ""
#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgstr "Biblitheek%sEen freepascal bibliotheek (.dll onder windows, .so onder linux, dylib onder macosx). De broncode bestanden worden bijgehouden door Lazarus."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "Bibliotheek pad"
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr ""
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr ""
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr ""
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "Linker opties"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr ""
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr ""
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr ""
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr "Naam"
#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "Waarde"
#: lazarusidestrconsts.lislogmessage
msgid "Log message"
msgstr ""
#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr ""
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr ""
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr ""
#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr ""
#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr ""
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Voer data in"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Voer Start parameters in"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "De hoofd unit bevat Application.CreateFrom statements"
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "De hoofd unit bevat Application.Title statements"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "De hoofd unit bevat alle project units in de Uses sectie"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr ""
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Maak Executable"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "make niet gevonden"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Maak ResourceString"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Voeg aan einde van sectie toe"
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "De resourcestring %s%s%s bestaat al.%sKies een andere naam.%sKlik op Negeren om het toch toe te voegen."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Conversieopties"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr ""
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identifier"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Identifier lengte:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr ""
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Alfabetisch invoegen"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Context gevoelig invoegen"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Ongeldige Resourcestring sectie"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring bestaat al"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Resourcestring sectie:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Bron vooruitzicht"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "String constante in broncode"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Strings met dezelfde waarde:"
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr ""
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr ""
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Bouwen afbreken"
#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Broncode breekpunt"
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Breekpunt toevoegen"
#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Een actieve unit toevoegen aan een Pakket"
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Springpunt aan geschiedenis toevoegen"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Bewerker-bestand aan project toevoegen"
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr "Watch toevoegen ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr ""
#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Bouw"
#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "Bouw Alles"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Bouw bestand"
#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus"
msgstr "Bouw Lazarus"
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Controleer .lfm-bestand in editor"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "Maak directory schoon ..."
#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Sluiten"
#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close all editor files"
msgid "Close a&ll editor files"
msgstr "Sluit alle editorbestanden"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Sluit project"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "CodeTools definitieseditor ..."
#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr "Verzamel .po-bestanden"
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Commentaarselectie"
#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Compileropties ..."
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Completeer code"
#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "$IFDEF Invoegen ..."
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configureer Bouw+Start bestand ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Configureer aanpasbare componenten ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configureer \"Bouw Lazarus\" ..."
#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Configureer Help ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Contextgevoelige help"
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Converteer Delphi pakket naar een Lazarus pakket ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Converteer Delphi project naar een Lazarus project ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Converteer Delphi-unit naar Lazarus-unit ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert DFM file to LFM ..."
msgid "Convert binary DFM file to text LFM and check syntax ..."
msgstr "Converteer .dfm-bestand naar .lfm ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr ""
#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Kopiëren"
#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr ""
#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr "Maak .po-bestanden"
#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Knippen"
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "Debug schermen"
#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "Verschil"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Bewerken"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Broncodesjablonen ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Bewerk context gevoelige Help"
#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Configure installed packages ..."
msgstr "Configureer geinstalleerde pakketten ..."
#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor..."
msgstr ""
#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Annuleren"
#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Maak submenu"
#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Verwijder van template ..."
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Verwijder item"
#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Invoegen van Template ..."
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Nieuw Item toevoegen (na)"
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Nieuw Item toevoegen (voor)"
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Menu editor"
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Beweeg omlaag (of naar rechts)"
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Beweeg omhoog (of naar links)"
#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Nieuw 'template' beschrijving ..."
#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Opslaan als Template"
#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Selecteer menu:"
#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Selecteer een Template"
#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Template vooruitzicht"
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Omsluit Selectie ..."
#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "I&nstellingen"
#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Evalueer/Wijzig ..."
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Destilleer procedure ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Bestand"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Zoeken"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr ""
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Spring naar eind code blok"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Spring naar begin code blok "
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Zoek Declaraties (op cursor)"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Zoek Identifier Referenties ..."
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "Zoek in &Bestanden ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Zoek &Volgende"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Zoek V&orige"
#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr ""
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Ga naar include directive"
#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "Ga naar lijn ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Corrigeer verkeerde IFDEF/ENDIF"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Corrigeer open blok"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Help"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr ""
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Incrementeel Zoeken"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Selectie Inspringen"
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "ChangeLog bericht"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Invoegen van Karakter Map"
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "CVS-sleutelwoord"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Huidige datum en tijd"
#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "General"
msgstr "Algemeen"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "GPL bericht"
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "LGPL melding"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr ""
#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "Invoegen Tekst"
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Huidige username"
#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr "Inspecteer ..."
#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "Spring terug"
#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "Spring voorwaarts"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Spring naar"
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Spring naar volgend bookmark"
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr "Spring naar volgende fout"
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Spring naar vorig bookmark"
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Spring naar vorige fout"
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Wijzig selectie in kleine letters"
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Maak Resource string ..."
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nieuwe Form"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nieuw ..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr ""
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nieuw Project ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Nieuw Project van bestand ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nieuwe Unit"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Online help"
#: lazarusidestrconsts.lismenuopen
#, fuzzy
#| msgid "Open ..."
msgid "&Open ..."
msgstr "Openen ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Open bestandsnaam (op cursor)"
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Open een geladen Pakket ..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Open Pakket bestand (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Open Pakket van huidige unit"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Open Project ..."
#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open Recent ..."
msgid "Open &Recent ..."
msgstr "Open Recent ..."
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Open recent pakket ..."
#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Open Recent Project ..."
#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr ""
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr "Pakketplaatje ..."
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr ""
#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Plakken"
#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "Pauze"
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Project"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Project Inspecteur"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Project Opties ..."
#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "Starten"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publiceer Project ..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr "Snel-compilatie"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Snellere Syntaxcheck"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr ""
#: lazarusidestrconsts.lismenuquit
#, fuzzy
#| msgid "Quit"
msgid "&Quit"
msgstr "Afsluiten"
#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Opnieuw"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Verwijder van Project ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Hernoem Identifier ..."
#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Vervangen"
#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr ""
#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr ""
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Lees FPC broncode directory"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "Reset debugger"
#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "Herstart"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Terugzetten"
#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "&Starten"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Start bestand"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "Start Parameter ..."
#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr "Start tot cursor"
#: lazarusidestrconsts.lismenusave
#, fuzzy
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Opslaan"
#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Alles Opslaan"
#: lazarusidestrconsts.lismenusaveas
#, fuzzy
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Opslaan Als ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Project Opslaan "
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Project Opslaan Als ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Zoeken"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Selecteer"
#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Selecteer Alles"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "Selecteer code blok"
#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Selecteer lijn"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "Selecteer paragraaf"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "Selecteer tot accolade"
#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr "Selecteer woord"
#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Plaats een beschikbare bookmark"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "Show execution point"
msgstr ""
#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Sorteer Selectie ..."
#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr "Step Into"
#: lazarusidestrconsts.lismenustepout
msgid "Step out"
msgstr ""
#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr "Step Over"
#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "Stoppen"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Tabs naar Spaties"
#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Informatie"
#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Sluiten"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Inhoud"
#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Kopiëren"
#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Knippen"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Standaard Edit Menu"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Standaard bestand menu"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Standaard Help Menu"
#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Bewerken"
#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "Verlaat"
#: lazarusidestrconsts.lismenutemplatefile
msgid "File"
msgstr "Bestand"
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Zoeken"
#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "Zoek Volgende"
#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "Help"
#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Nieuw"
#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Openen"
#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Open Recent"
#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Plakken"
#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Opnieuw"
#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Opslaan"
#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Opslaan Als"
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Leerprogramma"
#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr ""
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr ""
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Hulpmiddelen"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Commentaar Selectie ongedaan maken"
#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Ongedaan maken"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Selectie Inspringen ongedaan maken"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Wijzig selectie in hoofdletters"
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Tonen"
#: lazarusidestrconsts.lismenuviewanchoreditor
#, fuzzy
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Toon Anker Bewerker"
#: lazarusidestrconsts.lismenuviewassembler
msgid "Assembler"
msgstr ""
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Breekpunten"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Call Stack"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Codeverkenner"
#: lazarusidestrconsts.lismenuviewcomponentpalette
#, fuzzy
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Toon component palette"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Componenten"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "Debugger output"
#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "Forms..."
#: lazarusidestrconsts.lismenuviewidespeedbuttons
#, fuzzy
#| msgid "View IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr "Toon IDE speed buttons"
#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "View Jump-History ..."
msgid "Jump-History ..."
msgstr "Toon Springpunt geschiedenis ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Lokale Variabelen"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Berichten"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Object Inspecteur"
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr ""
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Zoek Resultaten"
#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr ""
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Broncode Bewerker"
#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "ToDo Lijst"
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Schakel tussen Form/Unit zicht"
#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "View Unit Dependencies"
msgid "Unit Dependencies"
msgstr "Toon Unit Afhankelijkheden"
#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "View Unit Information"
msgid "Unit Information"
msgstr "Toon Unit informatie"
#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "Units..."
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Watches"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr ""
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr ""
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr ""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr ""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr ""
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Ontbrekende pakketten"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr ""
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr ""
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr ""
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr ""
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr ""
#: lazarusidestrconsts.lismore
msgid "More"
msgstr ""
#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr ""
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr ""
#: lazarusidestrconsts.lismvdocking
msgid "Docking"
msgstr ""
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Berichten opslaan in bestand (*.txt)"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr ""
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Naam van nieuwe procedure"
#: lazarusidestrconsts.lisnever
msgid "Never"
msgstr ""
#: lazarusidestrconsts.lisnew
msgid "new"
msgstr ""
#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "Nieuwe voorouders"
#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr ""
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nieuwe klasse"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr ""
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Maak een nieuw programma."
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Maak een nieuw editor-bestand.%sKies een type."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Maak een nieuw leeg tekst bestand."
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr "Maak een nieuwe grafische applicatie.%sHet bestand wordt door Lazarus beheerd."
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Maak een nieuwe Pascal-unit."
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr "Maak een nieuw programma.%sHet programma wordt door Lazarus beheerd."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Maak een nieuw project.%sKies een type."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Maak een nieuw standaard pakket.%sEen pakket is een verzameling units en componenten."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Maak een nieuwe unit met een datamodule."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame"
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Maak een nieuwe unit met een LCL-formulier."
#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr ""
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Geen item geselecteerd"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Selecteer eerst een item"
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr ""
#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr ""
#: lazarusidestrconsts.lisnewproject
msgid "%s - (new project)"
msgstr "%s - (nieuw project)"
#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr ""
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr ""
#: lazarusidestrconsts.lisno
msgid "No"
msgstr ""
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Geen backup bestanden"
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Geen wijziging"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Geen code geselecteerd"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Geen compiler opties overgenomen."
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr ""
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr ""
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "geen naam"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%sgeen"
#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "geen"
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr ""
#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr ""
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr ""
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Geen ResourceString sectie gevonden"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Het filter is gewoonlijk een regular expressie. In de eenvoudige syntax betekent een . een gewoon karakter, een * staat voor alles, een ? staat voor elk willekeurig karakter. Komma's en puntkomma's zijn scheidingstekens tussen alternatieven. Bijvoorbeeld: *.pas;*.pp staat voor ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Geen string constante gevonden"
#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Geen Dephi project"
#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Geen Delphi unit"
#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr ""
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "Opmerking: Define Template voor Free Pascal broncode kon niet gemaakt worden"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "Opmerking: Define Template voor Lazarus broncode kon niet gemaakt worden"
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr ""
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr ""
#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Niet nu"
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Maak"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Maak een nieuw project"
#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Selecteer een Project type"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr ""
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "obectpad"
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr ""
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Voeg aan favoriete properties toe"
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Kies een basisklasse voor de favoriete eigenschap %s%s%s."
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Klasse %s%s%s niet gevonden."
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Uit favoriete properties verwijderen"
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "Automatisch installeren dynamisch"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "Automatisch installeren statisch"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Beschrijving: "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sBeschrijving: %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Bestandsnaam: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "dynamisch geinstalleerd"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "statisch geinstalleerd"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "niet aanwwezig"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "gewijzigd"
#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Geen pakket geselecteerd"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Open een geladen Pakket"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Pakketnaam"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Selecteer een pakket"
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Selecteer een te openen pakket"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "niet wijzigbaar"
#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "Status"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sDit package was geïnstalleerd, maar het lpk-bestand was niet gevonden"
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sDit pakket was automatisch aangemaakt"
#: lazarusidestrconsts.lisok
#, fuzzy
#| msgid "&Ok"
msgid "&OK"
msgstr "&Ok"
#: lazarusidestrconsts.lisold
msgid "old"
msgstr ""
#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "Oude Ancestors"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Oude Klasse"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr ""
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr ""
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Alleen hele woorden zoeken"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr ""
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Open als XML bestand"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr ""
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Open bestannd bestand"
#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Open bestand"
#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr ""
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Open %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Open Pakket?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr ""
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Open Pakket bestand"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Open Project?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Project openen"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Project opnieuw openen"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Open Project bestand"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr ""
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr ""
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Open het bestand als normale broncode"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Open het pakket %s?"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Open het project %s"
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "of"
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Overrule de ingestelde taal. Bijv. --language=nl. Voor mogelijke waardes zie de bestanden in the directorie languages"
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Bestand overschrijven?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Bestand op disk overschrijven"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Pakket"
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr ""
#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "Pakketinformatie"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Pakketnaam begint met ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Pakketnaam bevat ..."
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Pakket moet geinstalleerd worden"
#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "In de IDE te installeren pakketten"
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr ""
#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "Pascal broncode bestand"
#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "Pascal unit"
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr ""
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr ""
#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr ""
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr ""
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Blader"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "Verplaats pad omlaag"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "Verplaats pad omhoog"
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Pad templates"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Doorzoek paden:"
#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Selecteer directory"
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr ""
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr ""
#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Item toevoegen"
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr ""
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Wijzigingen toepassen"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Aanroepen %Register%s procedure van de geselecteerde unit"
#: lazarusidestrconsts.lispckeditcleardependencydefaultfilename
msgid "Clear dependency filename"
msgstr "Maak schoon afhankelijkheid bestandsnaam "
#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Compileren"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Alles compileeren?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compileer package"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Compileropties voor Package %s"
#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Compileropties"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Maak MakeFile"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Bewerk algemene opies"
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Bewerk opties ter compilering pakket"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Bestand eigenschappen"
#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Algemene Opties"
#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Help"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Installeren"
#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Pakket in IDE installeren"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Ongeldige maximum versie"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Ongeldige minimum versie"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maximum versie"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimum Versie:"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Gewijzigd: %s"
#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "Meer ..."
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Verplaats afhankelijk omlaag"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Verplaats afhankelijkheid omhoog"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Pakket %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Pakket %s%s%s is gewijzigd.%sPakket opslaan?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "package %s niet opgeslagen"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Pagina: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Voeg afhankelijkheid opnieuw toe"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Voeg bestand opnieuw toe"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Niet wijzigbaar: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Hercompileer wat benodigd is"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Hercompileer opnieuw"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Compileer dit opnieuw en alle benodigde Pakketten?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Geregistreerde plugins"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registreer unit"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Verwijder afhankelijkheid"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Verwijder afhankelijkheid"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Verwijder afhankelijkheid %s%s%s%suit pakket %s%s%s"
#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Verwijderde bestanden (deze worden niet opgeslagen in het lpk bestand)"
#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Benodigde pakketten verwijderd"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Verwijder bestand"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Bestand verwijderen?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Verwijder bestand %s%s%s%svan pakket %s%s%s?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Verwijder geselecteerde items"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Benodigde Pakketten"
#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Wijzigingen Opslaan?"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Pakket opslaan"
#: lazarusidestrconsts.lispckeditsetdependencydefaultfilename
msgid "Store dependency filename"
msgstr "Sla afhankelijkheid bestandsnaam op"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "De maximum versie %s%s%s is geen geldige package versie.%s(Correct voorbeeld 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "De minimum versie %s%s%s is geen geldige package versie.%s(Correct voorbeeld 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "De-installeer"
#: lazarusidestrconsts.lispckeditviewpackgesource
msgid "View Package Source"
msgstr "Toon Pakket Bron"
#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "AutoCreated"
#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Geinstalleerd"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Installeer bij volgende start"
#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Geselecteerde pakket is nodig voor:"
#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Geladen Pakketten:"
#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Pakket %s niet gevonden"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sStatus: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "De-installeer bij volgende start"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Opties aan pakketten en projecten toevoegen"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Paden aan pakketten en projecten toevoegen"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Auteur:"
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Automatisch ophogen van versie bij bouwen"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automatisch herbouwen wanneer nodig"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automatisch herbouwen wanneer allen herbouwd worden"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Aanpasbaar"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Beschrijving/Samenvatting"
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Designtime en Runtime"
#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Alleen tijdens het ontwerp"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "IDE Integratie"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Neem op"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Ongeldige pakket type"
#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr ""
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Bibliotheek"
#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Licentie:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Major"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Handmatige compilatie (nooit automatisch)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minor"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Object"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Pakketopties"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "Pakkettype"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr ""
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Vrijgeven"
#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Alleen tijdens het uitvoeren"
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Het package %s%s%s heeft de \"auto install\" vlag.%sDit betekent dat het in de IDE wordt geinstalleerd. Te installeren packages moeten \"ontwerp\" packages zijn. "
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr ""
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Update/Herbouwen"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Gebruik"
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Afbreken"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Voortgang"
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Conflict gevonden"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr ""
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr ""
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Ongeldige unit bestandsnaam"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Ongeldige unit naam"
#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr ""
#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr ""
#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr ""
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Unitnaam:"
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""
#: lazarusidestrconsts.lispeviewtodolist
msgid "View ToDo list"
msgstr ""
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "CompiledSrcPath toevoeging"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Uitvoer directory"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Pakketbronbestanden directory markering"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Unitpad"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Weet u zeker dat alle wijzigingen in pakket %s geannuleerd moeten worden en het project opnieuw geladen moet worden?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "De nieuwe unit bevindt zich niet in het unit pad"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publiceer Pakket"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Pakket terugzetten?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Het bestand %s%s%s%sstaat niet in het unitpad van het package.%s%s %s%s%s toevoegen aan het unitpad?"
#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Online help nog niet geimplementeerd"
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Klik rechts op de boom om een popupmenu te krijgen met beschikbare package functies."
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Er zijn meer functies in het popup menu"
#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr "Binair"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Include bestand"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Lazarus form beschrijving"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus resource"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Virtuele Unit"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sToevoegen nieuwe afhankelijkheid aan package %s: package %s%s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sToevoegen nieuwe afhankelijkheid voor project %s: package %s%s"
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Neem unit in the uses-sectie van package op. Units die niet altijd gecompileerd worden, hoeven niet opgenomen te worden."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Dubbelzinnige units gevonden"
#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Een benodigd pakket was niet gevonden. Zie pakket plaatje."
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automatisch geïnstalleerde packages"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sBeide packages zijn verbonden, ofwel de ene package gebruikt de andere, of een derde gebruikt deze twee."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Gebroken Dependency"
#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Circulaire verbindingen in package afhankelijkheden"
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Verwijderen mislukt"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Verwijder het oude pakket-bestand?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Verwijder oud pakket bestand %s%s%s?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Afhankelijkheid zonder eigenaar: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Fout bij lezen bestand"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Fout bij Lezen Pakket"
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Fout bij schrijven bestand"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Fout bij schrijven Pakket"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Bestand is reeds aanwezig in pakket"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Bestand is in project"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Bestandsnaam verschilt van pakketnaam"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Bestandsnaam in gebruik in ander pakket"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Bestand in gebruik door project"
#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Bestand %s%s%s niet gevonden."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Bestand niet bewaard"
#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Negeer en sla pakket nu op"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "De installatie van pakket %s zal automatisch het volgende package installeren:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "De installatie van pakket %s zal automatisch de volgende pakket installeren:"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "ongeldige compiler bestandsnaam"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Ongeldige bestands extensie"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Ongeldige pakket bestandsextensie"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Ongeldige pakket bestandsnaam"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Ongeldige pakketnaam"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Ongeldige Pakketnaam"
#: lazarusidestrconsts.lispkgmanglazarus
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Het laden van Package %s zal package %s%s van bestand %s vervangen.%s Het oude pakket is gewijzigd. %s%sHet oude pakket %s opslaan?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "NieuwPakket"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Pakket: %s"
#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Pakket %s%s%s is gewijzigd. Opslaan?"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Pakket conflicteert."
#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Pakketbestand ontbreekt"
#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Pakket %s%s%s heeft geen geldig uitvoer directorie:%s%s%s%s"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Pakket is geen design-time pakket"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Pakket is benodigd"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "package hoofd broncode"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Pakketnaam bestaat al"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Pakketbestanden moeten de .lpk extensie hebben"
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Sla het bestand op voor het toevoegen aan een package"
#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Sla eerst het pakket op"
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Project: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Lazarus opnieuw bouwen"
#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Hernoem bestand in pakket"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Vervang bestaand bestand %s%s%s?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Vervang bestand"
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "Package Opslaan ?"
#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr "Pakket opslaan?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Package Opslaan %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Moet het bestand met kleine letters hernoemd worden? (%s%s%s%s)"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr ""
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr " configuratiebestand statische packages"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Het compiler bestand voor package %s is geen geldige executable:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Het bestand %s%s%s%smaakt al deel uit van het package %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Het bestand %s%s%s is geen Lazarus package"
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "De bestandsnaam %s%s%s correspondeert niet met de package naam %s%s%s in het bestand.%sPackage naam wijzigen in %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "De bestandsnaam %s%s%s is onderdeel van het huidige project.%sProjecten en Packages mogen geen bestanden delen."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "De bestandsnaam %s%s%s wordt gebruikt door%shet package %s%s%s%sin bestand %s%s%s."
#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Het bestand %s%s%s%svan package %s ontbreekt."
#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Het bestand %s%s%s%svan package %s dient eerst te worden opgeslagen."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Het volgende pakket is niet geladen:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "De volgende pakketten zijn niet geladen:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sDe volgende units zullen aan de uses sectie van %s%s:%s%s%s worden toegevoegd"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Het package %s%s%s kon niet worden gecompileerd.%Het package verwijderen uit de installatie lijst?"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "De bestandsnaam voor package %s%s%s is%s%s%s%s is geen geldige lazarus package naam."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Het package %s is alleen beschikbaar in runtime.%sDit soort packages kunnen niet geinstalleerd worden."
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Het package %s%s%s is aangemeld voor installatie, maar is niet gevonden.%Afhankelijkheid verwijderen van de lijst te installeren packages?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Het package %s is nodig voor %s, dat geinstalleerd moet worden.%sZie package plaatje."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Het packagenaam %s%s%s is geen geldige packagenaam%sKies een andere naam (bijv. package1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "De package naam %s%s%s van%shet bestand %s%s%s is ongeldig."
#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Het package %s bevat het bestand%s%s%s%s.%sMoet het bestand daar ook hernoemd worden?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Het package %s%s%s is verwijderd.%sLazarus ondersteund alleen statisch gelinkte packages. Om het volledig te de-installeren moet lazarus opnieuw gebouwd en gestart worden.%s%sWilt u Lazarus opnieuw bouwen?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Het package %s%s%s is aangemeld voor installatie.%sLazarus ondersteund alleen statisch gelinkte packages. Om het te installeren moet lazarus opnieuw gebouwd en gestart worden.%s%sWilt u Lazarus opnieuw bouwen?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Het project heeft het pakket %s%s%s nodig.%sDit is niet gevonden. Zie Project -> Project Inspecteur"
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Er zijn twee units met dezelfde naam:%s%s1. %s%s%s uit %s%s2. %s%s%s uit %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Benodigde packages refereren aan elkaar. Zie package plaatje."
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Er is een FPC unit met dezelfde naam als een package:%s%s%s%s%s%s"
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Er is een FPC unit met dezelfde naam als:%s%s%s%s%s uit %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "There is al een ander package met de naam %s%s%s.%sConflicterend package: %s%s%s%sBestand: %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Er is al een package %s%s%s geladen van bestand %s%s%s.%sZie Componenten -> Package plaatje.%sVervangen is onmogelijk"
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Er is een niet opgeslagen package in the benodigde packages. Zie package plaatje."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Er is een unit met dezelfde naam als een package:%s%s1. %s%s%s uit %s%s2. %s%s%s%s"
#: lazarusidestrconsts.lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr "Dit bestand is automatisch aangemaakt door Lazarus. Niet wijzigen!"
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Dit is een viruteel pakket. Er is nog geen broncode. Sla het pakket eerst op."
#: lazarusidestrconsts.lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr "Deze broncode is alleen gebruikt voor compilatie en installatie."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Kan de directory niet maken"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Kan de uitvoerdirectory %s%s%s%svoor package %s niet maken."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Kan geen package broncode directory %s%s%s%svoor package %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Kan doel directorie for lazarus:%s%s%s%s niet maken.%sDeze directorie is nodig voor de nieuwe lazarus IDE met je packages."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Kan het bestand %s%s%s niet verwijderen."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Kan het bestand niet verwijderen"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Kan het oude status bestand %s%s%s%svoor package %s niet verwijderen."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Kan het package %s%s%s niet openen.%sDit package moet geinstalleerd worden."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Kan het status bestand %s%s%s%svan package %s niet vinden.%sFout: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Kan het package %s%s%s%sniet schrijven in bestand %s%s%S.%sFout: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Kan het status bestand %s%s%s%s van package %s niet schrijven.%sFout: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Package de-installeren"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Package %s de-installeren?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Niet opgeslagen package"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Gebruik unit"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Waarschuwing: Het bestand %s%s%s%sbehoort tot het huidige project."
#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr ""
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Kan componenten zonder unit niet registreren"
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "Codetools - hulpmiddelen en functies om broncodes te parsen, bewerken en te verkennen "
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Componentklasse %s%s%s reeds gedefinieerd"
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sbestandsnaam: %s%s%s"
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Ongeldige component Class"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Ongeldige unit naam: %s"
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Pakketbestand niet gevonden"
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Register proceure is nill"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RegisterUnit is aangeroepen, maar er is geen pakket geregistreerd"
#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Regastratie error"
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "Synedit - de bewerker component gebruikt in Lazarus. http://sourceforge.net/projects/synedit/"
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "De FCL - FreePascol Componenten Bibliotheek bevat de basis klassen voor object pascal"
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "De LCL - Lazarus-componentenbibliotheek bevat alle basis componenten voor het bewerken van een form."
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Het package %s%s%s is geinstalleerd, maar er is geen geldig .lpk bestand gevonden.%sEen dummy package is aangemaakt."
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "De RTL - De \"Run-Time Library\" is de basis van alle Free Pascal programma's"
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Dit is het standaard pakket. Het wordt alleen gebruikt voor componenten zonder package. Deze zijn verouderd."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Het pakket is geinstalleerd, maar het lpk-bestand niet gevonden. Alle componenten hieruit zijn gedeactiveed. Herstel dit alstublieft."
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sUnitnaam: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Unit niet gevonden: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Unit %s%s%s is uit het package verwijderd"
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Dit bestand is niet aanwezig in een van de geladen packages."
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr ""
#: lazarusidestrconsts.lispldglobal
msgid "Global"
msgstr ""
#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr ""
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr ""
#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr ""
#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr ""
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr ""
#: lazarusidestrconsts.lispleasecheckthecompilername
msgid "Please check the compiler name"
msgstr "Controleer compiler naam"
#: lazarusidestrconsts.lispleasecheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr "Controleer de FP bron directory"
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "A.u.b. een unit openen .."
#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr ""
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Selecteer een stuk code om in een nieuwe procedure/methode te maken"
#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Alles>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr ""
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr ""
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr ""
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr ""
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Spring naar selectie"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Geen>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objecten"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr ""
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Type"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Geen sessie info opslaan"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr ""
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Opslaan in IDE configuratie directorie"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Opslaan in .lpi bestand"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Opslaan in .lps bestand in project directory"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Sessie informatie opslaan in"
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr ""
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "eerste configuratie directory, waar Lazarus de configuratie bestanden opslaat. Standaard is "
#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Druk af"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr ""
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Private methode"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr "Waarschijnlijk moet je nog wat pakketten installeren voordat je verder gaat.%s%sWaarschuwing:%sHet project is afhankelijk van sommige pakketten, die units bevatten met de Register procedure. De register procedure wordt gewoonlijk gebruikt voor het installeren van componenten in de IDE. De volgende pakketten zijn nog niet in de IDE geinstalleerd. Als je een form dat deze componenten bevat, probeert te openen in de IDE zal dat vervelende resultaten geven.%s%sDit heeft geen impact op het laden van het project of de bijbehorende broncode.%s%sDit betekent alleen: Het is een slecht idee om deze forms te openen om te bewerken, voordat de missende pakketten zijn geinstalleerd.%s%s"
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedure met interface"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programma"
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr "Programma%sEen Freepascal programma. Het programma wordt automatisch door Lazarus bijgehouden."
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Programma vastgesteld"
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Programma broncode dient een Pascal extensie, zoals .pas, .pp of .lpr, te hebben."
#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr ""
#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Bestand aan project toevoegen:"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Afhankelijkheid bestaat al"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "Bewerker-bestanden toevoegen"
#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "Bestanden toevoegen"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Ongeldige Min-Max versie"
#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Ongeldige pakketnaam"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Ongeldige Pascal unit naam"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Ongeldige versie"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maximum Versie (optioneel):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimum Versie (optioneel):"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nieuwe vereiste"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Pakketnaam"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Pakket niet gevonden"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "De afhankelijkheid %s%s%s is niet gevonden.%sKies een bestaand package."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "De Maximum Versie %s%s%s is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "De maximum versie is lager dan de minimum versie"
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "De Minimum Versie %s%s%s is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Het packagenaam %s%s%s is niet geldig.%sKies een bestaand package."
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Het project is al afhankelijk van het pakket %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "De unitnaam %s%s%s bestaat al in het project%smet bestand: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "De unitnaam %s%s%s bestaat al in de selectie%smet bestand: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "De unitnaam %s%s%s is geen geldige pascal identifier."
#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "Voeg toe aan het project"
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Unitnaam bestaat al"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Project is gewijzigd"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr ""
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Project directory"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Project bestandsnaam"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Project Include Path"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Project info bestand gevonden"
#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr "Project informatie"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Project is 'runnable'"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Project macro eigenschappen"
#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr ""
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr ""
#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Project Src Path"
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#, fuzzy
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "Project %s%s%s succesvol gebouwd"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr ""
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Project Unit pad"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Bevestig Afhankelijkheid verwijderen"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Verwijder afhankelijkheid voor %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Project Inspecteur - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Benodigde pakketten verwijderd"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Verwijder bestand %s van het project?"
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Kan het status bestand %s van project %s%s niet lezen. Fout: %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Kan het status bestand van project %s%s niet schrijven. Four %s"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Altijd bouwen (ook als er niks is gewijzigd)"
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Fout"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Kan de \"Auto createlijst\" niet wijzigen in de broncode.%sLos eerst de fouten op."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Project broncode directory merk"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Vraag om een waarde"
#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr ""
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr ""
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Beschermde methode"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Publieke methode"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Gepubliceerde methode"
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Publiceer project directory"
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Ongeldig Exclude filter"
#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Ongeldig Include filter"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ""
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Een Pascal-unit dient op .pp of .pas te eindigen."
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Bewerk virtuele unit"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr ""
#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr ""
#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr ""
#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Open Recent"
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr ""
#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Verlaat Lazarus"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Leesfout"
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr ""
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr ""
#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr "Naam"
#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "Waarde"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr ""
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Relatieve paden"
#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr ""
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Verwijder alle ongeldige properties"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr ""
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "Verwijder van Project"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr ""
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr ""
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Verwijder ze"
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Hernoem bestand?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Hernoemen van bestand gefaald."
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Hernoemen in kleine letters"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr ""
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr ""
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr ""
#: lazarusidestrconsts.lisreplacementproptypes
msgid "Replacement Properties and Types"
msgstr ""
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Replace unknown types and properties"
msgstr ""
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Het vervangen van de selectie is niet gelukt."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr ""
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr ""
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr ""
#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Resource laad fout"
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Fout bij opslaan Resource"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr ""
#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr ""
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr ""
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr ""
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Terugzetten mislukt"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Rechts"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Rechter ankering"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr ""
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Dit is het verwante control waaraan de rechterzijde is verankerd. Laat het leeg voor ouders"
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Rechter kanten"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Verdeel rechter kant evenredig"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr ""
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Bestand niet uitvoerbaar"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Het \"host\" programma %s%s%s is niet uitvoerbaar."
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Uitvoeren to mislukte"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr ""
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr ""
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr ""
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr ""
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr ""
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr ""
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""
#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "Opslaan ..."
#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Alle berichten naar bestand schrijven"
#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr "alle gewijzigde bestanden opslaan"
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Opslaan en dialoog sluiten"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Opslaan and IDE opnieuw bouwen"
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Wijzigingen opslaan?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Wijzigingen in project %s opslaan?"
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr "huidige bestanden in de bewerker opslaan"
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Bewaar bewerker info voor bestanden buiten het project"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Sla bestand op als"
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Bestand %s%s%s%sopslaan voor het sluiten van form %s%s%s?"
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Bewaar info gesloten bewerker bestanden"
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr ""
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Sla instelling op"
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Opslaan "
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Schaal:"
#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Zoek naar "
#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "tweede configuratie directory, waar Lazarus zoekt voor configuratie template bestanden. Standaard is "
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Zie meldingen."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sZie project -> Project Inspecteur"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Selecteer een help item:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Selecteer een node"
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Selecteer Delphi form bestanden (*.dfm)"
#: lazarusidestrconsts.lisselected
msgid "Selected"
msgstr ""
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Selectie overschrijdt string constante"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Selectie tool"
#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr ""
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr ""
#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr ""
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr ""
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr ""
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr ""
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr ""
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "Toon hints in Object Inspecteur"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr ""
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr ""
#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr "Toon oude tab volgorde"
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Toon paketten"
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr ""
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr ""
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Toon units"
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr ""
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Nakomeling"
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr "Eenvoudige syntax"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Sla bestand over en vervolg het laden"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Sla het laden van het laatste project over"
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr ""
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Komt overeen"
#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr ""
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Excuses, dit type is nog niet geimplementeerd."
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Neerwaarts"
#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Annuleren"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr ""
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Neerwaarts"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domein"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Negeer Space"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Regels"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opties"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragrafen"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Voorbeeld"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Accepteer"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Sorteer Selectie"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Woorden"
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Bron en doel zijn het zelfde:%s%s"
#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr ""
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr ""
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Bron directory %s%s%s bestaat niet"
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Bron gewijzigd"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Bron van pagina %s%s%s is gewijzigd. Opslaan?"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Bron paden"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Gelijkmatige verdeling"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr ""
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Bezig met zoeken"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Zoek tekst"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Met een nieuw project starten"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Stop huidige debugsessie en het project opnieuw bouwen?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Stoppen met debuggen?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Stop debugsessie"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr ""
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Stoppen met debuggen?"
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr ""
#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr ""
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Fout in streaming"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr ""
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr ""
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Subprocedure"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Subprocedure op hetzelfde niveau"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Succes!"
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "SVN revisie: "
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Ongeldige variabele naam"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s is geen geldige identifier."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Overrule the systeem variabele"
#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr ""
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr "Tab volgorde van"
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Doel processor"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Doelbestandsnaam van het projekt"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Doel OS"
#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Interne compileer fout! (%d)"
#: lazarusidestrconsts.listddinserttodo
msgid "Insert ToDo"
msgstr ""
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ""
#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Testdirectorie"
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "De klasse %s%s%s is een TControl en kan niet op een niet control geplaatst worden.%sPlakken mislukt."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Het commando na %s%s%s kan niet worden uitgevoerd."
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Het commando na publicatie is ongeldig:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "De component bewerker van klasse %s%s%s%saangeroepen met #%s %s%s%s%sveroorzaakte de fout:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr ""
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "De huidige compiler bestandsnaam %s%s%s%sis geen geldige executable.%sKlik op OK voor de standaard %s%s%s.%sOf controleer Instellingen -> Omgevings Opties -> Bestanden"
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "De huidige compilerbestandsnaam %s%s%s%sis geen geldige executable.%sControleer Instellingen -> Omgevings Opties -> Bestanden"
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "The huidige FPC-broncodedirectory %s%s%s%slijkt niet correct.%sKlik op OK voor de standaard %s%s%s.%sOf controleer Instellingen -> Omgevings Opties -> Bestanden"
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "The huidige FPC broncode directory %s%s%s%slijkt niet correct.%sControleer Instellingen -> Omgevings Opties -> Bestanden"
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "De huidige Lazarus-directorie %s%s%s%slijkt niet correct.%sZonder dat kunt u geen LCL applicaties bouwen.%sKlik op OK voor de standaard %s%s%s.%sOf controleer Instellingen -> Omgevings Opties -> Bestanden"
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "De huidige Lazarus-directorie %s%s%s%slijkt niet correct.%sZonder dat kunt u geen LCL applicaties bouwen.%sControleer Instellingen -> Omgevings Opties -> Bestanden"
#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Het huidige pad naar het bestand%s%s%s%s is%s%s%s%s.%s%sHet pad naar de LCL units %s%s%s ontbreekt.%s%sHint voor newbies:%sMaak een lazarus applicatie en zet het bestand in de project directory."
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "De debugger %s%s%s%sbestaat niet of is niet uitvoerbaar.%s%sZie Instellingen -> Debugger opties"
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "De doel directorie%s%s%s%s bestaat niet."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "De directory %s%s%s is overbodig in het unit pad.%sDirectory verwijderen?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "De directory %s%s%s is nog niet in het unit path.%sDirectory toevoegen?"
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr ""
#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Het bestand %s%s%s"
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr ""
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr ""
#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "Het bestand %s%s%s is geen Delphi Project (.dpr)"
#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "Het bestand %s%s%s is geen Delphi unit."
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "het bestand %s%s%s%slijkt een programma te zijn. Het huidige project sluiten, en een nieuw Lazarus project voor dit programma maken?%s\"Nee\" zal het bestand als een normale bron laden."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Het bestand %s lijkt het programma bestand te zijn van een bestaand Lazarus project."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Het bestand %s%s%s%sis niet gevonden.%sWilt u het zelf zoeken?%s"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Het bestand %s%s%s%sis niet gevonden.%sIgnore gaat door met het laden,%sAbort stopt het laden van het project."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "De volgende methoden gebruikt door %s zijn niet in de bron%s%s%s%s%s%sVerwijder deze referenties?"
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "De Free Pascal compiler (bestandsnaam: %s) niet gevonden.%sHet is raadzaam om FPC te installeren."
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "The Free Pascal-broncodedirectory is niet gevonden.%sSommige code functies zullen niet werken.%sAan te raden is dit te installeren en het pad in te stellen%sInstellingen -> Omgeving opties -> Bestanden"
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr ""
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Het startende programma %s%s%s%sbestaat niet of is niet uitvoerbaar.%s%sZie Starten -> Start paramaters -> Lokaal"
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "De lazarus directorie is niet gevonden.%Je kunt geen LCL programmaas maken.%Controleer Instellingen -> Omgeving Opties -> Bestanden"
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Het LFM (Lazarus form) bestand bevat ongeldige properties. Dit kan betekenen dat het properties/klassen bevat, die niet in de huidige LCL voorkomen. De manier om dit te repareren is deze properties te verwijderen uit de lfm en de pascal handmatig aan te passen."
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "De naam %s%s%s is geen geldige pascal identifier."
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr ""
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr ""
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Het programma %smake%s is niet gevonden.%sDit is nodig om lazarus te bouwen.%s"
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr ""
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Het project info bestand %s%s%s%s"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr ""
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Het project moet worden opgeslagen voor het bouwen%sAls je de Test Directory invuld bij de Omgeving Opties,%skun je nieuwe projecten maken en deze gelijk bouwen.%sPorject opslaan?"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr ""
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr ""
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Er zijn andere bestanden in de directory met dezelfde naam,%salleen met andere hoofdletters:%s%s%sDeze verwijderen?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Er is een bestand met dezelfde naam en een gelijke extensie op disk%sBestand%s%sDubbel bestand %s%s%s verwijderen?"
#: lazarusidestrconsts.listhereisalreadyabuildvarwiththename
msgid "There is already a build variable with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Er is al een form net de naam %s%s%s"
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Er is al een unit met de naam %s%s%S. Pascal identifiers moeten uniek zijn."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Er is een unit met de naam %s%s%s in het project.%sKies een andere naam"
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr ""
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Er is een fout opgetreden tijdens het opslaan van het geselecteerde component %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Er is een fout opgetreden tijdens het converteren van de binaire stream van het geselecteerde component %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Er is een fout opgetreden tijdens het kopiëren van de component stream naar het klembord:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Het root component kan niet verwijderd worden."
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr ""
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "De unit %s%s%s bestaat al.%sNegeren forceert een hernoeming,%sAnnuleer stop het opslaan van deze source en%sAbort stopt het hele opslaan."
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr ""
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr ""
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr ""
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr ""
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr ""
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "De unit heeft zelf al de naam %s%s%s. Pascal identifiers moeten uniek zijn."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr ""
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr ""
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "Dit Help bericht"
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Dit lijkt op een pascal bestand.%sAangeraden wordt om alleen kleine letters te gebruiken in de bestandnaam, om problemen te voorkomen.%sHernoemen naar kleine letters?"
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr ""
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Dit statement kan niet worden gedistilleerd.%sSelecteer meer code om een nieuwe procedure te distilleren."
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr ""
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr ""
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Functie: toevoegen pad scheidingsteken"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Functie: afhakken pad scheidingsteken"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Functie: destilleer bestandsextensie"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Functie: destilleer bestandsnaam+extensie"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Functie: destilleer alleen bestandsnaam"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Functie: destilleer pad naar bestand"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(onbekende macro: %s)"
#: lazarusidestrconsts.listodoexport
msgctxt "lazarusidestrconsts.listodoexport"
msgid "Export"
msgstr ""
#: lazarusidestrconsts.listodogoto
msgid "Goto"
msgstr "Ga naar"
#: lazarusidestrconsts.listodoldescription
msgctxt "lazarusidestrconsts.listodoldescription"
msgid "Description"
msgstr "Beschrijving"
#: lazarusidestrconsts.listodoldone
msgid "Done"
msgstr ""
#: lazarusidestrconsts.listodolfile
msgctxt "lazarusidestrconsts.listodolfile"
msgid "Module"
msgstr "Module"
#: lazarusidestrconsts.listodolistcaption
msgctxt "lazarusidestrconsts.listodolistcaption"
msgid "ToDo List"
msgstr "ToDo Lijst"
#: lazarusidestrconsts.listodolistgotoline
msgid "Goto selected source line"
msgstr "Ga naar geselecteerde broncode regel"
#: lazarusidestrconsts.listodolistoptions
msgid "ToDo options..."
msgstr "ToDo opties..."
#: lazarusidestrconsts.listodolistprintlist
msgid "Print todo items"
msgstr "Druk \"todo\" items af"
#: lazarusidestrconsts.listodolistrefresh
msgid "Refresh todo items"
msgstr "Ververs \"te doen\" items"
#: lazarusidestrconsts.listodolline
msgctxt "lazarusidestrconsts.listodolline"
msgid "Line"
msgstr "Regel"
#: lazarusidestrconsts.listodolowner
msgid "Owner"
msgstr ""
#: lazarusidestrconsts.listodolpriority
msgctxt "lazarusidestrconsts.listodolpriority"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Pad:"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr ""
#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Top verankering"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Top randruimte."
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Tops"
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Dit is het verwante control waaraan de bovenzijde is verankerd. Laat het leeg voor ouders"
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Top evenredig verdelen"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr ""
#: lazarusidestrconsts.listtodolcategory
msgctxt "lazarusidestrconsts.listtodolcategory"
msgid "Category"
msgstr ""
#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Toon dit bericht niet meer."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Fout in reguliere expressie"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Lettertype zonder UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line :"
msgstr "Ga naar regel :"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Niet gevonden."
#: lazarusidestrconsts.lisuereadonly
msgid "%s/ReadOnly"
msgstr "%s/uitsluitend leesbaar"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Vervang dit exemplaar van %s%s%s%s met %s%s%s?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Zoek naar: %s"
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Zoekstring '%s' niet gevonden"
#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Het huidige bewerker-lettertype ondersteunt geen UTF-8, maar uw systeem schijnt het te gebruiken. Niet-ASCII karakters zullen waarschijnlijk incorrect afgebeeld worden. U kunt een ander lettertype in de bewerker-opties selecteren."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr ""
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s bytes"
#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "Maak schoon"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Opgenomen door"
#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "in Project:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Regels:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Naam:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "nee"
#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Paden (Niet wijzigbaar)"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Grootte"
#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "Src"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Type:"
#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "Ja"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Toon waarde van CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Kan binaire stream niet omzetten naar tekst"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Kan component niet naar het klembord kopiëren"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Kan het resourceheader commentaar niet toeogen aan resource bestand %s%s%s%s.%sWaarschijnlijk een syntax fout."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Kan resource T%s:FORMDATA niet toevoegen aan resource bestand %s%s%s%s.%sWaarschijnlijk een syntax fout."
#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Kan %s niet toevoegen aan het project omdat er al een unit met dezelfde naam in het project is."
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Kan het bestand %s%s%s niet backup-en naar %s%s%s"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sKan de klasse van %s niet wijzigen in %s"
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Kan doel directory niet opschonen"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Kan %s%s%s niet opschonen.%sControleer de rechten."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Kan de component tekst niet omzetten in binair formaat:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Kan het bestand %s%s%s niet convertere%sFout: %s"
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Kan het lfm bestand niet converteren en het lrs bestand opslaan."
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Kan de tekst form data van bestand %s%s%s%s%sniet wijzigen in een binaire stream. (%s)."
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Kan het bestand niet kopiëren"
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Kan het bestand %s%s%s%s niet kopiëren naar %s%s%s"
#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Kan het bestand %s%s%s%s niet kopiëren naar %s%s%s."
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Kan geen backup directory maken."
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Kan de directory %s%s%s niet maken."
#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Kan de directory %s%s%s niet maken"
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Kan het bestand niet maken"
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Kan het bestand %s%s%s niet maken"
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Kan het bestand %s%s%s niet maken."
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Kan de nieuwe methode niet maken. Herstel de in het boodschappen scherm getoonde fout."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Lan geen tijdelijk lfm buffer maken."
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr ""
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Kan het dubbele bestand %s%s%s niet verwijderen"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Kan geen geldige klassenaam vinden in %s%s%s"
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Kan het bestand %s%s%s niet vinden."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr ""
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Kan %s niet vinden in LFM stream."
#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Kan de methode niet vinden. Herstel de fout getoond in het mededelingen scherm."
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Kan de bewerker-wijzigingen niet verzamelen."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Kan de broncode niet vinden voor de \"designer\"."
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Kan het oude resource bestand niet laden.%sHet resource bestand is de eerste include file in de%sinitialization sectie.%sBijvoorbeeld {$I %s.lrs}.%sWaarschijnlijk een syntax fout."
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr ""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr ""
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Kan het bestand niet lezen"
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Kan het bestand %s%s%s niet lezen"
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Kan het bestand %s%s%s niet lezen%sFout: %s"
#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Kan het bestand %s%s%s niet lezen."
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Kan het oude backup bestand %s%s%s niet verwijderen!"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Kan het dubbele bestand %s%s%s%sniet hernoemen in %s%s%s"
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Kan het bestand niet hernoemen"
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Kan het bestand %s%s%s niet hernoemen naar %s%s%s"
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Kan het bestand %s%s%s%sniet hernoemen in %s%s%s."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Kan het form niet in de broncode hernoemen."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Kan de methode niet hernoemen. Herstel de fout in het mededelingen scherm."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Kan de variabele niet hernoemen in de broncode."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr ""
#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Kan het bestand %s%s%s niet opslaan"
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr ""
#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Kan de methode niet tonen. Herstel de fout in het mededelingen scherm."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Kan geselecteerde componenten niet in stream opslaan"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Kan geselecteerde componenten niet in stream opslaan."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Kan %s:T%s niet in stream opslaan."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Kan de binaire stream met componenten van %s:T%s niet omzetten in tekst."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Kan het CreateForm statement niet wijzigen in de project broncode"
#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr ""
#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Kan niet schrijven naar %s%s%s%s%s."
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Kan het bestand niet schrijven"
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Kan het bestand %s%s%s niet schrijven%sFout: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritetofile
#, fuzzy
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Kan het bestand %s%s%s niet schrijven!"
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr ""
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "De-installeer Selectie"
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Unit identifier bestaat al"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr ""
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Unitname existiert bereits im Projekt"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Unit naam begint met ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Unit naam bevat ..."
#: lazarusidestrconsts.lisunitnotfound
#, fuzzy
#| msgid "Unit not found"
msgid "A unit not found in"
msgstr "Unit niet gevonden"
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Unit uitvoer directorie"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "Unitpad"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Unit paden"
#: lazarusidestrconsts.lisunitsnotfound2
#, fuzzy
#| msgid "Units not found"
msgid "Units not found in"
msgstr "Units niet gevonden"
#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr ""
#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr ""
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr ""
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr ""
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr ""
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr ""
#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Gebruik \"uitsluit\" filter"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr ""
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr ""
#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr "Gebruik \"bevat\" filter"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Applicatie wordt gestart"
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr ""
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr ""
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr ""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr ""
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr ""
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr ""
#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr ""
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr ""
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr ""
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr ""
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versie"
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Verticaal"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr ""
#: lazarusidestrconsts.lisviewbreakpointproperties
msgid "View Breakpoint Properties"
msgstr ""
#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr "Toon Project Units"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Toon bron (.lfm)"
#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr ""
#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr ""
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Waarschuwing: dubbel bestand gevonden: %s%s%s. Broncode bestand is: %s%s%s"
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr ""
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr ""
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr ""
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Met benodigde paketten"
#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr "&Toevoegen"
#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr "&Verwijderen"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr ""
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr ""
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr ""
#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr "&Ingeschakeld"
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Expressie"
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Eigenschappen"
#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr ""
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Woord bij de huidige bewerker positie"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr ""
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr ""
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Schrijffout"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr ""
#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "XML bestanden"
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Je kunt lazarus niet bouwen tijdens het debuggen of compileren."
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Broncode Bewerker"
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""
#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr ""
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr ""
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr ""
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr ""
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr ""
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr ""
#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr ""
#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr ""
#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr ""
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr ""
#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr ""
#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr ""
#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Formulier data bestand (*.dfm)|*.dfm"
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr ""
#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr ""
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Aanpasbare positie"
#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "Standaard"
#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Gedockt"
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Herstel window plaatsing"
#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Herstel window afmeting"
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Gebruik windowmanager instellingen"
#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "Toets"
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr ""
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabisch"
#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automatisch (of Engels)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalaans"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Chinees"
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Nederlands"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Engels"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Fins"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Frans"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Duits"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebreeuws"
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonesisch"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Itiliaans"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japans"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr ""
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr ""
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Pools"
#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr "Portugees"
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Russisch"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr ""
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr ""
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Spaans"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr ""
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Oekraiens"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr ""
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr ""
#: lazarusidestrconsts.rsok
msgid "ok"
msgstr ""
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr ""
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""
#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr ""
#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr ""
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr ""
#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr ""
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr ""
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr ""
#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "Waarde"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr ""
#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr "Het teken \"%s\" is al gekoppeld aan \"%s\"."
#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Alternatieve toets (of 2 toets combinaties)"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Help menu acties"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Opdrachtopdrachten"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "CodeToolscommando's"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Cursor beweeg commando's"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Tekstverwerkingsopdrachten"
#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Omgeving Menu commando's"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Bestandsmenu acties"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr ""
#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Tekstmarkering opdrachten"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Project menu commandos"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Start menu commando's"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Tekstzoek- en vervangopdrachten"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Tekstselectieopdrachten"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Bron notitieblok opdrachten"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Hulpmiddelen menu commando's"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Toon Menu commando's"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Opdracht:"
#: lazarusidestrconsts.srkmcommand1
msgid " command1 \""
msgstr " commando1 \""
#: lazarusidestrconsts.srkmcommand2
msgid " command2 \""
msgstr " commando2 \""
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Conflict "
#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr " is in conflict met "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "Bouw afbreken"
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "Springpunt toevoegen"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "Watch toevoegen"
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Broncodesjablooncompletering"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Blok Inspringen"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr ""
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Unindent Blok"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Bouw programma/project"
#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr "Alle bestanden van een programma/project bouwen"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Bouw bestand"
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Bouw Lazarus"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Karakter"
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Verwijder gehele tekst"
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Codetools-definitieseditor"
#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "CodeTools opties"
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr ""
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Kolom selectie methode"
#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "compileropties"
#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "Completeer code"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "Configureer bouwbestand"
#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Kopieer selectie naar klembord"
#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "Aanpasbare Tool %d"
#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Knip selectie naar klembord"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Verwijder tot het begin van de regel"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Verwijder karakter bij cursor"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Verwijder tot het eind van de regel"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Verwijder laatste karakter"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Verwijder tot het begin van het woord"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Verwijder huidige regel"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Verwijder tot het eind van het woord"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Verschil"
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Verplaats cursor naar het absolute eind"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Verplaats cursor naar het absolute begin"
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr ""
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "bereken/wijzig"
#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Destilleer procedure"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Extern gereedschap %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Externe hulpmiddelen instellingen"
#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "Zoek tekst"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Zoek blok Einde"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Zoek blok Start"
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "Zoek Declaratie"
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Vind identifier referenties"
#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "Vind in bestanden"
#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "Vind volgende"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr ""
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "Vind vorige"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr ""
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Vind procedure definitie"
#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Vind procedure methode"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr ""
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Ga naar tekstverwerker %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Ga naar include opdracht van huidig include bestand"
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "Ga naar lijn nummer"
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Ga naar Marker %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Ga naar XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Corrigeer verkeerde $IFDEF"
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "ChangeLog item toevoegen"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Invoegen vanaf de karaktermap"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Invoegen CVS Keyword Auteur"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Invoegen CVS keyword Datum"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Invoegen CVS keyword Header"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Invoegen CVS keyword ID"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Invoegen CVS keyword Log"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Invoegen CVS keyword Naam"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Invoegen CVS keyword Revisie"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Invoegen CVS keyword Broncode"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Huidige datum tijd invoegen"
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Invoegen GPL notice"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr ""
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "LGPL melding invoegen"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Breek lijn, verlaat cursor"
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Invoeg mode"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Huidige gebruikers naam invoegen"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspecteer"
#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr "Draai toekenning om"
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Breek lijn, en verplaats cursor"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Verplaats cursor naar regeleinde"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Regelselectie mode"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Verplaats cursor naar regelbegin"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Maak resource string"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Ga naar bijpassende haak"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Editor naar links"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Editor naar rechts"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Volgend bookmark"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Ga naar volgende tekstverwerker"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normale selectie modus"
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Open bestand (op cursor)"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Overschrijf mode"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Verplaats cursor naar de onderkant van de pagina"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Verplaats cursor een pagina omlaag"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Verplaats cursor een pagina naar links"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Verplaats cursor een pagina naar rechts"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Verplaats cursor naar de top van de pagina"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Verplaats cursor een pagina omhoog"
#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Plak klembord op de huidige positie"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pauzeer programma"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Vorig Bookmark"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Ga naar vorige tekstverwerker"
#: lazarusidestrconsts.srkmecprocedurelist
msgid "Procedure List ..."
msgstr "Procedure lijst ..."
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "Snel-compilatie, geen linking"
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr "verwijder breekpunt"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr ""
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr ""
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Hernoem identifier"
#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Vervang tekst"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "reset debugger"
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "voer programma uit"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "voer bestand uit"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "uitvoer parameters"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Scroll een regel naar beneden"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Scroll een karakter naar links"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Scroll een karakter naar rechts"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Scroll een regel omhoog"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Selecteer naar beneden"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Selecteer Alles"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Converteer tabs naar spaties in selectie"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Selecteer tot eind"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Selecteer tot begin"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Selecteer Goto XY"
#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "SelLinks"
#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "Selecteer regel einde"
#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "Selecteer regel begin"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Selecteer onderkant Pagina"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Selecteer pagina naar beneden"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Selecteer pagina Links"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Selecteer pagina rechts"
#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "Select bovenkant pagina"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Selecteer pagina omhoog"
#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "SelRechts"
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Selecteer omhoog"
#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "Selecteer linker woord"
#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "Selecteer rechter woord"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Zet markering %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr ""
#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr "Toon code samenhang"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr ""
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "Stop programma"
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Syntax controleren"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Toon Breekpunten"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Toon Call Stack"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Toon Code Verkenner"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Toon component palette"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Toon Debugger output "
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Schakel tussen form en unit"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr ""
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Toon IDE speed buttons"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Toon lokale variabelen"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr ""
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr ""
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Toon Berichten"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Wissel mode"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Toon Object Inspecteur"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr ""
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Toon zoek resultaten"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Toon Broncode Bewerker"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Toon Watches"
#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "Onbekend bewerker-commando"
#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "Gebruiker eerst"
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Toon anker bewerker"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr ""
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Toon Forms"
#: lazarusidestrconsts.srkmecviewtodolist
msgid "View todo list"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Toon Unit Afhankelijkheden"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Toon Unit informatie"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Toon Units"
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "Woord completering"
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Verplaats cursor een woord naar links"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Verplaats cursor een woord naar rechts"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr ""
#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Bewerk toetsen"
#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr ""
#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr ""
#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr ""
#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "Druk een toets in"
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Bestand is alleen-lezen"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Het bestand \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" is niet beschrijfbaar."
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "&Kijk op positie cursor toevoegen"
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Bookmark"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr ""
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Sluit Pagina"
#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "Completeer code"
#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Kopiëren"
#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Kopieer bestandsnaam"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Copy to new Window"
msgstr ""
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Copy to other Window"
msgstr ""
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr ""
#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Knippen"
#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "Editor Eigenschappen"
#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr "Omsluit Selectie"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr ""
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify..."
msgstr ""
#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr "Destilleer procedure"
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Zoek declaratie"
#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Zoek Identifier Referenties"
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Ga naar bladwijzer"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr ""
#: lazarusidestrconsts.ueminserttodo
msgid "Insert Todo"
msgstr ""
#: lazarusidestrconsts.ueminspect
msgid "&Inspect..."
msgstr ""
#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "Draai toekenning om"
#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr ""
#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr ""
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr ""
#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr ""
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr ""
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr ""
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr ""
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr ""
#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Ga naar volgend Bookmark"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Gewijzigd"
#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Open bestand op positie van cursor"
#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Plakken"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Ga naar vorig Bookmark"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Procedure sprong"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Niet wijzigbaar"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"
#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr "Hernoem Identifier"
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Start tot cursor"
#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Zet bladwijzer"
#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Plaats een beschikbaar Bookmark"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Toon regelnummers"
#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "Unit informatie"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr ""
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "&Toggle Breakpoint"
msgstr ""
#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "Toon Call Stack"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Nog niet geimplementeerd"
#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Nog niet geimplementeerd (Yoda rant)"
#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Als u deze feature kunt implementeren, mail naar lazarus@miraclec.com"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Niet wijzigbaar"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Verie informatie"