mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-04-05 20:58:06 +02:00
21720 lines
670 KiB
Plaintext
21720 lines
670 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: \n"
|
|
"POT-Creation-Date: \n"
|
|
"PO-Revision-Date: 2023-10-25 23:29+0200\n"
|
|
"Last-Translator: Swen Heinig <swen@heinig.email>\n"
|
|
"Language-Team: Deutsch <lazarus@miraclec.com>\n"
|
|
"Language: de_DE\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=utf-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"X-Poedit-SourceCharset: utf-8\n"
|
|
"X-Generator: Poedit 3.2\n"
|
|
|
|
#: lazarusidestrconsts.cocoamfstbicommand
|
|
msgid "Command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.cocoamfstbijumpback
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.cocoamfstbijumpback"
|
|
msgid "Jump Back"
|
|
msgstr "Zurückspringen"
|
|
|
|
#: lazarusidestrconsts.cocoamfstbijumpforward
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.cocoamfstbijumpforward"
|
|
msgid "Jump Forward"
|
|
msgstr "Vorwärtsspringen"
|
|
|
|
#: lazarusidestrconsts.cocoamfstbisearch
|
|
msgid "Search Instantly"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgasmwindowlinktarget
|
|
msgid "Link target line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgasmwindowsourcefunc
|
|
msgid "Function name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgasmwindowsourceline
|
|
msgid "Source line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
|
|
#, object-pascal-format
|
|
msgid "Address Breakpoint %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddress
|
|
#, object-pascal-format
|
|
msgid "at $%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
|
|
#, object-pascal-format
|
|
msgid "at $%s: from origin %s line %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
|
|
#, object-pascal-format
|
|
msgid "at $%s: %s line %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
|
|
#, object-pascal-format
|
|
msgid "Source Breakpoint %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
|
|
#, object-pascal-format
|
|
msgid "Unknown Breakpoint %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakwatchpoint
|
|
#, object-pascal-format
|
|
msgid "Watchpoint %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
|
|
#, object-pascal-format
|
|
msgid "Unknown Watchpoint out of scope %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
|
|
#, object-pascal-format
|
|
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventwatchscopeended
|
|
#, object-pascal-format
|
|
msgid "Watchpoint for \"%s\" out of scope %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventwatchtriggered
|
|
#, object-pascal-format
|
|
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
|
msgid "Use predefined scheme"
|
|
msgstr "Benutzerdefiniertes Schema"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetall
|
|
msgid "Reset all settings"
|
|
msgstr "Alle Einstellungen zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetgutter
|
|
msgid "Reset all gutter settings"
|
|
msgstr "Randleisten-Einstellungen zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresettext
|
|
msgid "Reset all text settings"
|
|
msgstr "Text-Einstellungen zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
|
msgid "Add history point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
|
msgid "Context Menu"
|
|
msgstr "Kontextmenü"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
|
msgid "Context Menu (debug)"
|
|
msgstr "Kontextmenü (Debuggen)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
|
msgid "Context Menu (tab)"
|
|
msgstr "Kontextmenü (Tab)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
|
msgid "Jumps to implementation"
|
|
msgstr "Zur Implementierung springen"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
|
msgid "Jumps to implementation/other block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
|
msgid "History back"
|
|
msgstr "Historie zurück"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
|
msgid "History forward"
|
|
msgstr "Historie vorwärts"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
|
msgid "Toggle extra Caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr "Nichts / Vorgabe"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
|
msgid "Paste"
|
|
msgstr "Einfügen"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
|
#, object-pascal-format
|
|
msgid "Continue %0:s (Bound to: %1:s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
|
#, object-pascal-format
|
|
msgid "Continue %0:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
|
msgid "Select text"
|
|
msgstr "Text markieren"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
|
msgid "Select text (lines)"
|
|
msgstr "Text auswählen (Zeilen)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
|
msgid "Select text (tokens)"
|
|
msgstr "Text auswählen (Zeichen)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
|
msgid "Select text (words)"
|
|
msgstr "Text auswählen (Wörter)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
|
msgid "Select text (Column mode)"
|
|
msgstr "Text markieren (Spalten)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
|
msgid "Select text (Line mode)"
|
|
msgstr "Text markieren (Zeilen)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
|
#, fuzzy
|
|
#| msgid "Set free bookmark"
|
|
msgid "Set a free bookmark"
|
|
msgstr "Freies Lesezeichen setzen"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
|
msgid "Select current Line (Full)"
|
|
msgstr "Aktuelle Zeile markieren (komplett)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
|
msgid "Select current Line (Text)"
|
|
msgstr "Aktuelle Zeile markieren (Text)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
|
msgid "Select current Paragraph"
|
|
msgstr "Aktuellen Absatz markieren"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
|
msgid "Select current Word"
|
|
msgstr "Aktuelles Wort markieren"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
|
msgid "Reset zoom"
|
|
msgstr "Zoom zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplediff
|
|
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
|
msgstr "Diese Seite enthält nicht die derzeitigen Einstellungen. Sehen Sie in der erweiterten Seite nach und setzen Sie hier die vorgeschrittenen Änderungen zurück"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
|
msgid "General"
|
|
msgstr "Allgemein"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
|
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
|
msgstr "Standard, Alle Aktionen (Haltepunkte, Faltung) beim Drücken der Maustaste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
|
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
|
msgstr "Erweitert, Aktionen (Haltepunkte, Falten) beim Loslassen der Maustaste. Auswahl beim Drücken und Bewegen"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
|
msgid "Extended, Actions, right gutter half only"
|
|
msgstr "Erweitert, Aktionen, nur rechte Randhälfte"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
|
msgid "Use line numbers to select lines"
|
|
msgstr "Zeilennummern verwenden zur Zeilenauswahl"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
|
msgid "Gutter"
|
|
msgstr "Randleiste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
|
msgid "Right button click includes caret move"
|
|
msgstr "Rechte Maustaste bewegt auch den Cursor"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
|
msgid "Alt-Ctrl Button"
|
|
msgstr "Alt+Strg+Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
|
msgid "Alt-Ctrl Wheel"
|
|
msgstr "Alt+Strg+Rad"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
|
msgid "Alt Button"
|
|
msgstr "Alt + Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
|
msgid "Alt Wheel"
|
|
msgstr "Alt + Rad"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
|
msgid "Ctrl Button"
|
|
msgstr "Strg + Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
|
msgid "Ctrl Wheel"
|
|
msgstr "Strg + Rad"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
|
msgid "Drag selection (copy/paste)"
|
|
msgstr "Auswahl verschieben (kopieren/einfügen)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
|
msgid "Extra-1 Button"
|
|
msgstr "Extra-1 Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
|
msgid "Extra-2 Button"
|
|
msgstr "Extra-2 Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
|
msgid "Alt Double"
|
|
msgstr "Alt + Doppelt"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
|
msgid "Ctrl Double"
|
|
msgstr "Strg + Doppelt"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
|
msgid "Double"
|
|
msgstr "Doppelt"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
|
msgid "Shift Double"
|
|
msgstr "Umsch + Doppelt"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
|
msgid "Quad"
|
|
msgstr "Vierfach"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
|
msgid "Triple"
|
|
msgstr "Dreifach"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
|
msgid "Middle Button"
|
|
msgstr "Mittlere Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
|
msgid "Middle"
|
|
msgstr "Mitte"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
|
msgid "Extra 1"
|
|
msgstr "Extra 1"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
|
msgid "Extra 2"
|
|
msgstr "Extra 2"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
|
|
msgid "Horizontal-Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
|
msgid "Left 1"
|
|
msgstr "Links 1"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
|
msgid "Left 2"
|
|
msgstr "Links 2"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
|
msgid "Wheel"
|
|
msgstr "Rad"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
|
msgid "Right Button"
|
|
msgstr "Rechte Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
|
msgid "Shift-Alt-Ctrl Button"
|
|
msgstr "Umsch+Alt+Strg+Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
|
msgid "Shift-Alt-Ctrl"
|
|
msgstr "Umsch+Alt+Strg"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
|
msgid "Shift-Alt Button"
|
|
msgstr "Umsch+Alt+Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
|
msgid "Shift-Alt Wheel"
|
|
msgstr "Umsch+Alt+Rad"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
|
msgid "Shift-Ctrl Button"
|
|
msgstr "Umsch+Strg+Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
|
msgid "Shift-Ctrl Wheel"
|
|
msgstr "Umsch+Strg+Rad"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
|
msgid "Shift Button"
|
|
msgstr "Umsch + Taste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
|
msgid "Wheel"
|
|
msgstr "Rad"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
|
msgid "Shift Wheel"
|
|
msgstr "Umsch + Rad"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewarning
|
|
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
|
msgstr "Änderungen wurden nicht gespeichert. Auf dieser Seite können Änderungen auf der fortgeschrittenen Seite zurückgenommen werden"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
|
msgid "Scroll horizontal (System speed)"
|
|
msgstr "Horizontal scrollen (Systemgeschwindigkeit)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
|
msgid "Scroll horizontal (Single line)"
|
|
msgstr "Horizontal scrollen (eine Zeile)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
|
msgid "Scroll horizontal (Page)"
|
|
msgstr "Horizontal scrollen (Seite)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
|
msgid "Scroll horizontal (Half page)"
|
|
msgstr "Horizontal scrollen (halbe Seite)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
|
msgid "Scroll horizontal (Page, less one line)"
|
|
msgstr "Horizontal scrollen (Seite, weniger eine Zeile)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr "Nichts / Vorgabe"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
|
msgid "Scroll (System speed)"
|
|
msgstr "Scrollen (Systemgeschwindigkeit)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
|
msgid "Scroll (Single line)"
|
|
msgstr "Scollen (eine Zeile)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
|
msgid "Scroll (Page)"
|
|
msgstr "Scrollen (Seite)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
|
msgid "Scroll (Half page)"
|
|
msgstr "Scrollen (halbe Seite)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
|
msgid "Scroll (Page, less one line)"
|
|
msgstr "Scrollen (Seite, weniger eine Zeile)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
|
msgid "Zoom"
|
|
msgstr "Zoom"
|
|
|
|
#: lazarusidestrconsts.dlfnopredefinedscheme
|
|
msgid "< None >"
|
|
msgstr "< Keine >"
|
|
|
|
#: lazarusidestrconsts.dlfreadonlycolor
|
|
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
|
msgid "Read Only"
|
|
msgstr "Schreibgeschützt"
|
|
|
|
#: lazarusidestrconsts.dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Kleinbuchstaben, erster immer groß"
|
|
|
|
#: lazarusidestrconsts.dlgactivedesktop
|
|
msgid "active"
|
|
msgstr "aktiv"
|
|
|
|
#: lazarusidestrconsts.dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr "Zuweisungsoperator := hinzufügen"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
|
msgid "Brackets highlight"
|
|
msgstr "Klammerhervorhebung"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
|
msgid "Code folding tree"
|
|
msgstr "Codefaltungs-Baum"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur
|
|
msgid "Code folding (current)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcustom
|
|
#, object-pascal-format
|
|
msgid "Custom %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefault
|
|
msgid "Default Text"
|
|
msgstr "Standardtext"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
|
|
msgid "Default Text / Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
|
msgid "Disabled breakpoint"
|
|
msgstr "Deaktivierter Haltepunkt"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
|
msgid "Enabled breakpoint"
|
|
msgstr "Aktivierter Haltepunkt"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
|
msgid "Error line"
|
|
msgstr "Fehlerzeile"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
|
msgid "Execution point"
|
|
msgstr "Ausführungspunkt"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
|
msgid "Folded code marker"
|
|
msgstr "Eingefaltete Code-Markierung"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
|
|
msgid "Fold start-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
|
msgid "Global"
|
|
msgstr "Allgemein"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
|
msgid "Gutter"
|
|
msgstr "Randleiste"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
|
msgid "Line"
|
|
msgstr "Zeile"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
|
|
msgid "Outline Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
|
msgid "Syncron Edit"
|
|
msgstr "Synchronbearbeitung"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
|
msgid "Template Edit"
|
|
msgstr "Vorlagenbearbeitung"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupwrap
|
|
msgid "Wrapping"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_custom
|
|
msgid "(Custom)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_entrytype
|
|
msgid "(entry type)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_extended
|
|
msgid "(Extended)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_nbrackets
|
|
msgid "(Nested Brackets)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
|
msgid "Gutter Separator"
|
|
msgstr "Randtrenner"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
|
|
msgid "Hide start-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
|
msgid "Incremental others"
|
|
msgstr "Inkrementell weitersuchen"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
|
|
msgid "Highlight prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
|
msgid "Highlight current word"
|
|
msgstr "Aktuelles Wort hervorheben"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
|
msgid "Incremental search"
|
|
msgstr "Inkrementelle Suche"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
|
msgid "Invalid breakpoint"
|
|
msgstr "Ungültiger Haltepunkt"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
|
msgid "Current line highlight"
|
|
msgstr "Aktuelle Zeile hervorgehoben"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
|
msgid "Line number"
|
|
msgstr "Zeilennummer"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
|
msgid "Modified line"
|
|
msgstr "Geänderte Zeile"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
|
msgid "Mouse link"
|
|
msgstr "Maus-Link"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrnestedbracket
|
|
#, object-pascal-format
|
|
msgid "Nested bracket %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevelcolor
|
|
#, object-pascal-format
|
|
msgid "Level %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrrecentlyused
|
|
msgid "Recently used item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
|
msgid "Selected Area"
|
|
msgstr "Gewählter Bereich"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktive Zelle"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Andere Zellen"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr "Synchrone Zellen"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktive Zelle"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Andere Zellen"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr "Synchrone Zellen"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
|
#, fuzzy
|
|
#| msgid "Text block"
|
|
msgid "Selected text"
|
|
msgstr "Textblock"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
|
msgid "Unknown breakpoint"
|
|
msgstr "Unbekannter Haltepunkt"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwindowborder
|
|
msgid "Window border"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
|
msgid "Word-Brackets"
|
|
msgstr "Wortklammern"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwrapeol
|
|
msgid "EOL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwrapindent
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrwrapindent"
|
|
msgid "Indent"
|
|
msgstr "Einrückung"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwrapsubline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrwrapsubline"
|
|
msgid "Sub-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
|
msgid "Visualized Special Chars"
|
|
msgstr "Visualisierte Sonderzeichen"
|
|
|
|
#: lazarusidestrconsts.dlgaddnewmode
|
|
msgid "Add new mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr "Semikolon hinzufügen"
|
|
|
|
#: lazarusidestrconsts.dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Ausrichten der oberen Zeile vorne am Kommentar"
|
|
|
|
#: lazarusidestrconsts.dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "alphabetisch"
|
|
|
|
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
|
msgid "Always keep caret in visible area of editor"
|
|
msgstr "Cursor immer im sichtbaren Bereich des Editors halten"
|
|
|
|
#: lazarusidestrconsts.dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Mehrdeutige Dateiaktion:"
|
|
|
|
#: lazarusidestrconsts.dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Beim Kompilieren warnen"
|
|
|
|
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
|
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgansicommenttab
|
|
#, fuzzy
|
|
#| msgid "Ansi (* *)"
|
|
msgid "ANSI (* *)"
|
|
msgstr "ANSI (* *)"
|
|
|
|
#: lazarusidestrconsts.dlgapplicationsettings
|
|
msgid "Application settings"
|
|
msgstr "Programmeinstellungen"
|
|
|
|
#: lazarusidestrconsts.dlgassertcode
|
|
msgid "Include assertion code"
|
|
msgstr "Code für Assertions einfügen"
|
|
|
|
#: lazarusidestrconsts.dlgassociateddebugdesktop
|
|
#, object-pascal-format
|
|
msgid "Associated debug desktop for \"%s\""
|
|
msgstr "Dem Desktop \"%s\" zugeordneter Debug-Desktop"
|
|
|
|
#: lazarusidestrconsts.dlgassociateddebugdesktophint
|
|
msgid "If you select the desktop, the associated debug desktop will be selected as well."
|
|
msgstr "Wenn Sie den Desktop auswählen wird der zugeordnete Debug-Desktop ebenfalls gewählt."
|
|
|
|
#: lazarusidestrconsts.dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Automatisch erzeugte Formulare:"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateformshint
|
|
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreatenewforms
|
|
msgid "Auto-create new forms"
|
|
msgstr "Neue Formulare automatisch erzeugen"
|
|
|
|
#: lazarusidestrconsts.dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Datei automatisch löschen"
|
|
|
|
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
|
msgid "Auto Display Function Prototypes"
|
|
msgstr "Zeige Funktions-Prototypen automatisch"
|
|
|
|
#: lazarusidestrconsts.dlgautohidecursor
|
|
msgid "Hide mouse pointer when typing"
|
|
msgstr "Mauspfeil beim Tippen verbergen"
|
|
|
|
#: lazarusidestrconsts.dlgautoindent
|
|
msgctxt "lazarusidestrconsts.dlgautoindent"
|
|
msgid "Auto indent"
|
|
msgstr "Automat. Einrückung"
|
|
|
|
#: lazarusidestrconsts.dlgautoindentlink
|
|
msgid "(Set up smart indent)"
|
|
msgstr "(Einrückung festlegen)"
|
|
|
|
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
|
msgid "Auto remove empty methods"
|
|
msgstr "Leere Methoden automatisch entfernen"
|
|
|
|
#: lazarusidestrconsts.dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Dateinamen in Kleinbuchstaben"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
|
msgid "Auto save active desktop"
|
|
msgstr "Aktiven Desktop automatisch speichern"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
|
msgid ""
|
|
"Save active desktop on IDE close\n"
|
|
"Save debug desktop on IDE close and debug end"
|
|
msgstr ""
|
|
"Aktiven Desktop beim Schließen der IDE speichern\n"
|
|
"Debug-Desktop beim Schließen der IDE und Ende des Debuggens speichern."
|
|
|
|
#: lazarusidestrconsts.dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Verfügbare Formulare:"
|
|
|
|
#: lazarusidestrconsts.dlgavailableformshint
|
|
msgid "These forms must be created and freed in the program code."
|
|
msgstr "Diese Formulare müssen im Programmcode erzeugt und freigegeben werden."
|
|
|
|
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
|
|
msgid "Avoid unnecessary jumps"
|
|
msgstr "Unnötige Sprünge vermeiden"
|
|
|
|
#: lazarusidestrconsts.dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Hintergrundfarbe"
|
|
|
|
#: lazarusidestrconsts.dlgbaknosubdirectory
|
|
msgid "(no subdirectory)"
|
|
msgstr "(kein Unterverzeichnis)"
|
|
|
|
#: lazarusidestrconsts.dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Gleicher Name (im Unterverzeichnis)"
|
|
|
|
#: lazarusidestrconsts.dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Nach Methoden"
|
|
|
|
#: lazarusidestrconsts.dlgblockgroupoptions
|
|
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
|
msgid "Selection"
|
|
msgstr "Auswahl"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentkeys
|
|
msgid "Block indent"
|
|
msgstr "Blockeinrückung"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentlink
|
|
msgid "(edit keys)"
|
|
msgstr "(Tasten bearbeiten)"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentspaces
|
|
msgid "Amount of spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttabs
|
|
msgid "Amount of tabs (tab stops)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttabs2spaces
|
|
msgid "Amount of spaces (tab stops)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypecopy
|
|
msgid "Space/tab as prev Line"
|
|
msgstr "Leerz./Tab wie vorherige Zeile"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypepos
|
|
msgid "Position only"
|
|
msgstr "nur Position"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypespace
|
|
msgid "Spaces"
|
|
msgstr "Leerzeichen"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
|
msgid "Tabs, cut off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
|
msgid "Tabs, then spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbookmarksetscroll
|
|
msgid "Restore scroll position for bookmarks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
|
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgborderspacingcolor
|
|
msgid "BorderSpacing frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbrackethighlight
|
|
msgid "Bracket highlight"
|
|
msgstr "Klammerhervorhebung"
|
|
|
|
#: lazarusidestrconsts.dlgbracketmatchgroup
|
|
msgid "Matching bracket and quote pairs"
|
|
msgstr "Korrespondierende Klammer- und Anführungszeichenpaare"
|
|
|
|
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
|
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
|
msgstr "Sie können keinen gedockten Desktop in ungedockter Umgebung oder umgekehrt verwenden."
|
|
|
|
#: lazarusidestrconsts.dlgcaretbackcolor
|
|
msgid "Secondary carets (multi-caret mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcaretcolor
|
|
msgctxt "lazarusidestrconsts.dlgcaretcolor"
|
|
msgid "Caret (Text-Cursor)"
|
|
msgstr "Text-Cursor"
|
|
|
|
#: lazarusidestrconsts.dlgcaretcolorinfo
|
|
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcaretforecolor
|
|
msgid "Main or primary caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcaretgroupoptions
|
|
msgid "Caret (Text Cursor)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcaretscrollgroupoptions
|
|
msgid "Caret (Text Cursor) past end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcasesensitive
|
|
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
|
msgid "&Case sensitive"
|
|
msgstr "&Klein-/Großschreibung beachten"
|
|
|
|
#: lazarusidestrconsts.dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr "Prüfe Compilereinstellungen"
|
|
|
|
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
|
#, object-pascal-format
|
|
msgid "orphaned file found: %s"
|
|
msgstr "verwaiste Datei gefunden: %s"
|
|
|
|
#: lazarusidestrconsts.dlgccoresults
|
|
msgid "Results"
|
|
msgstr "Ergebnisse"
|
|
|
|
#: lazarusidestrconsts.dlgccotest
|
|
msgctxt "lazarusidestrconsts.dlgccotest"
|
|
msgid "Test"
|
|
msgstr "Test"
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr "Test: Überprüfe Compiler ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr "Test: Überprüfe Compilerkonfiguration ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr "Test: Prüfe Compilerdatum ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr "Test: Kompiliere eine leere Datei ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestrtlunits
|
|
msgid "Test: Checking RTL units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr "Test: Prüfe die Quellen in den ppu-Suchpfaden von FPC..."
|
|
|
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr "Test: Kompiliere eine leere Datei"
|
|
|
|
#: lazarusidestrconsts.dlgccousingconfigfile
|
|
#, object-pascal-format
|
|
msgid "using config file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "Klassenreihenfolge"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "als letzte"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "Kleinbuchstaben"
|
|
|
|
#: lazarusidestrconsts.dlgcdtpreview
|
|
msgid "Preview (max line length = 1)"
|
|
msgstr "Vorschau (Maximale Zeilenlänge = 1)"
|
|
|
|
#: lazarusidestrconsts.dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "Präfix lesen"
|
|
|
|
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "Gespeicherte Nachsilbe"
|
|
|
|
#: lazarusidestrconsts.dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "GROSSBUCHSTABEN"
|
|
|
|
#: lazarusidestrconsts.dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Variablenpräfix"
|
|
|
|
#: lazarusidestrconsts.dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "Präfix schreiben"
|
|
|
|
#: lazarusidestrconsts.dlgcharcasefileact
|
|
msgid "Save As - auto rename Pascal files lower case"
|
|
msgstr "Speichern unter (Pascaldateien in Kleinbuchstaben)"
|
|
|
|
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
|
msgid "Check and Auto Save Files"
|
|
msgstr "Automatisches Speichern"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
|
msgid "Check packages on form create"
|
|
msgstr "Packages bei Form-Erzeugung prüfen"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
|
msgid "The form may require a package to work. Install such a package automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Auswahl der Code-Vorlagendatei (*.dci)"
|
|
|
|
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Schließen-Schaltfläche im Notebook anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Farbschema"
|
|
|
|
#: lazarusidestrconsts.dlgcmacro
|
|
msgid "C style macros (global)"
|
|
msgstr "C-artige Makros (global)"
|
|
|
|
#: lazarusidestrconsts.dlgcoansistr
|
|
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
|
msgid "Use Ansistrings"
|
|
msgstr "AnsiStrings verwenden"
|
|
|
|
#: lazarusidestrconsts.dlgcoasmstyle
|
|
msgid "Assembler style"
|
|
msgstr "Assembler-Stil"
|
|
|
|
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
|
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
|
msgid "Messages"
|
|
msgstr "Meldungen"
|
|
|
|
#: lazarusidestrconsts.dlgcochecksandassertion
|
|
msgid "Checks and assertion"
|
|
msgstr "Überprüfungen"
|
|
|
|
#: lazarusidestrconsts.dlgcocompilercommands
|
|
msgid "Compiler Commands"
|
|
msgstr "Compiler-Kommandos"
|
|
|
|
#: lazarusidestrconsts.dlgcocops
|
|
msgid "C style operators (*=, +=, /= and -=)"
|
|
msgstr "C-artige Operatoren (*=, +=, /= und -=)"
|
|
|
|
#: lazarusidestrconsts.dlgcocreatemakefile
|
|
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Makedatei anlegen"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugging
|
|
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
|
msgid "Debugging"
|
|
msgstr "Debuggen"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Zusätzlicher Debuggerpfad (keiner):"
|
|
|
|
#: lazarusidestrconsts.dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Quelltexterzeugung"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenableboth
|
|
msgid "Both"
|
|
msgstr "Beides"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablefold
|
|
msgid "Fold"
|
|
msgstr "Falten"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablehide
|
|
msgid "Hide"
|
|
msgstr "Verbergen"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
|
msgid "Reverse fold-order in Popup"
|
|
msgstr "Umgek. Faltungsreihenfolge im Popup"
|
|
|
|
#: lazarusidestrconsts.dlgcogdb
|
|
msgid "Generate info for the debugger (slower / increases exe-size)"
|
|
msgstr "Debugger-Informationen erzeugen (Verlangsamt das Kompilieren)"
|
|
|
|
#: lazarusidestrconsts.dlgcoheaptrc
|
|
msgid "Use Heaptrc unit (check for mem-leaks)"
|
|
msgstr "Heaptrc-Unit verwenden"
|
|
|
|
#: lazarusidestrconsts.dlgcoincfiles
|
|
msgid "Include files (-Fi):"
|
|
msgstr "Include-Dateien (-Fi):"
|
|
|
|
#: lazarusidestrconsts.dlgcoinfoforgdb
|
|
msgid "Debugger info"
|
|
msgstr "Debugger-Info"
|
|
|
|
#: lazarusidestrconsts.dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Bibliotheken (-Fl):"
|
|
|
|
#: lazarusidestrconsts.dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Linken"
|
|
|
|
#: lazarusidestrconsts.dlgcoloadsavehint
|
|
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
|
|
msgid "Compiler options can be saved to an XML file."
|
|
msgstr "Laden/Speichern"
|
|
|
|
#: lazarusidestrconsts.dlgcolorlink
|
|
msgid "(Edit Color)"
|
|
msgstr "(Farbe ändern)"
|
|
|
|
#: lazarusidestrconsts.dlgcolornotmodified
|
|
msgid "Not modified"
|
|
msgstr "Nicht modifiziert"
|
|
|
|
#: lazarusidestrconsts.dlgcolors
|
|
msgctxt "lazarusidestrconsts.dlgcolors"
|
|
msgid "Colors"
|
|
msgstr "Farben"
|
|
|
|
#: lazarusidestrconsts.dlgcolorstml
|
|
msgid "TML Setup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile
|
|
#, object-pascal-format
|
|
msgid "Sample text file not found: %1:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlerror
|
|
msgid "Error:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlfromfile
|
|
msgid "File:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlinfo
|
|
#, object-pascal-format
|
|
msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlmissinginclude
|
|
#, object-pascal-format
|
|
msgid "Did not find all includes: %1:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlnofilesfound
|
|
msgid "No files found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlnosampletxt
|
|
msgid "No sample text configured"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlok
|
|
msgid "OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlrefresh
|
|
msgid "Reload"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Kommandozeilenparameter (ohne Programmname)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
|
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
|
msgid "Limit indent to"
|
|
msgstr "Einrückung beschränken auf"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinue
|
|
msgid "Prefix comments on linebreak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematch
|
|
msgid "Match current line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
|
msgid "Match text including \"*\" of token \"(*\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
|
msgid "Match whole line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
|
#, object-pascal-format
|
|
msgid "Match text after token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
|
#, object-pascal-format
|
|
msgid "Match text including token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
|
msgid "Prefix new line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
|
msgid "Align Prefix at indent of previous line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
|
msgid "Align Prefix below start of comment on first comment line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
|
msgid "Do not indent prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
|
msgid "Comments and Strings"
|
|
msgstr "Kommentare und Strings"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
|
msgid "Extend if matched or not matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
|
msgid "Extend if matched or not matched (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
|
msgid "Extend if matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
|
msgid "Extend if matched and caret in the middle of text (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilationandlinking
|
|
msgid "Compilation and Linking"
|
|
msgstr "Kompilieren und Linken"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessage
|
|
msgid "Compiler messages"
|
|
msgstr "Compiler-Meldungen"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessages
|
|
msgid "Compiler messages language file (*.msg)"
|
|
msgstr "Compilermeldungen-Sprachdatei (*.msg)"
|
|
|
|
#: lazarusidestrconsts.dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Vollständige Eigenschaften"
|
|
|
|
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
|
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigandtarget
|
|
msgid "Config and Target"
|
|
msgstr "Konfiguration und Ziele"
|
|
|
|
#: lazarusidestrconsts.dlgconfigfiles
|
|
msgid "Config files"
|
|
msgstr "Konfigurationsdateien:"
|
|
|
|
#: lazarusidestrconsts.dlgconsolesizenotsupported
|
|
msgid "Current debugger does not support this."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
|
msgid "Other debugging info"
|
|
msgstr "Andere Debugger-Optionen"
|
|
|
|
#: lazarusidestrconsts.dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Überlauf"
|
|
|
|
#: lazarusidestrconsts.dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Parsen"
|
|
|
|
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
|
msgid "Copy/Paste with fold info"
|
|
msgstr "Kopieren/Einfügen mit Faltungsinformationen"
|
|
|
|
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
|
msgid "Copy current word when no selection exists"
|
|
msgstr "Aktuelles Wort auch ohne Auswahl kopieren"
|
|
|
|
#: lazarusidestrconsts.dlgcorange
|
|
msgctxt "lazarusidestrconsts.dlgcorange"
|
|
msgid "Range"
|
|
msgstr "Bereich"
|
|
|
|
#: lazarusidestrconsts.dlgcorelocatable
|
|
msgid "Relocatable"
|
|
msgstr "Verschiebbar"
|
|
|
|
#: lazarusidestrconsts.dlgcosetasdefault
|
|
msgid "Set compiler options as default"
|
|
msgstr "Diese Compilereinst. als Vorgabe"
|
|
|
|
#: lazarusidestrconsts.dlgcoshowoptions
|
|
msgid "&Show Options"
|
|
msgstr "Ein&stellungen anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgcosmartlinkable
|
|
msgid "Smart linkable"
|
|
msgstr "Smart-Linkbar"
|
|
|
|
#: lazarusidestrconsts.dlgcosources
|
|
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Andere Quellen (.pp-/.pas-Dateien, nur von der IDE benutzt, nicht vom Compiler)"
|
|
|
|
#: lazarusidestrconsts.dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Stack"
|
|
|
|
#: lazarusidestrconsts.dlgcostrip
|
|
msgid "Strip symbols from executable"
|
|
msgstr "Debuggersymbole aus der ausführbaren Datei entfernen"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltype
|
|
msgid "Type of debug info"
|
|
msgstr "Debugging-Info-Typ"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypeauto
|
|
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
|
msgid "Automatic"
|
|
msgstr "Automatisch"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
|
msgid "Dwarf 2"
|
|
msgstr "Dwarf 2"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
|
msgid "Dwarf 2 with sets"
|
|
msgstr "Dwarf 2 mit Sets"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
|
msgid "Dwarf 3 (beta)"
|
|
msgstr "Dwarf 3 (Beta)"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypestabs
|
|
msgid "Stabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcotrashvariables
|
|
msgid "Trash variables"
|
|
msgstr "Trash-Variablen"
|
|
|
|
#: lazarusidestrconsts.dlgcounitstyle
|
|
msgid "Unit style"
|
|
msgstr "Unit-Stil"
|
|
|
|
#: lazarusidestrconsts.dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Code für valgrind erzeugen"
|
|
|
|
#: lazarusidestrconsts.dlgcoverbosity
|
|
msgid "Verbosity"
|
|
msgstr "Ausführlichkeit"
|
|
|
|
#: lazarusidestrconsts.dlgcppinline
|
|
msgid "C++ styled INLINE"
|
|
msgstr "C++-artige Inline-Anweisungen"
|
|
|
|
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
|
|
msgid "Create new Run Parameters settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcurlycommenttab
|
|
msgid "Curly { }"
|
|
msgstr "Geschweifte Klammern {}"
|
|
|
|
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
|
msgid "Currently respected by messages window, jump history and search results."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Cursor hinter dem Zeilenende"
|
|
|
|
#: lazarusidestrconsts.dlgcursormoveclearsselection
|
|
msgid "Caret left/right clears selection (no move)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipsselection
|
|
msgid "Caret skips selection"
|
|
msgstr "Cursor überspringt Auswahl"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipstab
|
|
msgid "Caret skips tabs"
|
|
msgstr "Cursor überspringt Tabulatoren"
|
|
|
|
#: lazarusidestrconsts.dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Benutzerdefinierte Erweiterung (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts.dlgdebugdesktop
|
|
msgid "debug"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr "Pfadeditor"
|
|
|
|
#: lazarusidestrconsts.dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Debuggertyp und -pfad"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Voreingestellte Schrift im Editor"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulttabfont
|
|
msgid "Default tab font"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdefaultwinpos
|
|
msgid "Default Window/Console position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdefvaluecolor
|
|
msgid "Default Value"
|
|
msgstr "Voreinstellung"
|
|
|
|
#: lazarusidestrconsts.dlgdeletemode
|
|
msgid "Delete mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
|
|
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
|
|
msgid "Delete"
|
|
msgstr "Löschen"
|
|
|
|
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
|
|
msgid "Delete selected desktop"
|
|
msgstr "Ausgewählten Desktop löschen"
|
|
|
|
#: lazarusidestrconsts.dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Vorlage löschen "
|
|
|
|
#: lazarusidestrconsts.dlgdesktopbuttons
|
|
msgid "Buttons - "
|
|
msgstr "Buttons -"
|
|
|
|
#: lazarusidestrconsts.dlgdesktophints
|
|
msgid "Hints"
|
|
msgstr "Hinweise"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopmenus
|
|
msgid "Menus - "
|
|
msgstr "Menüs - "
|
|
|
|
#: lazarusidestrconsts.dlgdesktopname
|
|
msgid "Desktop name"
|
|
msgstr "Desktop-Name:"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsexported
|
|
#, object-pascal-format
|
|
msgid "%d desktop(s) successfully exported to \"%s\""
|
|
msgstr "%d Desktop(s) erfolgreich exportiert nach \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsimported
|
|
#, object-pascal-format
|
|
msgid "%d desktop(s) successfully imported from \"%s\""
|
|
msgstr "%d Desktop(s) erfolgreich importiert aus \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
|
|
msgid "Different values background"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Richtung"
|
|
|
|
#: lazarusidestrconsts.dlgdisableantialiasing
|
|
msgid "Disable anti-aliasing"
|
|
msgstr "Antialiasing abschalten"
|
|
|
|
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
|
msgid "Distance between grid points is the smallest step when moving a control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividercolordefault
|
|
msgid "Use right margin color"
|
|
msgstr "Verwende Farbe des rechten Randes"
|
|
|
|
#: lazarusidestrconsts.dlgdividerdrawdepth
|
|
msgid "Draw divider level"
|
|
msgstr "Trennlinie zeichnen"
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolor
|
|
msgid "Nested line color"
|
|
msgstr "Geschachtelte Linienfarben"
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolor
|
|
msgid "Line color"
|
|
msgstr "Linienfarbe"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasbeginendname
|
|
msgid "Begin/End"
|
|
msgstr "Begin/End"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasprocedurename
|
|
msgid "Procedure/Function"
|
|
msgstr "Prozedur/Funktion"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
|
msgid "Class/Struct"
|
|
msgstr "Klasse/Struktur"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
|
msgid "Class/Struct (local)"
|
|
msgstr "Klasse/Struktur (lokal)"
|
|
|
|
#: lazarusidestrconsts.dlgdivpastryname
|
|
msgid "Try/Except"
|
|
msgstr "Try/Except"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
|
msgid "Unit sections"
|
|
msgstr "Unit-Bereiche"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasusesname
|
|
msgid "Uses clause"
|
|
msgstr "Uses-Anweisung"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
|
msgid "Var/Type"
|
|
msgstr "Var/Type"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
|
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (lokal)"
|
|
|
|
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
|
msgid "Draw the component's name below it."
|
|
msgstr "Den Komponentennamen darunter zeichnen."
|
|
|
|
#: lazarusidestrconsts.dlgedback
|
|
msgid "Back"
|
|
msgstr "Zurück"
|
|
|
|
#: lazarusidestrconsts.dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Fett"
|
|
|
|
#: lazarusidestrconsts.dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Unterverzeichnis"
|
|
|
|
#: lazarusidestrconsts.dlgedcodetempl
|
|
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
|
msgid "Code Templates"
|
|
msgstr "Quelltextvorlagen"
|
|
|
|
#: lazarusidestrconsts.dlgedcompleteblocks
|
|
msgid "Add close statement for Pascal blocks"
|
|
msgstr "Blöcke vervollständigen"
|
|
|
|
#: lazarusidestrconsts.dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Benutzerdefinierte Erweiterung"
|
|
|
|
#: lazarusidestrconsts.dlgeddelayinsec
|
|
#, object-pascal-format
|
|
msgid "(%s sec delay)"
|
|
msgstr "(%s Sek. Verzögerung)"
|
|
|
|
#: lazarusidestrconsts.dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Anzeige"
|
|
|
|
#: lazarusidestrconsts.dlgedfiles
|
|
msgid "Editor Files"
|
|
msgstr "Editordateien"
|
|
|
|
#: lazarusidestrconsts.dlgedidcomlet
|
|
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
|
msgid "Identifier completion"
|
|
msgstr "Bezeichner-Vervollständigung"
|
|
|
|
#: lazarusidestrconsts.dlgedinvert
|
|
msgid "Invert"
|
|
msgstr "Umkehren"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
|
msgid "Ignore Locks, use longest unused editor"
|
|
msgstr "Sperren übergehen, am längsten unbenutzter Editor"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
|
msgid "Ignore Locks, if editor is current"
|
|
msgstr "Sperren übergehen, wenn im aktuellen Editor"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
|
msgid "Ignore Locks, if editor in current window"
|
|
msgstr "Sperren übergehen, wenn Editor im aktuellen Fenster"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
|
msgid "Locked, if text in view"
|
|
msgstr "Gesperrt wenn Text sichtbar ist"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
|
msgid "Unlocked"
|
|
msgstr "Entsperrt"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
|
msgid "Unlocked, if text in centered view"
|
|
msgstr "Entsperrt wenn Text im Zentrum des Ausschnitts"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
|
msgid "New tab, existing or new window"
|
|
msgstr "Neuer Reiter, vorhandenes oder neues Fenster"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
|
msgid "New tab in new window"
|
|
msgstr "Neuer Reiter in neuem Fenster"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
|
msgid "New tab in existing window"
|
|
msgstr "Neuer Reiter in vorhandenem Fenster"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
|
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
|
msgstr "Diese Option wählt den am längsten freien Editor für die Datei und zwar selbst dann, wenn er gesperrt ist oder wenn gescrollt werden muß. Das bezieht sich auf den Editor und nicht auf das Fenster um den am längsten ungenutzten zu finden. Diese Option hat immer Erfolg, andere werden nicht mehr geprüft."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
|
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
|
msgstr "Diese Option prüft, ob die Zieldatei im derzeit aktiven Editor ist. Falls ja wird dieser genutzt, selbst wenn er gesperrt ist oder wenn er scrollen muß."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
|
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
|
msgstr "Diese Option prüft, ob es im aktuellen Fenster einen Editor für die Zieldatei gibt und falls ja, wird dieser Editor genommen, selbst wenn er gesperrt ist oder wenn gescrollt werden muß."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
|
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
|
msgstr "Diese Option wählt einen gesperrten Editor, der das Sprungziel ohne Scrollen darstellen kann (das Ziel ist bereits im angezeigten Bildschirmbereich)."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
|
msgid "This option will use any not locked Editor."
|
|
msgstr "Diese Option wählt einen beliebigen nicht-gesperrten Editor."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
|
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
|
msgstr "Diese Option wählt einen nicht gesperrten Editor der ohne scrollen den Zielsprungpunkt anzeigen kann (das Ziel befindet sich bereits in der Mitte des sichtbaren Bereichs, nicht in den ersten/letzten 2-5 Zeilen)."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
|
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
|
|
msgstr "Diese Option öffnet einen neuen Reiter in einem vorhandenen oder neuen Fenster falls kein entsperrter Reiter gefunden wurde. Diese Option hat immer Erfolg und es werden keine weiteren Optionen mehr geprüft."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
|
msgstr "Diese Option öffnet einen neuen Reiter immer in einem neuen Fenster falls kein entsperrter Reiter gefunden wurde. Diese Option hat immer Erfolg und es werden keine weiteren Optionen geprüft."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
|
|
msgstr "Diese Option öffnet einen neuen Reiter in einem vorhandenen Fenster, falls kein entsperrter Reiter gefunden wird. Ein Reiter wird nur geöffnet, wenn ein Fenster verfügbar ist, das noch keinen Editor für die Zieldatei enthält."
|
|
|
|
#: lazarusidestrconsts.dlgedital
|
|
msgid "Italic"
|
|
msgstr "Kursiv"
|
|
|
|
#: lazarusidestrconsts.dlgeditexportbackcolor
|
|
msgid "Use Background color in HTML export"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditmaxlength
|
|
msgid "(Edit Max Length)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditorfontsize
|
|
msgid "Editor font size"
|
|
msgstr "Editor-Zeichengröße"
|
|
|
|
#: lazarusidestrconsts.dlgeditoroptions
|
|
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
|
msgid "Editor options"
|
|
msgstr "Editoreigenschaften"
|
|
|
|
#: lazarusidestrconsts.dlgeditschemdefaults
|
|
msgid "Scheme globals"
|
|
msgstr "Globale Schemata"
|
|
|
|
#: lazarusidestrconsts.dlgedmisc
|
|
msgctxt "lazarusidestrconsts.dlgedmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Verschiedenes"
|
|
|
|
#: lazarusidestrconsts.dlgedoff
|
|
msgid "Off"
|
|
msgstr "Aus"
|
|
|
|
#: lazarusidestrconsts.dlgedon
|
|
msgid "On"
|
|
msgstr "An"
|
|
|
|
#: lazarusidestrconsts.dlgedtabindent
|
|
msgid "Tab and Indent"
|
|
msgstr "Einrückung und Tabulatoren"
|
|
|
|
#: lazarusidestrconsts.dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Unterstreichen"
|
|
|
|
#: lazarusidestrconsts.dlgelastictabs
|
|
msgid "Elastic tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgelastictabswidths
|
|
msgid "Elastic min Widths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgelementattributes
|
|
msgid "Element Attributes"
|
|
msgstr "Elementattribute"
|
|
|
|
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
|
msgid "End key jumps to nearest end"
|
|
msgstr "Ende-Taste springt zum nächsten Ende"
|
|
|
|
#: lazarusidestrconsts.dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Fragen"
|
|
|
|
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Hinweis: Projektdateien sind alle Dateien im Verzeichnis des Projekts"
|
|
|
|
#: lazarusidestrconsts.dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Backup"
|
|
|
|
#: lazarusidestrconsts.dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "Dateien"
|
|
|
|
#: lazarusidestrconsts.dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Gitter"
|
|
|
|
#: lazarusidestrconsts.dlgenvidestartup
|
|
msgid "IDE Startup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguage
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
|
msgid "Language"
|
|
msgstr "Sprache"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguagerestarthint
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint"
|
|
msgid "Restart the IDE to complete the language change."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Hilfslinien"
|
|
|
|
#: lazarusidestrconsts.dlgenvmisc
|
|
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Verschiedenes"
|
|
|
|
#: lazarusidestrconsts.dlgenvnone
|
|
msgctxt "lazarusidestrconsts.dlgenvnone"
|
|
msgid "None"
|
|
msgstr "Keine"
|
|
|
|
#: lazarusidestrconsts.dlgenvotherfiles
|
|
msgid "Other Files"
|
|
msgstr "Andere Dateien"
|
|
|
|
#: lazarusidestrconsts.dlgenvproject
|
|
msgid "Tabs for project"
|
|
msgstr "Tabulatoren für Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgenvtype
|
|
msgctxt "lazarusidestrconsts.dlgenvtype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
|
|
msgid "Focus messages at compilation"
|
|
msgstr "Nachrichtenfenster während Kompilierung fokussieren"
|
|
|
|
#: lazarusidestrconsts.dlgextracharspacing
|
|
msgid "Extra character spacing"
|
|
msgstr "Zusätzlicher Zeichenabstand"
|
|
|
|
#: lazarusidestrconsts.dlgextralinespacing
|
|
msgid "Extra line spacing"
|
|
msgstr "Zusätzlicher Zeilenabstand"
|
|
|
|
#: lazarusidestrconsts.dlgextsymb
|
|
msgid "Use external debug symbols file"
|
|
msgstr "Externe Debugsymboldatei verwenden"
|
|
|
|
#: lazarusidestrconsts.dlgfileassociationinos
|
|
msgid "Opening Files from OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Dateiendungen"
|
|
|
|
#: lazarusidestrconsts.dlgfiles
|
|
#, object-pascal-format
|
|
msgid "%s files"
|
|
msgstr "%s Dateien"
|
|
|
|
#: lazarusidestrconsts.dlgfilterall
|
|
msgctxt "lazarusidestrconsts.dlgfilterall"
|
|
msgid "All files"
|
|
msgstr "Alle Dateien"
|
|
|
|
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
|
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
|
msgid "CodeTools template file"
|
|
msgstr "CodeTools-Vorlagendatei"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdcifile
|
|
msgid "DCI file"
|
|
msgstr "DCI-Datei"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiform
|
|
msgid "Delphi form"
|
|
msgstr "Delphi-Formular"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphipackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
|
msgid "Delphi package"
|
|
msgstr "Delphi-Package"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiproject
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
|
msgid "Delphi project"
|
|
msgstr "Delphi-Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
|
msgid "Delphi unit"
|
|
msgstr "Delphi-Unit"
|
|
|
|
#: lazarusidestrconsts.dlgfilterexecutable
|
|
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
|
msgid "Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
|
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
|
|
msgid "FPC message file"
|
|
msgstr "FPC-Nachrichten-Datei"
|
|
|
|
#: lazarusidestrconsts.dlgfilterfppkgconfigurationfile
|
|
msgid "Fppkg configuration file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterhtml
|
|
msgid "HTML files"
|
|
msgstr "HTML-Dateien"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
|
msgid "Bitmap images"
|
|
msgstr "Bitmap-Bilder"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespixmap
|
|
msgid "Pixmap images"
|
|
msgstr "Pixmap-Bilder"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespng
|
|
msgid "PNG images"
|
|
msgstr "PNG-Bilder"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Lazarus-Desktop-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
|
|
msgid "Editor file types"
|
|
msgstr "Editor-Dateitypen"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
|
|
msgid "Lazarus file"
|
|
msgstr "Lazarus-Datei"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusform
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
|
|
msgid "Lazarus form"
|
|
msgstr "Lazarus-Formular"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
|
|
msgid "Lazarus include file"
|
|
msgstr "Lazarus-Include-Datei"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
|
|
msgid "Lazarus other file"
|
|
msgstr "Lazarus andere Datei"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
|
|
msgid "Lazarus package"
|
|
msgstr "Lazarus-Package"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusproject
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
|
|
msgid "Lazarus project"
|
|
msgstr "Lazarus-Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
|
|
msgid "Lazarus project source"
|
|
msgstr "Lazarus-Projektquelltext"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarussession
|
|
msgid "Lazarus session"
|
|
msgstr "Lazarus-Sitzung"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
|
|
msgid "Lazarus unit"
|
|
msgstr "Lazarus-Unit"
|
|
|
|
#: lazarusidestrconsts.dlgfilterpackagelistfiles
|
|
msgid "Package list files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterpascalfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
|
|
msgid "Pascal file"
|
|
msgstr "Pascal-Datei"
|
|
|
|
#: lazarusidestrconsts.dlgfilterprograms
|
|
msgctxt "lazarusidestrconsts.dlgfilterprograms"
|
|
msgid "Programs"
|
|
msgstr "Programme"
|
|
|
|
#: lazarusidestrconsts.dlgfilterxml
|
|
msgctxt "lazarusidestrconsts.dlgfilterxml"
|
|
msgid "XML files"
|
|
msgstr "XML-Dateien"
|
|
|
|
#: lazarusidestrconsts.dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Text am Cursor suchen"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunk
|
|
msgid "Chunk"
|
|
msgstr "Chunk"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunksect
|
|
msgid "Chunk section"
|
|
msgstr "Chunk-Bereich"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlasp
|
|
msgid "ASP"
|
|
msgstr "ASP"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
|
msgid "Comment"
|
|
msgstr "Kommentar"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
|
msgid "Node"
|
|
msgstr "Knoten"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmitem
|
|
msgid "Item"
|
|
msgstr "Eintrag"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmlist
|
|
msgid "List <>"
|
|
msgstr "Liste <>"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmobject
|
|
msgid "Object (inherited, inline)"
|
|
msgstr "Objekt (abgeleitet, inline)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (lokal)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasanonprocedure
|
|
msgid "Anonymous Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasansicomment
|
|
msgid "Comment (* *)"
|
|
msgstr "Kommentar (* *)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasasm
|
|
msgid "Asm"
|
|
msgstr "Asm"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasbeginend
|
|
msgid "Begin/End (nested)"
|
|
msgstr "Begin/End (verschachtelt)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasborcomment
|
|
msgid "Comment { }"
|
|
msgstr "Kommentar { }"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpascase
|
|
msgid "Case"
|
|
msgstr "Case"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclass
|
|
msgid "Class/Object"
|
|
msgstr "Class/Object"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclasssection
|
|
msgid "public/private"
|
|
msgstr "Public/Private"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasexcept
|
|
msgid "Except/Finally"
|
|
msgstr "Except/Finally"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasfordo
|
|
msgid "For/Do"
|
|
msgstr "For/Do"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifdef
|
|
msgid "{$IfDef}"
|
|
msgstr "{$IfDef}"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifthen
|
|
msgid "If/Then/Else"
|
|
msgstr "If/Then/Else"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
|
msgid "Nested Comment"
|
|
msgstr "Geschachtelter Kommentar"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
|
msgid "Begin/End (procedure)"
|
|
msgstr "Begin/End (Prozedur)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocedure
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedure"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprogram
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecord
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
|
msgid "Record"
|
|
msgstr "Record"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecordcase
|
|
msgid "Record case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecordcasesect
|
|
msgid "Record case section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrepeat
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Repeat"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
|
msgid "Comment //"
|
|
msgstr "Kommentar //"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpastry
|
|
msgid "Try"
|
|
msgstr "Try"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunit
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
|
msgid "Unit"
|
|
msgstr "Unit"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunitsection
|
|
msgid "Unit section"
|
|
msgstr "Unit-Abschnitt"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuserregion
|
|
msgid "{%Region}"
|
|
msgstr "{%Region}"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuses
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
|
msgid "Uses"
|
|
msgstr "Uses"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasvartype
|
|
msgid "Var/Type (global)"
|
|
msgstr "Var/Type (global)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswhiledo
|
|
msgid "While/Do"
|
|
msgstr "While/Do"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswithdo
|
|
msgid "With/Do"
|
|
msgstr "With/Do"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcdata
|
|
msgid "CData"
|
|
msgstr "CData-Abschnitt"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
|
msgid "Comment"
|
|
msgstr "Kommentar"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmldoctype
|
|
msgid "DocType"
|
|
msgstr "Dokumenttyp"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
|
msgid "Node"
|
|
msgstr "Knoten"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlprocess
|
|
msgid "Processing Instruction"
|
|
msgstr "Verarbeite Anweisung"
|
|
|
|
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
|
|
msgid "Force DPI scaling in design-time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
|
|
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
|
msgid "The running Lazarus instance cannot accept any files."
|
|
msgstr "Die laufende Lazarus-Instanz akzeptiert keine Dateien."
|
|
|
|
#: lazarusidestrconsts.dlgforecolor
|
|
msgid "Foreground"
|
|
msgstr "Vordergrundfarbe"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
|
|
msgid "Change Object Inspector contents on clicking form title bar"
|
|
msgstr "Objektinspektor-Inhalte durch Klicken auf Titelleiste ändern"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
|
|
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Prozedur-Einfügerichtlinie"
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Reihenfolge der Prozeduren beibehalten"
|
|
|
|
#: lazarusidestrconsts.dlgfpcexecutable
|
|
#, object-pascal-format
|
|
msgid "Compiler executable (e.g. %s)"
|
|
msgstr "Compilerdateiname (z.B. %s)"
|
|
|
|
#: lazarusidestrconsts.dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "FPC-Quelltextverzeichnis"
|
|
|
|
#: lazarusidestrconsts.dlgfppkgconfigurationfile
|
|
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgframecolor
|
|
msgid "Text-mark"
|
|
msgstr "Rahmenfarbe"
|
|
|
|
#: lazarusidestrconsts.dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Formulareditor"
|
|
|
|
#: lazarusidestrconsts.dlgfrombeginning
|
|
msgid "From b&eginning"
|
|
msgstr "Vom B&eginn"
|
|
|
|
#: lazarusidestrconsts.dlgfromcursor
|
|
msgid "From c&ursor"
|
|
msgstr "Ab C&ursorposition"
|
|
|
|
#: lazarusidestrconsts.dlgglobal
|
|
msgid "&Global"
|
|
msgstr "&Global"
|
|
|
|
#: lazarusidestrconsts.dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Code für gprof erzeugen"
|
|
|
|
#: lazarusidestrconsts.dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Grabberfarbe"
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsdocked
|
|
msgid "Grayed desktops are for docked environment."
|
|
msgstr "Ausgegraute Desktops sind für gedockte IDE"
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
|
msgid "Grayed desktops are for undocked environment."
|
|
msgstr "Ausgegraute Desktops sind für ungedockte IDE"
|
|
|
|
#: lazarusidestrconsts.dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Gitterfarbe"
|
|
|
|
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
|
msgid "Grid consists of small dots which help aligning controls."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Gittergröße X"
|
|
|
|
#: lazarusidestrconsts.dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Waagrechte Rasterschrittweite"
|
|
|
|
#: lazarusidestrconsts.dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Gittergröße Y"
|
|
|
|
#: lazarusidestrconsts.dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Senkrechte Rasterschrittweite"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodeexplorer
|
|
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Code-Explorer"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodetools
|
|
msgid "Codetools"
|
|
msgstr "Codetools"
|
|
|
|
#: lazarusidestrconsts.dlggroupdebugger
|
|
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Debugger"
|
|
|
|
#: lazarusidestrconsts.dlggroupeditor
|
|
msgid "Editor"
|
|
msgstr "Editor"
|
|
|
|
#: lazarusidestrconsts.dlggroupenvironment
|
|
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
|
msgid "Environment"
|
|
msgstr "Umgebung"
|
|
|
|
#: lazarusidestrconsts.dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr "Gruppenrücknahme"
|
|
|
|
#: lazarusidestrconsts.dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Hilfslinien anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgguidelineshint
|
|
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutter
|
|
msgctxt "lazarusidestrconsts.dlggutter"
|
|
msgid "Gutter"
|
|
msgstr "Randleiste"
|
|
|
|
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
|
msgid "Collapsed"
|
|
msgstr "Gefaltet"
|
|
|
|
#: lazarusidestrconsts.dlgguttercolor
|
|
msgid "Gutter Color"
|
|
msgstr "Farbe der Randleiste"
|
|
|
|
#: lazarusidestrconsts.dlgguttercurrentlinenumber
|
|
msgid "Current Line (number)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguttercurrentlineother
|
|
msgid "Current Line (other)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutteredgecolor
|
|
msgid "Gutter Edge Color"
|
|
msgstr "Trennlinienfarbe"
|
|
|
|
#: lazarusidestrconsts.dlggutterseparatorindex
|
|
msgid "Gutter separator index"
|
|
msgstr "Trennerindex für Randleiste"
|
|
|
|
#: lazarusidestrconsts.dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Halbseitiges Scrollen"
|
|
|
|
#: lazarusidestrconsts.dlgheapandstacksize
|
|
msgid "Heap and stack sizes"
|
|
msgstr "Heap- und Stackgrößen"
|
|
|
|
#: lazarusidestrconsts.dlgheapsize
|
|
msgid "Heap size"
|
|
msgstr "Heap-Größe"
|
|
|
|
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
|
msgid "Height of one property in the grid."
|
|
msgstr "Höhe einer Eigenschaft im Gitter."
|
|
|
|
#: lazarusidestrconsts.dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Höhe:"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrun
|
|
msgid "Hide IDE windows on Run/Debug"
|
|
msgstr "IDE-Fenster bei Start/Debug verstecken"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrunhint
|
|
msgid "Do not show the IDE at all while program is running."
|
|
msgstr "Während das Programm läuft wird die IDE nicht angezeigt."
|
|
|
|
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
|
msgid "Hide tab in single page windows"
|
|
msgstr "Reiter bei einseitigen Fenstern ausblenden"
|
|
|
|
#: lazarusidestrconsts.dlghighlightcolor
|
|
msgid "Highlight Color"
|
|
msgstr "Hervorhebungsfarbe"
|
|
|
|
#: lazarusidestrconsts.dlghighlightfontcolor
|
|
msgid "Highlight Font Color"
|
|
msgstr "Hervorhebungsschriftfarbe"
|
|
|
|
#: lazarusidestrconsts.dlghighlightleftofcursor
|
|
msgid "Left Of Caret"
|
|
msgstr "Links vom Cursor"
|
|
|
|
#: lazarusidestrconsts.dlghighlightrightofcursor
|
|
msgid "Right Of Caret"
|
|
msgstr "Rechts vom Cursor"
|
|
|
|
#: lazarusidestrconsts.dlghintsparametersendernotused
|
|
msgid "Show hints for parameter \"Sender\" not used"
|
|
msgstr "Hinweisanzeige für unbenutzte Parameter \"Sender\""
|
|
|
|
#: lazarusidestrconsts.dlghintsunused
|
|
msgid "Show hints for unused units in main"
|
|
msgstr "Hinweis a. überflüssige Units im Hauptquelltext"
|
|
|
|
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Pos1-Taste springt zum nächsten Anfang"
|
|
|
|
#: lazarusidestrconsts.dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Hostapplikation"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryabstractprocfunc
|
|
msgid "Abstract proc/func"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrycodetemplate
|
|
msgid "Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryconst
|
|
msgid "Const"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryenum
|
|
msgid "Enum"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryfunc
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryfunc"
|
|
msgid "Function"
|
|
msgstr "Funktion"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryident
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryident"
|
|
msgid "Identifier"
|
|
msgstr "Bezeichner"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrykeyword
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrykeyword"
|
|
msgid "Keyword"
|
|
msgstr "Schlüsselwort"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrylabel
|
|
msgid "Label"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrylowervisibilityprocfunc
|
|
msgid "Lower visibility proc/func"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrynamespace
|
|
msgid "Namespace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryother
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryother"
|
|
msgid "Other"
|
|
msgstr "Andere"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryproc
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryproc"
|
|
msgid "Procedure"
|
|
msgstr "Procedure"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryproperty
|
|
msgid "Property"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrytext
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytext"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrytype
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryunit
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryunit"
|
|
msgid "Unit"
|
|
msgstr "Unit"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryvar
|
|
msgid "Var"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgidentifiercompletion
|
|
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
|
msgid "Identifier Completion"
|
|
msgstr "Bezeichner-Vervollständigung"
|
|
|
|
#: lazarusidestrconsts.dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Bezeichnerrichtlinie"
|
|
|
|
#: lazarusidestrconsts.dlgideoptions
|
|
msgid "IDE Options"
|
|
msgstr "IDE-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockactive
|
|
msgid "Active $IFDEF code"
|
|
msgstr "Aktiver $IFDEF Code"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockinactive
|
|
msgid "Inactive $IFDEF code"
|
|
msgstr "Inaktiver $IFDEF Code"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
|
msgid "Included mixed state $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeactive
|
|
msgid "Active $IFDEF node"
|
|
msgstr "Aktiver $IFDEF Knoten"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeinactive
|
|
msgid "Inactive $IFDEF node"
|
|
msgstr "Inaktiver $IFDEF Knoten"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
|
msgid "Included mixed state $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgimportdesktopexists
|
|
msgid ""
|
|
"A desktop with the same name already exists.\n"
|
|
"Please confirm the desktop name:"
|
|
msgstr ""
|
|
"Ein Desktop mit dem gleichen Namen existiert bereits.\n"
|
|
"Bitte bestätigen Sie den Desktopnamen:"
|
|
|
|
#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
|
|
msgid "Include code templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
|
|
msgid "Include identifiers containing prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
|
|
msgid "Include all keywords and operators"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Systemvariablen einfügen"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl
|
|
msgid "Include words"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
|
|
msgid "don't include"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
|
|
msgid "from all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
|
|
msgid "from current unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentslineindentgroupoptions
|
|
msgid "Indent (New line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabindentgroupoptions
|
|
msgid "Indent (Tab key on Selection)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabskeyoptions
|
|
msgid "Tab key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabswidthsoptions
|
|
msgid "Tabs widths (Tab stop position)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Vor Methoden"
|
|
|
|
#: lazarusidestrconsts.dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Name des Konstruktors muß »init« sein (Destruktor muß »done« heißen)"
|
|
|
|
#: lazarusidestrconsts.dlginsertclassparts
|
|
msgid "Insert class parts"
|
|
msgstr "Klassenteileeinfügung"
|
|
|
|
#: lazarusidestrconsts.dlginsertimplementation
|
|
msgid "Implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertinterface
|
|
msgid "Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertmethods
|
|
msgid "Insert method implementations"
|
|
msgstr "Methodenimplementierungen einfügen"
|
|
|
|
#: lazarusidestrconsts.dlginsertsection
|
|
msgid "Insert into Uses section of"
|
|
msgstr "Einfügen in den uses Abschnitt von"
|
|
|
|
#: lazarusidestrconsts.dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Leerzeichen einfügen nach ..."
|
|
|
|
#: lazarusidestrconsts.dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Leerzeichen einfügen vor ..."
|
|
|
|
#: lazarusidestrconsts.dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Intervall in Sekunden"
|
|
|
|
#: lazarusidestrconsts.dlgjumpcodeblockpos
|
|
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
|
|
msgstr "Vertikale Position für einen Codeblock-Sprung in % (0=oben, 100=unten)"
|
|
|
|
#: lazarusidestrconsts.dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Springen (bspw. Methodenspringen)"
|
|
|
|
#: lazarusidestrconsts.dlgjumpsinglelinepos
|
|
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
|
|
msgstr "Vertikale Position für einen einfachen Zeilen-Sprung in % (0=oben, 100=unten)"
|
|
|
|
#: lazarusidestrconsts.dlgjumptomethodbody
|
|
msgid "Jump directly to method body"
|
|
msgstr "Direkt zum Methodenrumpf springen"
|
|
|
|
#: lazarusidestrconsts.dlgkeepcursorx
|
|
msgid "Keep caret X position when navigating up/down"
|
|
msgstr "Cursorposition X beim Navigieren nach oben/unten beibehalten"
|
|
|
|
#: lazarusidestrconsts.dlgkeylink
|
|
msgid "(Edit Key)"
|
|
msgstr "(Taste bearbeiten)"
|
|
|
|
#: lazarusidestrconsts.dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Tastaturbelegung"
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Tastenzuweisungsfehler"
|
|
|
|
#: lazarusidestrconsts.dlgkeyword
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgkeyword"
|
|
msgid "Keyword"
|
|
msgstr "Schlüsselwort"
|
|
|
|
#: lazarusidestrconsts.dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Schlüsselwortrichtlinie"
|
|
|
|
#: lazarusidestrconsts.dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "LABEL und GOTO erlauben"
|
|
|
|
#: lazarusidestrconsts.dlglang
|
|
msgctxt "lazarusidestrconsts.dlglang"
|
|
msgid "Language"
|
|
msgstr "Sprache"
|
|
|
|
#: lazarusidestrconsts.dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Letzter (d.h. am Ende des Quelltexts)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Lazarus-Verzeichnis (Voreinstellung für alle Projekte)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusinstances
|
|
msgid "Lazarus instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglefttopclr
|
|
msgid "Guide lines Left,Top"
|
|
msgstr "Farbe für links, oben"
|
|
|
|
#: lazarusidestrconsts.dlglevel1opt
|
|
msgid "1 (quick, debugger friendly with small limitations)"
|
|
msgstr "Stufe 1 (schnell, noch weitgehend debuggerfreundlich)"
|
|
|
|
#: lazarusidestrconsts.dlglevel2opt
|
|
msgid "2 (-O1 + quick optimizations)"
|
|
msgstr "Stufe 2 (-O1 + schnelle Opt.)"
|
|
|
|
#: lazarusidestrconsts.dlglevel3opt
|
|
msgid "3 (-O2 + slow optimizations)"
|
|
msgstr "Stufe 3 (-O2 + langsame Opt.)"
|
|
|
|
#: lazarusidestrconsts.dlglevel4opt
|
|
msgid "4 (-O3 + aggressive optimizations, beware)"
|
|
msgstr "Stufe 4 (-O3 + aggressive Opt. , Vorsicht!)"
|
|
|
|
#: lazarusidestrconsts.dlglevelnoneopt
|
|
msgid "0 (no optimization, for debugging)"
|
|
msgstr "Stufe 0 (keine Optimierungen, zum Debuggen)"
|
|
|
|
#: lazarusidestrconsts.dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Zeilentrennung"
|
|
|
|
#: lazarusidestrconsts.dlglinksmart
|
|
msgid "Link smart"
|
|
msgstr "Smart Linken"
|
|
|
|
#: lazarusidestrconsts.dlglnumsbct
|
|
msgid "Display line numbers in run-time error backtraces"
|
|
msgstr "Zeilennummern in Laufzeitfehler-Backtraces anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewforms
|
|
msgid "View Project Forms"
|
|
msgstr "Projektfenster anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewframes
|
|
msgid "View Project Frames"
|
|
msgstr "Projekt-Frames anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewunits
|
|
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
|
msgid "View Project Units"
|
|
msgstr "Projektunits anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgmakeexecutable
|
|
msgid "\"Make\" executable"
|
|
msgstr "Pfad zum \"Make\"-Programm"
|
|
|
|
#: lazarusidestrconsts.dlgmanagedesktops
|
|
msgid "Manage desktops"
|
|
msgstr "Desktops verwalten"
|
|
|
|
#: lazarusidestrconsts.dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Rand und Leiste"
|
|
|
|
#: lazarusidestrconsts.dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Markierungsfarbe"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec
|
|
#, object-pascal-format
|
|
msgid "(%s sec delay after caret move)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupfoldcolor
|
|
msgid "Vertical-mark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupgroup
|
|
msgid "Highlight all occurrences of Word under Caret"
|
|
msgstr "Alle Vorkommen von Wort unter Caret hervorheben"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutline
|
|
msgid "Outline (global)"
|
|
msgstr "Außenlinie (global)"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
|
|
msgid "Warning: There are no colors configured for the selected language"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefined
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
|
msgid "User defined markup"
|
|
msgstr "Benutzerdefinierte Hervorhebung"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
|
msgid "Delete"
|
|
msgstr "Löschen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
|
#, object-pascal-format
|
|
msgid "Delete list \"%s\"?"
|
|
msgstr "Liste \"%s\" löschen?"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivedit
|
|
msgid "Edit list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
|
msgid "Add Word or Term by key"
|
|
msgstr "Wort oder Ausdruck mit Taste hinzufügen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
|
msgid "Remove Word or Term by key"
|
|
msgstr "Wort oder Ausdruck mit Taste entfernen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
|
msgid "Toggle Word or Term by key"
|
|
msgstr "Wort oder Ausdruck mit Taste umschalten"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivselect
|
|
msgid "Create or Select list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
|
msgid "Duplicate Term"
|
|
msgstr "Doppelter Ausdruck"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
|
#, object-pascal-format
|
|
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
|
msgstr "Der Ausdruck %s existiert bereits. Duplikate werden beim Speichern der Liste entfernt."
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
|
msgid "Add/Remove in all editors"
|
|
msgstr "In allen Editorfenstern hinzufügen/löschen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
|
msgid "Delete list"
|
|
msgstr "Liste löschen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
|
msgid "Name"
|
|
msgstr "Name"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
|
msgid "Add list"
|
|
msgstr "Liste hinzuf."
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
|
msgid "Case sensitive"
|
|
msgstr "Beachtung Groß- und Kleinschreibung"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
|
msgid "Set bound at term end"
|
|
msgstr "Begrenzung am Ausdruckende setzen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
|
msgid "Set bound at term start"
|
|
msgstr "Begrenzung am Ausdruckanfang setzen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
|
msgid "Ignore bounds for terms longer than"
|
|
msgstr "Begrenzung ignorieren für Ausdrücke länger als"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
|
msgid "selection"
|
|
msgstr "Auswahl"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
|
msgid "current word"
|
|
msgstr "aktuelles Wort"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
|
msgid "Settings for terms added by key"
|
|
msgstr "Einst. für durch eine Taste hinzugef. Ausdruck"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
|
msgid "Smart match selection bounds"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
|
msgid "New list"
|
|
msgstr "Neue Liste"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
|
msgid "No lists"
|
|
msgstr "Keine Listen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
|
msgid "Select ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
|
msgid "Key mappings"
|
|
msgstr "Tastenbelegung"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
|
msgid "Main settings"
|
|
msgstr "Haupteinstellungen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordbracket
|
|
msgid "Keyword brackets on caret (global)"
|
|
msgstr "Schlüsselwortklammern am Cursor (global)"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
|
msgid "Match whole words, if length is less or equal to:"
|
|
msgstr "Nur ganze Wörter, wenn Länge kleiner oder gleich:"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordkeycombo
|
|
#, object-pascal-format
|
|
msgid "Markup current word by key: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
|
msgid "Ignore keywords"
|
|
msgstr "Schlüsselworte übergehen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordoncaretmove
|
|
msgid "Automatically markup current word on caret move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordtrim
|
|
msgid "Trim spaces (when highlighting current selection)"
|
|
msgstr "Leerzeichen anpassen"
|
|
|
|
#: lazarusidestrconsts.dlgmatchwords
|
|
msgid "Match words"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Maximaler Zähler"
|
|
|
|
#: lazarusidestrconsts.dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Maximale Zeilenlänge"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Höchstens gemerkte Dateien"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecenthint
|
|
msgid "Value 0 means unlimited."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Höchstens gemerkte Projektdateien"
|
|
|
|
#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
|
|
msgid "Middle-click-modifier to close all other tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
|
|
msgid "Middle-click-modifier to close tabs on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Methoden und Eigenschaften mischen"
|
|
|
|
#: lazarusidestrconsts.dlgmode
|
|
msgid "Mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmodifier
|
|
msgid "Modifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseaction
|
|
msgid "Mouse Action"
|
|
msgstr "Mausaktion"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
|
msgid "Single"
|
|
msgstr "Einfach"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
|
msgid "Double"
|
|
msgstr "Doppelt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn3
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
|
msgid "Triple"
|
|
msgstr "Dreifach"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn4
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
|
msgid "Quad"
|
|
msgstr "Vierfach"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnany
|
|
msgid "Any"
|
|
msgstr "Jeder"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
|
msgid "Extra 1"
|
|
msgstr "Extra 1"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
|
msgid "Extra 2"
|
|
msgstr "Extra 2"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
|
msgid "Middle"
|
|
msgstr "Mitte"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
|
msgid "Make Fallback"
|
|
msgstr "Fallback anlegen"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnright
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
|
msgid "Wheel down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
|
|
msgid "Wheel left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelright
|
|
msgid "Wheel right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
|
msgid "Wheel up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcapture
|
|
msgid "Capture"
|
|
msgstr "Einfangen"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
|
msgid "Move Caret (extra)"
|
|
msgstr "Caret bewegen (extra)"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
|
msgid "Act on Mouse up"
|
|
msgstr "Beim Loslassen der Maustaste ausführen"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescaction
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
|
msgid "Action"
|
|
msgstr "Aktion"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
|
msgid "Click"
|
|
msgstr "Klick"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
|
msgid "Edit Mouse"
|
|
msgstr "Mausbearbeitung"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrordup
|
|
msgid "Duplicate Entry"
|
|
msgstr "Doppelter Eintrag"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
|
msgid "This entry conflicts with an existing entry"
|
|
msgstr "Eintrag kollidiert mit einem vorhandenen"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
|
msgid "Button"
|
|
msgstr "Schaltfläche"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
|
|
msgid "Caret"
|
|
msgstr "Cursor"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
|
msgid "Context"
|
|
msgstr "Kontext"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcount
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
|
msgid "Click"
|
|
msgstr "Klick"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Strg"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
|
msgid "Action"
|
|
msgstr "Aktion"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddir
|
|
msgid "Up/Down"
|
|
msgstr "Hinauf/Hinunter"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadopt
|
|
msgid "Option"
|
|
msgstr "Einstellung"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadorder
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
|
msgid "Order"
|
|
msgstr "Reihenfolge"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
|
msgid "Priority"
|
|
msgstr "Priorität"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
|
msgid "Shift"
|
|
msgstr "Umsch"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptions
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
|
msgid "Mouse"
|
|
msgstr "Maus"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsadv
|
|
msgid "Advanced"
|
|
msgstr "Erweitert"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
|
msgid "IDE-Command"
|
|
msgstr "IDE-Befehl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Strg"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
|
msgid "n"
|
|
msgstr "n"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
|
msgid "Y"
|
|
msgstr "j"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
|
msgid "Shift"
|
|
msgstr "Umsch"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
|
msgid "Y"
|
|
msgstr "J"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeall
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
|
msgid "Gutter"
|
|
msgstr "Randleiste"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
|
msgid "Line Changes"
|
|
msgstr "Zeilenänderungen"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
|
msgid "Fold Tree"
|
|
msgstr "Falt-Baum"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
|
msgid "Collapsed [+]"
|
|
msgstr "Gefaltet [+]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
|
msgid "Expanded [-]"
|
|
msgstr "Entfaltet [-]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
|
|
msgid "Overview"
|
|
msgstr "Übersicht"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
|
|
msgid "Overview Mark"
|
|
msgstr "Übersichtsmarkierung"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
|
msgid "Line Numbers"
|
|
msgstr "Zeilennummern"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodemain
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
|
msgid "Selection"
|
|
msgstr "Auswahl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptopt2label
|
|
msgid "Opt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheract
|
|
msgid "Other actions using the same button"
|
|
msgstr "Andere Aktionen nutzen die selbe Taste"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
|
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
|
msgstr "Sie können abhängig von den Modifizierer-Tasten, Einstellung für das Durchlaufen, Single/Double, Hoch/Runter usw. ausgeführt werden"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
|
msgid "Filter Mod-Keys"
|
|
msgstr "Mod-Tasten filtern"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
|
msgid "Priority"
|
|
msgstr "Priorität"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
|
msgid "Debug"
|
|
msgstr "Debug"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
|
msgid "Error"
|
|
msgstr "Fehler"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
|
msgid "Fatal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
|
msgid "Hint"
|
|
msgstr "Hinweis"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
|
msgid "Important"
|
|
msgstr "Wichtig"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
|
msgid "Normal"
|
|
msgstr "Normal"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
|
msgid "Note"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
|
msgid "Time and statistics"
|
|
msgstr "Zeit und Statistik"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
|
msgid "Verbose 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
|
msgid "Verbose 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
|
msgid "Warning"
|
|
msgstr "Warnung"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
|
msgid "Navigation keys move all carets (column-select)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretdelskipcr
|
|
msgid "Skip delete key at EOL (do not join lines)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretgroupoptions
|
|
msgid "Multi-caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretmode
|
|
msgid "Navigation keys move all carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
|
msgid "Enable multi-caret for column selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
|
msgid "always start a new instance"
|
|
msgstr "immer eine neue Instanz öffnen"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
|
msgid "do not allow multiple instances"
|
|
msgstr "Mehrfache Instanzen nicht erlauben"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
|
msgid "open files in a running instance"
|
|
msgstr "Dateien in einer laufenden Instanz öffnen"
|
|
|
|
#: lazarusidestrconsts.dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr "Mehrfachauswahl"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
|
msgid "Jump target priority between multiple editors"
|
|
msgstr "Editorauswahl für Sprungziele"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
|
msgid "Order to use for editors matching the same criteria"
|
|
msgstr "Reihenfolge für Editoren, für die die selben Kriterien gelten"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
|
msgid "Most recent focused editor for this file"
|
|
msgstr "Zuletzt fokussierter Editor für die Datei"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
|
msgid "Editor (for file) in most recent focused window"
|
|
msgstr "Editor (für die Datei) der zuletzt den Fokus hatte"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
|
msgid "Priority list of criteria to choose an editor:"
|
|
msgstr "Kriterieren, nach denen ein Editor ausgewählt wird:"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinoptions
|
|
msgid "Pages and Windows"
|
|
msgstr "Seiten und Fenster"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwintabgroup
|
|
msgid "Notebook Tabs"
|
|
msgstr "Notebook-Reiter"
|
|
|
|
#: lazarusidestrconsts.dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Namensvergabe"
|
|
|
|
#: lazarusidestrconsts.dlgnewdesktop
|
|
msgid "New desktop ..."
|
|
msgstr "Neuer Desktop ..."
|
|
|
|
#: lazarusidestrconsts.dlgnewprojecttype
|
|
msgid "New Project Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
|
msgid "No automatic renaming"
|
|
msgstr "Kein automatisches Umbenennen"
|
|
|
|
#: lazarusidestrconsts.dlgnoavailableunits
|
|
msgid "No available units to add."
|
|
msgstr "Keine verfügbaren Units zum Hinzufügen."
|
|
|
|
#: lazarusidestrconsts.dlgnobrackethighlight
|
|
msgid "No Highlight"
|
|
msgstr "Keine Hervorhebung"
|
|
|
|
#: lazarusidestrconsts.dlgnonformbackgroundcolor
|
|
msgid "Other Designer background (e. g. TDataModule)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotebooktabpos
|
|
msgid "Source notebook tabs position"
|
|
msgstr "Reiterpositionen des Quell-Notebooks"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlineafter
|
|
msgid "Do not split line after"
|
|
msgstr "Zeile nicht teilen nach:"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlinefront
|
|
msgid "Do not split line in front of"
|
|
msgstr "Zeile nicht teilen vor:"
|
|
|
|
#: lazarusidestrconsts.dlgnsprincipalclass
|
|
msgid "NSPrincipalClass"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgobjinsp
|
|
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
|
msgid "Object Inspector"
|
|
msgstr "Objektinspektor"
|
|
|
|
#: lazarusidestrconsts.dlgoiitemheight
|
|
msgid "Item height (0 = auto)"
|
|
msgstr "Höhe des Eintrags (0 = automatisch)"
|
|
|
|
#: lazarusidestrconsts.dlgoimiscellaneous
|
|
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Verschiedenes"
|
|
|
|
#: lazarusidestrconsts.dlgoispeedsettings
|
|
msgid "Speed settings"
|
|
msgstr "Schnellumstellung"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
|
msgid "Use default Delphi settings"
|
|
msgstr "Es gelten die Voreinstellungen von Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
|
msgid "Use default Lazarus settings"
|
|
msgstr "Es gelten die Voreinstellungen von Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgoptdebugbackendeditdebuggerbackend
|
|
msgid "Edit debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptdebugbackendselectdebuggerbackend
|
|
msgid "Select debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptdebugbackendtheprojectoptionshavebeen
|
|
msgid "The project options have been set to use a different debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptimizationlevels
|
|
msgid "Optimization levels"
|
|
msgstr "Optimierungen"
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrap
|
|
msgid "Word-wrap"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapallhl
|
|
msgid "Select all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapcheckfixedlength
|
|
msgid "Wrap at fixed column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapdisplaycaretatwrappositio
|
|
msgid "Display caret at wrap-position..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapendofline
|
|
msgid "end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapfixedlinelength
|
|
msgid "Fixed line length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwraphomeendkey
|
|
msgid "Force default home/end keys to subline start/end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindent
|
|
msgid "Indent width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindentisoffset
|
|
msgctxt "lazarusidestrconsts.dlgoptwordwrapindentisoffset"
|
|
msgid "Indent relative to text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindentmax
|
|
msgid "Maximum indent width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindentmaxrel
|
|
msgid "Maximum indent width (percent)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindentmin
|
|
msgid "Minimum indent width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapmaximumlinelength
|
|
msgid "Maximum line length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapminimumlinelength
|
|
msgid "Minimum line length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapnonehl
|
|
msgid "Clear selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapsectioncolumn
|
|
msgid "Wrap column settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapsectionindent
|
|
msgid "Indent settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapstartofnextline
|
|
msgid "start of next line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapusewordwrap
|
|
msgid "Use Word-wrap"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgotheroptimizations
|
|
msgid "Other optimizations"
|
|
msgstr "Andere Optimierungen"
|
|
|
|
#: lazarusidestrconsts.dlgotherunitfiles
|
|
msgid "Other unit files (-Fu):"
|
|
msgstr "Andere Units (-Fu) (Trenner ist der Strichpunkt):"
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterback1color
|
|
msgid "Background 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterback2color
|
|
msgid "Background 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoverviewguttercolor
|
|
msgid "Overview Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterpagecolor
|
|
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
|
|
msgid "Page"
|
|
msgstr "Seite"
|
|
|
|
#: lazarusidestrconsts.dlgoverwriteblock
|
|
msgid "Overwrite block"
|
|
msgstr "Block überschreiben"
|
|
|
|
#: lazarusidestrconsts.dlgoverwritedesktop
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"Desktop with the name \"%s\" was found.\n"
|
|
"Should the old desktop be overwritten?"
|
|
msgstr ""
|
|
"Desktop mit dem Namen \"%s\" wurde gefunden.\n"
|
|
"Soll der alte Desktop überschrieben werden?"
|
|
|
|
#: lazarusidestrconsts.dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Hinweise für die Komponentenpalette"
|
|
|
|
#: lazarusidestrconsts.dlgpascaselabelforotherwise
|
|
msgid "Color otherwise/else as case-label"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmode
|
|
msgid "Extend of type-highlight in declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodeident
|
|
msgid "Identifier only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodekeyandsym
|
|
msgid "All, including symbols"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodekeywords
|
|
msgid "Identifier, built-in and keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodenames
|
|
msgid "Identifier and built-in (types/values)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypevaluemode
|
|
msgid "Extend of initial-value-highlight in declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypevaluemodeliteral
|
|
msgid "Include literals (Number, String) in initial-value-highlight in declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasext
|
|
msgid "Default Pascal extension"
|
|
msgstr "Voreingestellte Pascal-Dateiendung"
|
|
|
|
#: lazarusidestrconsts.dlgpasexthighlightgroup
|
|
msgid "Extended Pascal Highlight Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywords
|
|
#, fuzzy
|
|
#| msgid "Highlight control statements as keywords"
|
|
msgid "Highlight flow control statements (break, continue, exit) as keywords"
|
|
msgstr "Steueranweisungen wie Schlüsselworte hervorheben"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmarkup
|
|
msgid "Markup (on caret)"
|
|
msgstr "Auszeichnung (am Cursor)"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
|
msgid "Matching Keywords"
|
|
msgstr "Passende Schlüsselwörter"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsoutline
|
|
msgid "Outline"
|
|
msgstr "Außenlinie"
|
|
|
|
#: lazarusidestrconsts.dlgpassoptslinker
|
|
msgid "Pass options to linker with \"-k\", delimiter is space"
|
|
msgstr "Linker zusätzliche Einstellungen übergeben mit \"-k\" (Leerzeichen trennt)"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywords
|
|
#, fuzzy
|
|
#| msgid "Highlight \"String\" keyword(s)"
|
|
msgid "Highlight \"String\" types as keyword"
|
|
msgstr "Hebe \"String\" Schlüsselwort(e) hervor"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
|
msgid "Default"
|
|
msgstr "Voreinstellung"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
|
msgid "None"
|
|
msgstr "Keine"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
|
msgid "Only \"String\""
|
|
msgstr "Nur \"String\""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentblock
|
|
msgid "Persistent block"
|
|
msgstr "Persistenter Block"
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursor
|
|
msgid "Visible caret in unfocused editor"
|
|
msgstr "Einfügemarke im unfokussierten Editor sichtbar"
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursornoblink
|
|
msgid "Caret in unfocused editor does not blink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoansiutf8
|
|
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Anwendung"
|
|
|
|
#: lazarusidestrconsts.dlgpoasinvoker
|
|
msgid "as invoker (asInvoker)"
|
|
msgstr "wie Aufrufer (asInvoker)"
|
|
|
|
#: lazarusidestrconsts.dlgpoclearicon
|
|
msgid "&Clear Icon"
|
|
msgstr "Symbol lös&chen"
|
|
|
|
#: lazarusidestrconsts.dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr "Anwendungsbundle erzeugen"
|
|
|
|
#: lazarusidestrconsts.dlgpodebugger
|
|
msgctxt "lazarusidestrconsts.dlgpodebugger"
|
|
msgid "Debugger"
|
|
msgstr "Debugger"
|
|
|
|
#: lazarusidestrconsts.dlgpodefaulticon
|
|
msgid "Load &Default"
|
|
msgstr "Vorgabe-Symbol laden"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawareness
|
|
msgid "DPI awareness"
|
|
msgstr "DPI-Anpassung"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
|
msgid "off"
|
|
msgstr "aus"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
|
msgid "Vista-8: off, 8.1+: per monitor"
|
|
msgstr "Vista-8: aus, 8.1+: pro Monitor"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
|
msgid "Vista-8: on, 8.1+: per monitor"
|
|
msgstr "Vista-8: an, 8.1+: pro Monitor"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
|
|
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
|
|
msgstr "Vista-8: an, 8.1/10+: pro Monitor/V2"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenesson
|
|
msgid "on"
|
|
msgstr "an"
|
|
|
|
#: lazarusidestrconsts.dlgpoexecutionlevel
|
|
msgid "Execution Level"
|
|
msgstr "Ausführungsebene"
|
|
|
|
#: lazarusidestrconsts.dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Formulare"
|
|
|
|
#: lazarusidestrconsts.dlgpohighestavailable
|
|
msgid "highest available (highestAvailable)"
|
|
msgstr "höchste verfügbare (highestAvailable)"
|
|
|
|
#: lazarusidestrconsts.dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr "i18n"
|
|
|
|
#: lazarusidestrconsts.dlgpoicon
|
|
msgid "Icon:"
|
|
msgstr "Symbol:"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondesc
|
|
#, object-pascal-format
|
|
msgid "(size: %d:%d, bpp: %d)"
|
|
msgstr "(Größe: %d:%d, bpp: %d)"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondescnone
|
|
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
|
msgid "(none)"
|
|
msgstr "(keiner)"
|
|
|
|
#: lazarusidestrconsts.dlgpointertypecheck
|
|
msgid "@<pointer> returns a typed pointer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoloadicon
|
|
msgid "&Load Icon"
|
|
msgstr "Symbol &laden"
|
|
|
|
#: lazarusidestrconsts.dlgpolongpathaware
|
|
msgid "Long path awareness (Windows 10 1607+)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpomisc
|
|
msgctxt "lazarusidestrconsts.dlgpomisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Verschiedenes"
|
|
|
|
#: lazarusidestrconsts.dlgporequireadministrator
|
|
msgid "require administrator (requireAdministrator)"
|
|
msgstr "benötigt Administrator (requireAdministrator)"
|
|
|
|
#: lazarusidestrconsts.dlgporesources
|
|
msgid "Resources"
|
|
msgstr "Ressourcen"
|
|
|
|
#: lazarusidestrconsts.dlgposaveicon
|
|
msgid "&Save Icon"
|
|
msgstr "Symbol &speichern"
|
|
|
|
#: lazarusidestrconsts.dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Sitzung"
|
|
|
|
#: lazarusidestrconsts.dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Titel:"
|
|
|
|
#: lazarusidestrconsts.dlgpouiaccess
|
|
msgid "UI Access (uiAccess)"
|
|
msgstr "UI-Zugriff (uiAccess)"
|
|
|
|
#: lazarusidestrconsts.dlgpouseappbundle
|
|
msgid "Use Application Bundle for running and debugging"
|
|
msgstr "Anwendungs-Bundle für Start und Debug verwenden"
|
|
|
|
#: lazarusidestrconsts.dlgpouselclscaling
|
|
msgid "Use LCL scaling (Hi-DPI)"
|
|
msgstr "LCL-Skalierung verwenden (Hi-DPI)"
|
|
|
|
#: lazarusidestrconsts.dlgpousemanifest
|
|
msgid "Use manifest resource (and enable themes)"
|
|
msgstr "Manifest-Ressource verwenden (und Themen aktivieren)"
|
|
|
|
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
|
msgid "Prefer double-click over single-click"
|
|
msgstr "Doppelklick gegenüber Einfachklick bevorzugen"
|
|
|
|
#: lazarusidestrconsts.dlgpriorities
|
|
msgid "Priorities"
|
|
msgstr "Prioritäten"
|
|
|
|
#: lazarusidestrconsts.dlgproject
|
|
msgctxt "lazarusidestrconsts.dlgproject"
|
|
msgid "Project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptionsfor
|
|
#, object-pascal-format
|
|
msgid "Options for Project: %s"
|
|
msgstr "Einstellungen für Projekt: %s"
|
|
|
|
#: lazarusidestrconsts.dlgprojecttoopenorcreate
|
|
msgid "Project to Open or Create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojfiles
|
|
msgid "Project Files"
|
|
msgstr "Projektdateien"
|
|
|
|
#: lazarusidestrconsts.dlgpromptonreplace
|
|
msgid "&Prompt on replace"
|
|
msgstr "Beim Überschreiben nachfragen"
|
|
|
|
#: lazarusidestrconsts.dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "Eigenschaftenvervollständigung"
|
|
|
|
#: lazarusidestrconsts.dlgpropnamecolor
|
|
msgid "Property Name"
|
|
msgstr "Name der Eigenschaft"
|
|
|
|
#: lazarusidestrconsts.dlgqopenlastprj
|
|
msgid "Open last project and packages at start"
|
|
msgstr "Zuletzt geladenes Projekt und Packages beim Start öffnen"
|
|
|
|
#: lazarusidestrconsts.dlgqshowborderspacing
|
|
msgid "Show border spacing"
|
|
msgstr "Abstand vom Rand"
|
|
|
|
#: lazarusidestrconsts.dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Gitter anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Am Gitter ausrichten"
|
|
|
|
#: lazarusidestrconsts.dlgreallydeletedesktop
|
|
#, object-pascal-format
|
|
msgid "Really delete desktop \"%s\"?"
|
|
msgstr "Desktop \"%s\" wirklich löschen?"
|
|
|
|
#: lazarusidestrconsts.dlgredirappend
|
|
msgid "To file (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirinput
|
|
msgid "From file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirinputend
|
|
msgid "From file (at EOF)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrediroff
|
|
msgid "No redirection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrediroverwrite
|
|
msgid "To file (overwrite)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirstderr
|
|
msgid "Redirect StdErr"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirstdin
|
|
msgid "Redirect StdIn"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirstdnotsupported
|
|
msgid "Current debugger does not support redirection."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirstdout
|
|
msgid "Redirect StdOut"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr "Referenz"
|
|
|
|
#: lazarusidestrconsts.dlgregularexpressions
|
|
msgid "Regular e&xpressions"
|
|
msgstr "Reguläre Ausdrücke"
|
|
|
|
#: lazarusidestrconsts.dlgrenamedesktop
|
|
msgid "Rename desktop"
|
|
msgstr "Desktop umbenennen"
|
|
|
|
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
|
|
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
|
|
msgid "Rename"
|
|
msgstr "Umbenennen"
|
|
|
|
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
|
|
msgid "Rename selected desktop"
|
|
msgstr "Ausgewählten Desktop umbenennen"
|
|
|
|
#: lazarusidestrconsts.dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "&Alle ersetzen"
|
|
|
|
#: lazarusidestrconsts.dlgreplacewith
|
|
msgid "Replace wit&h"
|
|
msgstr "E&rsetzen mit"
|
|
|
|
#: lazarusidestrconsts.dlgreport
|
|
msgid "Report"
|
|
msgstr "Report"
|
|
|
|
#: lazarusidestrconsts.dlgreset
|
|
msgctxt "lazarusidestrconsts.dlgreset"
|
|
msgid "Reset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgresetactivedesktopbtncaption
|
|
msgid "Restore active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgresetactivedesktopbtnhint
|
|
msgid "Restore window layout of active desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgresetall
|
|
msgid "Reset all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrightbottomclr
|
|
msgid "Guide lines Right,Bottom"
|
|
msgstr "Farbe für rechts, unten"
|
|
|
|
#: lazarusidestrconsts.dlgrightclickselects
|
|
msgid "Right click selects"
|
|
msgstr "Rechtsklick wählt aus"
|
|
|
|
#: lazarusidestrconsts.dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "Rechter Rand"
|
|
|
|
#: lazarusidestrconsts.dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Arbeitsverzeichnis"
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
|
msgid "Select grandchildren"
|
|
msgstr "Enkel auswählen"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
|
msgid "Rubberband Creation"
|
|
msgstr "Erzeugung"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
|
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
|
msgid "Rubberband Selection"
|
|
msgstr "Auswahl"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"The running Lazarus instance cannot accept any files.\n"
|
|
"Do you want to open them in a new IDE instance?\n"
|
|
"\n"
|
|
"%s"
|
|
msgstr ""
|
|
"Die laufende Lazarus-Instanz akzeptiert keine Dateien.\n"
|
|
"Wollen Sie sie in einer neuen IDE-Instanz öffnen?\n"
|
|
"\n"
|
|
"%s\n"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
|
msgid "Lazarus instance is running but not responding."
|
|
msgstr "Lazarus-Instanz läuft, reagiert aber nicht."
|
|
|
|
#: lazarusidestrconsts.dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Anzeige (nicht bei Win32, beispielsweise 198.112.45.11:0, x.org:1, hydra:0,1)"
|
|
|
|
#: lazarusidestrconsts.dlgrunoenvironment
|
|
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
|
msgid "Environment"
|
|
msgstr "Umgebung"
|
|
|
|
#: lazarusidestrconsts.dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Lokal"
|
|
|
|
#: lazarusidestrconsts.dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Systemvariablen"
|
|
|
|
#: lazarusidestrconsts.dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Display verwenden"
|
|
|
|
#: lazarusidestrconsts.dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Benutzervorgaben"
|
|
|
|
#: lazarusidestrconsts.dlgrunparameters
|
|
msgid "Run Parameters"
|
|
msgstr "Start-Parameter"
|
|
|
|
#: lazarusidestrconsts.dlgrunwithdebug
|
|
msgid "Run uses the debugger (disable for release-mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktop
|
|
msgid "Save current desktop"
|
|
msgstr "Aktiven Desktop speichern"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
|
msgid "Save current desktop as"
|
|
msgstr "Aktuellen Desktop speichern unter"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
|
|
msgid "Save active desktop as ..."
|
|
msgstr "Aktiven Desktop speichert unter ..."
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
|
|
msgid "Save active desktop as"
|
|
msgstr "Aktiven Desktop speichert unter"
|
|
|
|
#: lazarusidestrconsts.dlgsavedlinecolor
|
|
msgid "Saved line"
|
|
msgstr "Gesicherte Zeile"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Editorinformationen für geschlossene Dateien speichern"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
|
msgid "The files are available in the \"Open Recent\" history list."
|
|
msgstr "Die Dateien sind verfügbar in der \"Wieder öffnen\" Liste."
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Editorinformationen nur für Projektdateien speichern"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
|
msgid "Only files that belong to this project."
|
|
msgstr "Nur Dateien, die zu diesem Projekt gehören."
|
|
|
|
#: lazarusidestrconsts.dlgsavein
|
|
msgid "Save in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolfixed
|
|
msgid "Force 1024 columns minimum for horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolnone
|
|
msgid "Do not add any permanent space to horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolpage
|
|
msgid "Always add one page to horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Eine Zeile weniger scrollen"
|
|
|
|
#: lazarusidestrconsts.dlgscrollgroupoptions
|
|
msgid "Scrolling"
|
|
msgstr "Scrolleinstellungen"
|
|
|
|
#: lazarusidestrconsts.dlgscrollhint
|
|
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
|
msgid "Show scroll hint"
|
|
msgstr "Scroll-Hinweise anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Über das Dateiende hinaus scrollen"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendline
|
|
msgid "Allow Caret to move past the end of line"
|
|
msgstr "Über das Zeilenende hinaus scrollen"
|
|
|
|
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
|
#, object-pascal-format
|
|
msgid "Search directory \"%s\" not found."
|
|
msgstr "Suchverzeichnis »%s« nicht gefunden."
|
|
|
|
#: lazarusidestrconsts.dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Suche vom Benutzer abgebrochen"
|
|
|
|
#: lazarusidestrconsts.dlgsearchcaption
|
|
msgid "Searching ..."
|
|
msgstr "Suche ..."
|
|
|
|
#: lazarusidestrconsts.dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Pfade"
|
|
|
|
#: lazarusidestrconsts.dlgsearchscope
|
|
msgid "Search scope"
|
|
msgstr "Suchbereich"
|
|
|
|
#: lazarusidestrconsts.dlgselectallchildcontrols
|
|
msgid "Select all child controls together with their parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectallnoscroll
|
|
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectedtext
|
|
msgid "&Selected text"
|
|
msgstr "Au&sgewählter Text"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
|
|
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
|
|
msgid "Set active"
|
|
msgstr "aktivieren"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
|
|
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
|
|
msgid "Set active"
|
|
msgstr "aktivieren"
|
|
|
|
#: lazarusidestrconsts.dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Alle Elemente auf Voreinstellungen setzen"
|
|
|
|
#: lazarusidestrconsts.dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Element auf die Voreinstellung setzen"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "Eigenschaften-Variable setzen"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
|
msgid "The parameter name for the default setter procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
|
msgid "is prefix"
|
|
msgstr "ist Präfix"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
|
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
|
msgid "use const"
|
|
msgstr "verwende const"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
|
msgid "If checked, the setter parameter is marked with \"const\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowallunits
|
|
msgid "Show all units"
|
|
msgstr "Zeige alle Units"
|
|
|
|
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
|
msgid "Show captions of nonvisual components"
|
|
msgstr "Zeige Titel nichtvisueller Komponenten"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Kompilierte Prozeduren anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Zeilennummern zeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Bedingungen anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Debug-Informationen anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhints
|
|
msgid "Show designer hints"
|
|
msgstr "Zeige Designer-Hinweise"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
|
msgid "Hint shows control's position or size while moving or resizing it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Alles anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Executable-Info anzeigen (nur für Win32)"
|
|
|
|
#: lazarusidestrconsts.dlgshowfilenameincaption
|
|
msgid "Show file name in caption"
|
|
msgstr "Dateiname im Titel anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Allgemeine Informationen anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Leistenhinweise zeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowhint
|
|
msgctxt "lazarusidestrconsts.dlgshowhint"
|
|
msgid "Show hints"
|
|
msgstr "Hinweise zeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowingwindows
|
|
msgid "Showing Windows"
|
|
msgstr "Fensteranzeige"
|
|
|
|
#: lazarusidestrconsts.dlgshowlinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Zeilennummern anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowmessagesicons
|
|
msgid "Show Messages Icons"
|
|
msgstr "Zeige Nachrichten-Icons"
|
|
|
|
#: lazarusidestrconsts.dlgshownotes
|
|
msgid "Show notes"
|
|
msgstr "Notizen anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Versuchte Dateien anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Verwendete Dateien anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgshowwarnings
|
|
msgid "Show warnings"
|
|
msgstr "Warnungen anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
|
msgid "Show single button in TaskBar"
|
|
msgstr "Einzelnen Schalter in der Taskleiste anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
|
msgid "Skip forward class declarations"
|
|
msgstr "\"forward\" Klassendeklarationen überspringen"
|
|
|
|
#: lazarusidestrconsts.dlgslashcommenttab
|
|
msgid "Slash //"
|
|
msgstr "Schrägstriche //"
|
|
|
|
#: lazarusidestrconsts.dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr "Intelligentes Einrücken"
|
|
|
|
#: lazarusidestrconsts.dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Kennung angehängt (.pp~)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Zähler (.pp;1)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Kennung vorangestellt (*.~pp)"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "An Hilfslinien ausrichten"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelineshint
|
|
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
|
msgid "Multiline tabs"
|
|
msgstr "Mehrzeilige Tabs"
|
|
|
|
#: lazarusidestrconsts.dlgspacenotcosmos
|
|
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
|
msgid "Space"
|
|
msgstr "Leerzeichen"
|
|
|
|
#: lazarusidestrconsts.dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Hinweise für die Haupt-Speedbuttons (Öffnen, Speichern, ...)"
|
|
|
|
#: lazarusidestrconsts.dlgsrcedcolorlabelinthesourceareonlyco
|
|
msgid "Label in the source are only colored if the colon \":\" is placed immediately after the label."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsrcedcolormembercolorisappliedtoany
|
|
msgid "\"Member\" color is applied to any identifier behind a dot \".\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Ursprung"
|
|
|
|
#: lazarusidestrconsts.dlgstacksize
|
|
msgid "Stack size"
|
|
msgstr "Stack-Größe"
|
|
|
|
#: lazarusidestrconsts.dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Abbruch nach Fehlerzahl:"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoappend
|
|
msgid "Append text to close string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringautoprefix
|
|
msgid "Prefix string on new line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringbreakindenttab
|
|
msgid "String ''"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringcontalignalignsecondlineafterfirst
|
|
msgid "Align second line (after first break) with the position of the lowest matching group in the pattern, or the match position of the pattern itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringcontalignalignsecondlineregex
|
|
msgid "Align second line (reg-ex):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringcontalignmaxindentforsecondlineifb
|
|
msgid "Max indent for second line if based on reg-ex:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringenableautocontinue
|
|
msgid "Extend strings on linebreak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsubpropcolor
|
|
msgid "SubProperties"
|
|
msgstr "Untereigenschaften"
|
|
|
|
#: lazarusidestrconsts.dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Syntaxeinstellungen"
|
|
|
|
#: lazarusidestrconsts.dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tab rückt ganze Blöcke ein"
|
|
|
|
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
|
msgid "Show tab numbers in notebook"
|
|
msgstr "Reiternummern im Notebook anzeigen"
|
|
|
|
#: lazarusidestrconsts.dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Tabulatoren in Leerzeichen umwandeln"
|
|
|
|
#: lazarusidestrconsts.dlgtabwidths
|
|
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
|
msgid "Tab widths"
|
|
msgstr "Tab-Breite"
|
|
|
|
#: lazarusidestrconsts.dlgtargetcpufamily
|
|
msgid "Target CPU family"
|
|
msgstr "Ziel-CPU-Familie"
|
|
|
|
#: lazarusidestrconsts.dlgtargetos
|
|
msgctxt "lazarusidestrconsts.dlgtargetos"
|
|
msgid "Target OS"
|
|
msgstr "Ziel-Betriebssystem"
|
|
|
|
#: lazarusidestrconsts.dlgtargetplatform
|
|
msgid "Target platform"
|
|
msgstr "Zielplattform"
|
|
|
|
#: lazarusidestrconsts.dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr "Zielprozessor"
|
|
|
|
#: lazarusidestrconsts.dlgtargetspecificoptions
|
|
msgid "Target-specific options"
|
|
msgstr "Zielbetriebssytemspezifische Einstellungen"
|
|
|
|
#: lazarusidestrconsts.dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Verzeichnis für das Anlegen von Testprojekten"
|
|
|
|
#: lazarusidestrconsts.dlgtextstyle
|
|
msgid "Text-Style"
|
|
msgstr "Text-Stil"
|
|
|
|
#: lazarusidestrconsts.dlgtexttofind
|
|
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
|
msgid "Search s&tring"
|
|
msgstr "&Suchtext"
|
|
|
|
#: lazarusidestrconsts.dlgthiselementusescolor
|
|
msgid "The element uses (and edits) the schemes:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr "Debug-Desktop Eigenschaft umschalten"
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr "Debug-Desktop Eigenschaft umschalten"
|
|
|
|
#: lazarusidestrconsts.dlgtopinfohint
|
|
msgid "Current Class/Proc Hint"
|
|
msgstr "Aktueller Klassen-/Prozedurenhinweis"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
|
msgid "Trim spaces style"
|
|
msgstr "Leerzeichenbehandlung"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
|
msgid "Caret or Edit"
|
|
msgstr "bei Wechsel oder Bearbeitung"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
|
msgid "Line Edited"
|
|
msgstr "bei Zeilenbearbeitung"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
|
msgid "Leave line"
|
|
msgstr "beim Zeilenwechsel"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
|
msgid "Position Only"
|
|
msgstr "Nur Position"
|
|
|
|
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Abschneiden von Leerzeichen am Zeilenende"
|
|
|
|
#: lazarusidestrconsts.dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Rücknahme auch nach dem Speichern"
|
|
|
|
#: lazarusidestrconsts.dlgundogroupoptions
|
|
msgid "Undo / Redo"
|
|
msgstr "Einstellungen für Rücknahme"
|
|
|
|
#: lazarusidestrconsts.dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Rücknahmemaximum"
|
|
|
|
#: lazarusidestrconsts.dlgunitdeprefresh
|
|
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
|
msgid "Refresh"
|
|
msgstr "Erneuern"
|
|
|
|
#: lazarusidestrconsts.dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr "Unit-Ausgabeverzeichnis (-FU):"
|
|
|
|
#: lazarusidestrconsts.dlgunsavedlinecolor
|
|
msgid "Unsaved line"
|
|
msgstr "Ungesicherte Zeile"
|
|
|
|
#: lazarusidestrconsts.dlgusecodefolding
|
|
msgid "Code Folding"
|
|
msgstr "Codefaltung"
|
|
|
|
#: lazarusidestrconsts.dlguseconsolebuffer
|
|
msgid "Set Columns/Rows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseconsolepos
|
|
msgid "Set Left/Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseconsolesize
|
|
msgid "Set Width/Height"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusecustomconfig
|
|
msgid "Use additional compiler config file"
|
|
msgstr "Zusätzliche Compiler-Konfigurationsdatei einbinden"
|
|
|
|
#: lazarusidestrconsts.dlgusedividerdraw
|
|
msgid "Divider Drawing"
|
|
msgstr "Trennlinien"
|
|
|
|
#: lazarusidestrconsts.dlgusefpccfg
|
|
msgid "Use standard compiler config file (fpc.cfg)"
|
|
msgstr "Standard-Compilerkonfigurationsdatei (fpc.cfg) einbinden"
|
|
|
|
#: lazarusidestrconsts.dlgusehighlight
|
|
msgid "Use Highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseiconsincompletionbox
|
|
msgid "Icons in code completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Startprogramm verwenden"
|
|
|
|
#: lazarusidestrconsts.dlguseminimumime
|
|
msgid "IME handled by System"
|
|
msgstr "IME vom System gehandhabt"
|
|
|
|
#: lazarusidestrconsts.dlguserschemeerror
|
|
#, object-pascal-format
|
|
msgid "Failed to load user-scheme file %s"
|
|
msgstr "Laden von Benutzer-Schemadatei %s fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.dlguseschemedefaults
|
|
msgid "- Scheme globals -"
|
|
msgstr "- Globale Schemata -"
|
|
|
|
#: lazarusidestrconsts.dlguseschemelocal
|
|
msgid "selected language"
|
|
msgstr "ausgewählte Sprache"
|
|
|
|
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Nutze Syntaxhervorhebung"
|
|
|
|
#: lazarusidestrconsts.dlgusetabshistory
|
|
msgid "Use tab history when closing tabs"
|
|
msgstr "Tabs laut Historie schließen"
|
|
|
|
#: lazarusidestrconsts.dlguseunitcaption
|
|
msgid "Add unit to Uses section"
|
|
msgstr "Verwende eine Unit aus diesem Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgvaluecolor
|
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
|
msgid "Value"
|
|
msgstr "Wert"
|
|
|
|
#: lazarusidestrconsts.dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Compilerausgaben:"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Sichtbare Randleiste"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Sichtbarer rechter Rand"
|
|
|
|
#: lazarusidestrconsts.dlgwholewordsonly
|
|
msgid "&Whole words only"
|
|
msgstr "Nur ganze &Wörter"
|
|
|
|
#: lazarusidestrconsts.dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Breite:"
|
|
|
|
#: lazarusidestrconsts.dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr "Win32-GUI-Anwendung"
|
|
|
|
#: lazarusidestrconsts.dlgwindow
|
|
msgctxt "lazarusidestrconsts.dlgwindow"
|
|
msgid "Window"
|
|
msgstr "Fenster"
|
|
|
|
#: lazarusidestrconsts.dlgwordexceptions
|
|
msgid "Exceptions"
|
|
msgstr "Ausnahmen"
|
|
|
|
#: lazarusidestrconsts.dlgwordspolicies
|
|
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
|
msgid "Words"
|
|
msgstr "Worte"
|
|
|
|
#: lazarusidestrconsts.dlgwrdpreview
|
|
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
|
msgid "Preview"
|
|
msgstr "Vorschau"
|
|
|
|
#: lazarusidestrconsts.dlgwritefpclogo
|
|
msgid "Write FPC logo"
|
|
msgstr "FPC-Logo ausgeben"
|
|
|
|
#: lazarusidestrconsts.drsignoringprojectdebuggersettings
|
|
msgid " (Ignoring project settings below)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoreconverterconfiginses
|
|
msgid "Store converter config in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoredispformatconfiginses
|
|
msgid "Store display formats config in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoreformatterconfiginses
|
|
msgid "Store formatter config in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
|
|
msgid "Store project debugger configs in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthedebuggerbackendselecti
|
|
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthisonlyaffectsdispformats
|
|
msgid "This only affects the display formats below. The settings which formats to use are always stored in the session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
|
|
msgid "This only affects the list of converters below. The settings which list to use are always stored in the session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter
|
|
msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsuseideglobaldispformats
|
|
msgid "Use the IDEs-global display formats"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsuseprojecfdispformats
|
|
msgid "Use the projects display formats"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheidegloballistofconv
|
|
msgid "Use the IDE-Global list of converters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheidegloballistofformatter
|
|
msgid "Use the IDE-Global list of formatters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheprojectlistofconver
|
|
msgid "Use the project list of converters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheprojectlistofformatter
|
|
msgid "Use the project list of formatters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusingidedefaultdebuggerse
|
|
msgid "Using IDE default debugger settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusingselectedidedebuggers
|
|
msgid "Using selected IDE debugger settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Mehrfachselektion nur auf einem Formular möglich."
|
|
|
|
#: lazarusidestrconsts.fdmalignmenu
|
|
msgid "Align ..."
|
|
msgstr "Ausrichtung ..."
|
|
|
|
#: lazarusidestrconsts.fdmdeleteselection
|
|
msgid "Delete Selection"
|
|
msgstr "Auswahl löschen"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorhorizontal
|
|
msgid "Mirror Horizontal"
|
|
msgstr "Waagrecht spiegeln"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorvertical
|
|
msgid "Mirror Vertical"
|
|
msgstr "Senkrecht spiegeln"
|
|
|
|
#: lazarusidestrconsts.fdmorderbackone
|
|
msgid "Back One"
|
|
msgstr "Eins nach hinten"
|
|
|
|
#: lazarusidestrconsts.fdmorderforwardone
|
|
msgid "Forward One"
|
|
msgstr "Eins nach vorne"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetoback
|
|
msgid "Move to Back"
|
|
msgstr "Ganz nach hinten bewegen"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetofront
|
|
msgid "Move to Front"
|
|
msgstr "Ganz nach vorn bewegen"
|
|
|
|
#: lazarusidestrconsts.fdmresetmenu
|
|
msgid "Reset ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsaveformasxml
|
|
msgid "Save Form as XML"
|
|
msgstr "Form im XML-Format speichern"
|
|
|
|
#: lazarusidestrconsts.fdmscalemenu
|
|
msgid "Scale ..."
|
|
msgstr "Skalierung ..."
|
|
|
|
#: lazarusidestrconsts.fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Skalieren"
|
|
|
|
#: lazarusidestrconsts.fdmselectall
|
|
msgctxt "lazarusidestrconsts.fdmselectall"
|
|
msgid "Select All"
|
|
msgstr "Alles auswählen"
|
|
|
|
#: lazarusidestrconsts.fdmsizemenu
|
|
msgid "Size ..."
|
|
msgstr "Größe ..."
|
|
|
|
#: lazarusidestrconsts.fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Größe"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Einstellung: Ans Gitter kleben"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Einstellung: An Hilfslinien ausrichten"
|
|
|
|
#: lazarusidestrconsts.fdmzorder
|
|
msgid "Z-order"
|
|
msgstr "Z-Reihenfolge"
|
|
|
|
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
|
msgid "On Both Sides"
|
|
msgstr "Auf beiden Seiten"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugchangepath
|
|
msgid "Change path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
|
|
msgid "Error: The backend is not configured."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
|
|
msgid "(The configured backend's package is not installed.)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
|
|
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
|
|
msgid "Hint: The backend type is OK, but not the recommended type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
|
|
msgid "Create a new recommended backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugcurrent
|
|
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
|
|
msgid "Current"
|
|
msgstr "Aktuell"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
|
|
msgid "The selected backend uses the external executable:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
|
|
#, object-pascal-format
|
|
msgid "The selected backend requires an external executable: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
|
|
#, object-pascal-format
|
|
msgid "Default for your OS/Arch is: \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugignore
|
|
msgctxt "lazarusidestrconsts.initdlgdebugignore"
|
|
msgid "Ignore"
|
|
msgstr "Übergehen"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugkeepbackend
|
|
msgid "Keep backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugnew
|
|
msgctxt "lazarusidestrconsts.initdlgdebugnew"
|
|
msgid "New"
|
|
msgstr "Neu"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
|
|
msgid "Error: External executable is a directory, not a file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
|
|
msgid "Error: External executable not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
|
|
msgid "Error: External file is not executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
|
|
msgid "Error: No default for external executable found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
|
|
msgid "Error: No external executable specified."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpopupinformation
|
|
#, object-pascal-format
|
|
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
|
|
msgid "Select an existing backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
|
|
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
|
|
#, object-pascal-format
|
|
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackages
|
|
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
|
|
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
|
|
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatesetupok
|
|
msgid "Setup is OK."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstateupdatebackend
|
|
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
|
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
|
msgstr "0 = nein, 1 = Zeichnen einer Trennlinie zwischen zwei Hauptebenen, 2 = Zeichnen von Linien für die ersten beiden Ebenen, ..."
|
|
|
|
#: lazarusidestrconsts.lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Dateien hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Mehrdeutige Basisklasse"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Mehrdeutiger Klassenname"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Mehrdeutiger Unit-Name"
|
|
|
|
#: lazarusidestrconsts.lisa2pancestortype
|
|
msgid "Ancestor type"
|
|
msgstr "Basisklasse"
|
|
|
|
#: lazarusidestrconsts.lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Abhängigkeiten nicht erfüllt"
|
|
|
|
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Klassenname ist bereits belegt"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
|
msgid "Create New Component"
|
|
msgstr "Neue Komponente erzeugen"
|
|
|
|
#: lazarusidestrconsts.lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Abhängigkeit"
|
|
|
|
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
|
|
msgid "Directory for unit file:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pexistingfile2
|
|
#, object-pascal-format
|
|
msgid "Existing file: \"%s\""
|
|
msgstr "Existierende Datei: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "Datei ist bereits vorhanden"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" already exists in the package."
|
|
msgstr "Datei \"%s\" existiert bereits im Package."
|
|
|
|
#: lazarusidestrconsts.lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "Datei ist in Gebrauch"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename2
|
|
msgid "Filename/URL"
|
|
msgstr "Dateiname/URL"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "Keine Unit-Datei"
|
|
|
|
#: lazarusidestrconsts.lisa2picon24x24
|
|
msgid "Icon 24x24:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2picon36x36
|
|
msgid "Icon 36x36:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2picon48x48
|
|
msgid "Icon 48x48:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Ungültige Basisklasse"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
|
msgid "Invalid Circular Dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Ungültiger Klassenname"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "Ungültige Datei"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Ungültiger Dateiname"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Ungültiger Unit-Name"
|
|
|
|
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is not a valid unit name."
|
|
msgstr "\"%s\" ist kein gültiger Unit-Name."
|
|
|
|
#: lazarusidestrconsts.lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Neuer Klassenname"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "Neue Datei"
|
|
|
|
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
#, object-pascal-format
|
|
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
|
msgstr "Kein Package für die Abhängigkeit \"%s\" gefunden.%sBitte wählen Sie ein vorhandenes Package."
|
|
|
|
#: lazarusidestrconsts.lisa2ppackageorproject
|
|
msgid "Package/Project"
|
|
msgstr "Package/Projekt"
|
|
|
|
#: lazarusidestrconsts.lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Name des Reiters zu lang"
|
|
|
|
#: lazarusidestrconsts.lisa2ppalettepage
|
|
msgid "Palette page:"
|
|
msgstr "Palettenseite:"
|
|
|
|
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr "Dateiname verkürzen oder expandieren"
|
|
|
|
#: lazarusidestrconsts.lisa2pshowall
|
|
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Alles anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
|
#, object-pascal-format
|
|
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Die Basisklasse \"%s\" besitzt den selben Namen wie%sdie Unit \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
#, object-pascal-format
|
|
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Der Basisklassenname \"%s\" ist kein gültiger Pascal-Bezeichner."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
|
msgstr "Der Klassenname \"%s\" und der Basisklassenname \"%s\" sind gleich."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
|
msgstr "Der Klassenname \"%s\" ist bereits im%sPackage %s%s enthalten. Datei \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Der Klassename \"%s\" lautet wie der Name der%sder Unit \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Der Klassenname \"%s\" ist kein gültiger Pascal-Bezeichner."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "Die Datei \"%s\" ist Teil des aktuellen Projekts.%sEs ist keine gute Idee, Dateien zwischen Projekten und Packages auszutauschen."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
#, object-pascal-format
|
|
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr "Der Dateiname \"%s\" ist unklar, da für das Package noch kein Verzeichnis voreingestellt ist.%sBitte geben Sie den kompletten Pfad zum Dateinamen mit an."
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Die Maximalversion ist kleiner als die Minimalversion."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
|
#, object-pascal-format
|
|
msgid "The package already has a dependency on the package \"%s\"."
|
|
msgstr "Das Package besitzt bereits eine Abhängigkeit auf \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
|
#, object-pascal-format
|
|
msgid "The page name \"%s\" is too long (max 100 chars)."
|
|
msgstr "Der Name \"%s\" des Reiters ist zu lang (max. 100 Zeichen)."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
|
#, object-pascal-format
|
|
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
|
msgstr "Den Unit-Namen \"%s\" gibt es bereits im Package:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
|
#, object-pascal-format
|
|
msgid "The unitname \"%s\" already exists in this package."
|
|
msgstr "Der Unit-Name \"%s\" ist bereits in diesem Package angelegt."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
|
msgstr "Der Unit-Name \"%s\"%sund der Dateiname \"%s\" unterscheiden sich."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgstr "Der Unit-Name \"%s\" ist gleich wie eine registrierte Komponente.%sSeine Verwendung kann zu heftigen Fehlermeldungen führen."
|
|
|
|
#: lazarusidestrconsts.lisa2punitname
|
|
msgid "Unit name:"
|
|
msgstr "Unit-Name:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Unit-Name ist bereits vorhanden"
|
|
|
|
#: lazarusidestrconsts.lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr "Änderungen verwerfen?"
|
|
|
|
#: lazarusidestrconsts.lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr "Alle Ladevorgänge abbrechen"
|
|
|
|
#: lazarusidestrconsts.lisaborted
|
|
msgid "Aborted"
|
|
msgstr "Abgebrochen"
|
|
|
|
#: lazarusidestrconsts.lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Das Laden des Projekts abbrechen"
|
|
|
|
#: lazarusidestrconsts.lisabout
|
|
msgctxt "lazarusidestrconsts.lisabout"
|
|
msgid "About"
|
|
msgstr "Über"
|
|
|
|
#: lazarusidestrconsts.lisabout2
|
|
#, object-pascal-format
|
|
msgid "About %s"
|
|
msgstr "Über %s"
|
|
|
|
#: lazarusidestrconsts.lisaboutdocumentation
|
|
msgid "Documentation:"
|
|
msgstr "Dokumentation:"
|
|
|
|
#: lazarusidestrconsts.lisaboutide
|
|
msgid "About IDE"
|
|
msgstr "Über die IDE"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "Über Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarusmsg
|
|
#, object-pascal-format
|
|
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
|
|
msgstr "Lizenz: GPL/LGPL. Siehe Lazarus und Free Pascal Quellen für Lizenzdetails.%sLazarus ist eine integrierte Entwicklungsumgebung für das Schreiben grafischer und Konsolenanwendungen mit Free Pascal. Free Pascal ist ein Pascal- und Object Pascal-Compiler, der unter Windows, Linux, macOS, FreeBSD und mehr läuft.%sLazarus ist das fehlende Stück des Puzzles, um Programme für die oben genannten Plattformen in einer Delphi-artigen Umgebung zu entwickeln. Die IDE ist ein RAD-Werkzeug mit einem Formulardesigner.%sFür die Weiterentwicklung von Lazarus brauchen wir zusätzliche Unterstützung."
|
|
|
|
#: lazarusidestrconsts.lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Kann Liste der Mitwirkenden nicht finden"
|
|
|
|
#: lazarusidestrconsts.lisaboutofficial
|
|
msgid "Official:"
|
|
msgstr "Offiziell:"
|
|
|
|
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
#, object-pascal-format
|
|
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
|
|
msgstr "%s darf keine TControls enthalten.%sSie können hier nur nichtvisuelle Komponenten ablegen."
|
|
|
|
#: lazarusidestrconsts.lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr "Danksagung"
|
|
|
|
#: lazarusidestrconsts.lisaction
|
|
msgid "Action:"
|
|
msgstr "Aktion:"
|
|
|
|
#: lazarusidestrconsts.lisactivate
|
|
msgid "Activate"
|
|
msgstr "Aktiviere"
|
|
|
|
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr "Aktiviere die Syntax regulärer Ausdrücke für Text und Ersetzen (sehr ähnlich zu Perl)"
|
|
|
|
#: lazarusidestrconsts.lisactivateselected
|
|
msgid "Activate Selected"
|
|
msgstr "Aktiviere Gewählte"
|
|
|
|
#: lazarusidestrconsts.lisactive
|
|
msgid "Active"
|
|
msgstr "Aktiv"
|
|
|
|
#: lazarusidestrconsts.lisactivefilter
|
|
msgid "Active Filter"
|
|
msgstr "Aktiver Filter"
|
|
|
|
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
|
|
msgid "Add a new separator above selected item"
|
|
msgstr "Neuen Trenner oberhalb des gewählten Elements hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
|
|
msgid "Add a new separator below selected item"
|
|
msgstr "Neuen Trenner unterhalb des gewählten Elements hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefine
|
|
msgid "Add defines simulating Delphi7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefinehint
|
|
msgid "Useful when the code has checks for supported compiler versions"
|
|
msgstr "Hilfreich wenn der Code Überprüfungen der unterstützten Compilerversionen enthält"
|
|
|
|
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
|
#, object-pascal-format
|
|
msgid "Added missing object \"%s\" to pascal source."
|
|
msgstr "Fehlendes Objekt \"%s\" zum Pascal-Quelltext hinzugefügt."
|
|
|
|
#: lazarusidestrconsts.lisaddedpropertysfors
|
|
#, object-pascal-format
|
|
msgid "Added property \"%s\" for %s."
|
|
msgstr "Eigenschaft \"%s\" für %s hinzugefügt."
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8
|
|
msgid "Add -FcUTF8"
|
|
msgstr "-FcUTF8 hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8hint
|
|
msgid "May be needed if source files have non-ansistring literals."
|
|
msgstr "Könnte benötigt werden, falls Quelldateien Nicht-Ansistring-Symbole enthalten."
|
|
|
|
#: lazarusidestrconsts.lisaddfilter
|
|
msgid "Add Filter ..."
|
|
msgstr "Filter hinzufügen ..."
|
|
|
|
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
|
msgid "Addition does not fit the current message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
|
msgid "Addition fits the current message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditions
|
|
msgid "Additions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddkeyworddo
|
|
msgid "Add keyword \"do\""
|
|
msgstr "Schlüsselwort \"do\" hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaddmodifieroverload
|
|
msgid "Add modifier \"overload\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddmodifieroverride
|
|
msgid "Add modifier \"override\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddmodifierreintroduce
|
|
msgid "Add modifier \"reintroduce\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
|
#, object-pascal-format
|
|
msgid "Add new build mode, copying settings from \"%s\""
|
|
msgstr "Fügt neuen Erstellmodus hinzu, Einstellungen kopiert von \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewdiskfiles
|
|
msgid "Add new disk files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewfilesfromfilesystem
|
|
msgid "Add New Files from File System"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewmacro
|
|
msgid "Add new macro"
|
|
msgstr "Neues Makro hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaddnewset
|
|
msgid "Add new set"
|
|
msgstr "Neues Set hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagerequirement
|
|
msgid "Add package requirement?"
|
|
msgstr "Paketabhängigkeit hinzufügen?"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
|
msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)."
|
|
msgstr "Package(s) zur Liste der installierten Packages hinzufügen (in Verbindung mit --build-ide um die IDE zu rekompilieren)"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject2
|
|
msgid "Add package to project"
|
|
msgstr "Package zum Projekt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaddparameterbrackets
|
|
msgid "Add parameter brackets"
|
|
msgstr "Parameter-Klammern hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaddthefollowingfiles
|
|
msgid "Add the following files:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
|
msgid "Add to include search path?"
|
|
msgstr "Zum Include-Suchpfad hinzufügen?"
|
|
|
|
#: lazarusidestrconsts.lisaddtoproject
|
|
#, object-pascal-format
|
|
msgid "Add %s to project?"
|
|
msgstr "%s zum Projekt hinzufügen?"
|
|
|
|
#: lazarusidestrconsts.lisaddtostartupcomponents
|
|
msgid "Add to startup components?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr "Zum Unit-Suchpfad hinzufügen?"
|
|
|
|
#: lazarusidestrconsts.lisaddunitinterfaces
|
|
msgid "Add unit interfaces"
|
|
msgstr "Unit-Interfaces hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaddunitnotrecommended
|
|
msgid "Add unit (not recommended)"
|
|
msgstr "Unit hinzufügen (ist nicht angeraten)"
|
|
|
|
#: lazarusidestrconsts.lisaddvaluetomacro
|
|
#, object-pascal-format
|
|
msgid "Add value to macro %s"
|
|
msgstr "Wert zum Makro %s hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
|
msgid "Add File to Package"
|
|
msgstr "Datei in Package aufnehmen"
|
|
|
|
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
|
msgid "Destination package"
|
|
msgstr "Ziel-Package"
|
|
|
|
#: lazarusidestrconsts.lisaf2pfiletype
|
|
msgid "File type"
|
|
msgstr "Dateityp"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Ungültiges Package"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
|
#, object-pascal-format
|
|
msgid "Invalid package ID: \"%s\""
|
|
msgstr "Ungültige Package-ID: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Package ist schreibgeschützt"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" not found."
|
|
msgstr "Package \"%s\" nicht gefunden."
|
|
|
|
#: lazarusidestrconsts.lisaf2pshowall
|
|
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Alle anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
|
#, object-pascal-format
|
|
msgid "The package %s is read only."
|
|
msgstr "Das Package %s ist schreibgeschützt."
|
|
|
|
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
|
#, object-pascal-format
|
|
msgid "A filter with the name \"%s\" already exists."
|
|
msgstr "Ein Filter mit dem Namen \"%s\" existiert bereits."
|
|
|
|
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
|
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
|
msgstr "Nach Aufräumen (alle oder übliche Dateien) zu Automatisch wechseln"
|
|
|
|
#: lazarusidestrconsts.lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Ausrichtung"
|
|
|
|
#: lazarusidestrconsts.lisallblockslooksok
|
|
msgid "All blocks look ok."
|
|
msgstr "Alle Blöcke sehen gut aus."
|
|
|
|
#: lazarusidestrconsts.lisallbuildmodes
|
|
msgid "<All build modes>"
|
|
msgstr "<Alle Erstellmodi>"
|
|
|
|
#: lazarusidestrconsts.lisallinheritedoptions
|
|
msgid "All inherited options"
|
|
msgstr "Alle übernommenen Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lisalloptions
|
|
#, object-pascal-format
|
|
msgid "All options of FPC%s (\"%s\")"
|
|
msgstr "Alle Optionen von FPC%s (\"%s\")"
|
|
|
|
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr "Suche nach mehrfachen Zeilen erlauben"
|
|
|
|
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
|
msgid "All parameters of this function are already set at this call. Nothing to add."
|
|
msgstr "Alle Parameter dieser Funktion sind bereits eingestellt. Nichts hinzuzufügen."
|
|
|
|
#: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp
|
|
msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
|
#, object-pascal-format
|
|
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
|
msgstr "Die Datei wird neu geöffnet, alle Änderungen an \"%s\"%ssind verloren."
|
|
|
|
#: lazarusidestrconsts.lisalpha
|
|
msgid "Alpha"
|
|
msgstr "Alpha"
|
|
|
|
#: lazarusidestrconsts.lisalreadycontainsthehe
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"%s already contains the help:\n"
|
|
"%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr "Alternativtaste"
|
|
|
|
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr "Alternative Taste (oder 2-Tasten-Kombination)"
|
|
|
|
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
|
msgid "Always convert suggested default file name to lowercase"
|
|
msgstr "Immer den vorgeschlagenen Dateinamen in Kleinbuchstaben umwandeln"
|
|
|
|
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
|
msgid "Always draw selected items focused"
|
|
msgstr "Gewählte Elemente immer fokussiert darstellen"
|
|
|
|
#: lazarusidestrconsts.lisalwaysignore
|
|
msgid "Always ignore"
|
|
msgstr "Immer ignorieren"
|
|
|
|
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
|
msgid "A macro with this name already exists."
|
|
msgstr "Ein Makro mit diesem Namen existiert bereits."
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "Mehrdeutige Datei gefunden"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
#, object-pascal-format
|
|
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
|
msgstr "Doppelte Datei gefunden: \"%s\"%sDiese Datei kann mit \"%s\"%sverwechselt werden. Unklare Datei löschen?"
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
|
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtotopside
|
|
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr "Ankereditor - kein Kontrollelement ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lisanchorenabledhint
|
|
#, object-pascal-format
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr "Eingeschaltet = %s in Anker einfügen"
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttoleftside
|
|
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttorightside
|
|
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttoleftside
|
|
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttorightside
|
|
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorsof
|
|
#, object-pascal-format
|
|
msgid "Anchors of %s"
|
|
msgstr "Anker von %s"
|
|
|
|
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr "Anker der ausgewählten Kontrollelemente"
|
|
|
|
#: lazarusidestrconsts.lisanchortoptobottomside
|
|
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortoptotopside
|
|
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
|
|
#, object-pascal-format
|
|
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
|
msgstr "Ein Fehler trat beim letzten Start während des Ladens von %s auf!%sDas Projekt erneut laden?"
|
|
|
|
#: lazarusidestrconsts.lisappearance
|
|
msgid "Appearance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplicationclassname
|
|
msgid "&Application class name"
|
|
msgstr "&Anwendungsklassenname"
|
|
|
|
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
|
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
|
msgstr "Eine grafische Free-Pascal-Anwendung mit einer GUI unter Verwendung der plattformübergreifenden LCL-Bibliothek."
|
|
|
|
#: lazarusidestrconsts.lisapply
|
|
msgctxt "lazarusidestrconsts.lisapply"
|
|
msgid "Apply"
|
|
msgstr "Übernehmen"
|
|
|
|
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
|
msgid "Apply build flags (-B) to dependencies too."
|
|
msgstr "Build-Flag (-B) für die Abhängigkeiten setzen."
|
|
|
|
#: lazarusidestrconsts.lisapplyconventions
|
|
msgid "Apply conventions"
|
|
msgstr "Konventionen anwenden"
|
|
|
|
#: lazarusidestrconsts.lisapplyconventionshint
|
|
msgid "Adjust name extension and character case for platform and file type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
|
msgid "A project unit can not be used by other packages/projects"
|
|
msgstr "Eine Projekt-Unit kann nicht von anderen Packages/Projekten verwendet werden"
|
|
|
|
#: lazarusidestrconsts.lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr "Randabstand um das Kontrollelement. Die anderen vier Randabstände werden zu diesem Wert addiert."
|
|
|
|
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr "Vor dem Ersetzen immer nachfragen"
|
|
|
|
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
|
msgid "Ask before saving project's session"
|
|
msgstr "Vor dem Speichern der Projekt-Sitzungsinformationen nachfragen"
|
|
|
|
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
|
msgid "Ask for component name after putting it on a designer form."
|
|
msgstr "Nach dem Ablegen auf einem Designer-Fenster nach dem Komponentennamen fragen"
|
|
|
|
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
|
msgid "Ask for file name on new file"
|
|
msgstr "Nach Dateinamen für neue Datei fragen"
|
|
|
|
#: lazarusidestrconsts.lisasknameoncreate
|
|
msgid "Ask name on create"
|
|
msgstr "Komponentennamen beim Neuanlegen abfragen"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheight
|
|
msgid "Automatically adjust IDE main window height"
|
|
msgstr "IDE-Hauptmenü-Höhe automatisch anpassen"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
|
msgid "Show complete component palette"
|
|
msgstr "Zeige komplette Komponentenpalette"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
|
msgid "If component palette spans over more lines, show them all and not only one."
|
|
msgstr "Wenn sich die Komponentenpalette über mehrere Zeilen erstreckt, zeige alle und nicht nur eine."
|
|
|
|
#: lazarusidestrconsts.lisautocompletionoff
|
|
msgid "Auto completion: off"
|
|
msgstr "Auto-Vervollständigung: aus"
|
|
|
|
#: lazarusidestrconsts.lisautocompletionon
|
|
msgid "Auto completion: on"
|
|
msgstr "Auto-Vervollständigung: an"
|
|
|
|
#: lazarusidestrconsts.lisautomarkup
|
|
msgid "Markup and Matches"
|
|
msgstr "Hervorhebung"
|
|
|
|
#: lazarusidestrconsts.lisautomatic
|
|
msgctxt "lazarusidestrconsts.lisautomatic"
|
|
msgid "Automatic"
|
|
msgstr "Automatisch"
|
|
|
|
#: lazarusidestrconsts.lisautomatically
|
|
msgid "Automatically"
|
|
msgstr "Automatisch"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
|
msgid "Automatically convert .lfm files to .lrs resource files"
|
|
msgstr ".lfm-Dateien automatisch in .lrs-Ressourcendateien umwandeln"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
|
msgid "do not complete selection"
|
|
msgstr "Auswahl nicht vervollständigen"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
|
msgid "Automatically invoke after point"
|
|
msgstr "Automatisch nach Punkt aufrufen"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontype
|
|
msgid "Automatically invoke on typing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
|
|
msgid "Only complete if word is longer or equal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
|
|
msgid "Only complete when at end of word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
|
|
msgid "Use completion box delay"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr "Zeilenumbruch"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr "Leerzeichen"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyontab
|
|
msgid "tab"
|
|
msgstr "Tabulator"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr "Wordende"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr "Zeichen nicht hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
|
msgid "Automatically use single possible identifier"
|
|
msgstr "Automatisch einen einfachen Bezeichner verwenden"
|
|
|
|
#: lazarusidestrconsts.lisautomaticfeatures
|
|
msgid "Completion and Hints"
|
|
msgstr "Vervollständigung/Hinweise"
|
|
|
|
#: lazarusidestrconsts.lisautoshowobjectinspector
|
|
msgid "Auto show"
|
|
msgstr "Objektinspektor automatisch anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisavailableforinstallation
|
|
msgid "Available for installation"
|
|
msgstr "Verfügbar für Installation"
|
|
|
|
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
|
msgid "Available project build modes"
|
|
msgstr "Verfügbare Projekt-Erstellmodi"
|
|
|
|
#: lazarusidestrconsts.lisbackupchangedfiles
|
|
msgid "Make backup of changed files"
|
|
msgstr "Sicherung der geänderten Dateien anlegen"
|
|
|
|
#: lazarusidestrconsts.lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Dateisicherung fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lisbackuphint
|
|
msgid "Creates a Backup directory under project directory"
|
|
msgstr "Erzeugt ein Backup-Verzeichnis unterhalb des Projektverzeichnisses"
|
|
|
|
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
|
#, object-pascal-format
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Das Ändern des Package-Namens oder der Version zerstört Abhängigkeiten. Sollen diese Abhängigkeiten ebenfalls geändert werden?%sWählen Sie »Ja«, um alle aufgeführten Abhängigkeiten zu ändern.%sWählen Sie »Übergehen«, um die Abhängigkeiten zu löschen und fortzufahren."
|
|
|
|
#: lazarusidestrconsts.lisbegins
|
|
msgid "begins"
|
|
msgstr "beginnt"
|
|
|
|
#: lazarusidestrconsts.lisbehindrelated
|
|
msgid "Behind related"
|
|
msgstr "nach ähnlichen"
|
|
|
|
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
|
msgid "Be less verbose. Can be given multiple times."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
|
msgid "Be more verbose. Can be given multiple times."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
|
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
|
msgstr "Wird am Besten angezeigt mittels Installation eines HTML-Steuerelements wie turbopoweriprodsgn"
|
|
|
|
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
|
msgid "Always build before run"
|
|
msgstr "Vor dem Start immer neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr "Befehl für Neukompilieren"
|
|
|
|
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr "Beim Neukompilieren des Projekts »Datei kompilieren« aufrufen"
|
|
|
|
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr "Beim Start des Projekts statt dessen »Datei ausführen« aufrufen"
|
|
|
|
#: lazarusidestrconsts.lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr "Befehl ausführen"
|
|
|
|
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
|
msgid "When this file is active in source editor"
|
|
msgstr "Wenn diese Datei im Quelltexteditor aktiv ist ..."
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
|
msgid "Working directory (leave empty for file path)"
|
|
msgstr "Arbeitsverzeichnis (keine Angabe heißt Dateipfad)"
|
|
|
|
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
|
msgid "Bold non default values"
|
|
msgstr "Nicht voreingestellte Werte fett hervorheben"
|
|
|
|
#: lazarusidestrconsts.lisborderspace
|
|
msgid "Border space"
|
|
msgstr "Randbreite"
|
|
|
|
#: lazarusidestrconsts.lisbottom
|
|
msgctxt "lazarusidestrconsts.lisbottom"
|
|
msgid "Bottom"
|
|
msgstr "Unten"
|
|
|
|
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr "Unterer Randabstand, Der Wert wird zum Basis-Randabstand addiert und für den Platz unter dem Element verwendet."
|
|
|
|
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Untere Verankerung"
|
|
|
|
#: lazarusidestrconsts.lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr "Untere Kanten"
|
|
|
|
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Das ist das Geschwistercontrol, an das die Unterseite verankert wurde. Für den Parent leerlassen."
|
|
|
|
#: lazarusidestrconsts.lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr "Gleichmäßig am unteren Rand aufteilen"
|
|
|
|
#: lazarusidestrconsts.lisbrowseandselectacompiler
|
|
msgid "Browse and select a compiler (e.g. ppcx64"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnapply
|
|
msgid "&Apply"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnclose
|
|
msgctxt "lazarusidestrconsts.lisbtnclose"
|
|
msgid "&Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: lazarusidestrconsts.lisbtndlgreplace
|
|
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
|
msgid "&Replace ..."
|
|
msgstr "E&rsetzen ..."
|
|
|
|
#: lazarusidestrconsts.lisbtnfind
|
|
msgid "&Find"
|
|
msgstr "Suchen"
|
|
|
|
#: lazarusidestrconsts.lisbtnquit
|
|
msgctxt "lazarusidestrconsts.lisbtnquit"
|
|
msgid "&Quit"
|
|
msgstr "&Beenden"
|
|
|
|
#: lazarusidestrconsts.lisbtnremove
|
|
msgctxt "lazarusidestrconsts.lisbtnremove"
|
|
msgid "&Remove"
|
|
msgstr "&Löschen"
|
|
|
|
#: lazarusidestrconsts.lisbtnrename
|
|
msgid "&Rename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnreplace
|
|
msgid "&Replace"
|
|
msgstr "E&rsetzen"
|
|
|
|
#: lazarusidestrconsts.lisbuild
|
|
msgctxt "lazarusidestrconsts.lisbuild"
|
|
msgid "Build"
|
|
msgstr "Neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
|
msgid "Build all files of project/package/IDE."
|
|
msgstr "Alle Dateien des Projekts/Packages/IDE kompilieren."
|
|
|
|
#: lazarusidestrconsts.lisbuildcaption
|
|
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
|
msgid "Build"
|
|
msgstr "Neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lisbuilddate
|
|
msgid "Build Date"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildide
|
|
msgid "Build IDE"
|
|
msgstr "IDE erstellen"
|
|
|
|
#: lazarusidestrconsts.lisbuildidewithpackages
|
|
msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option."
|
|
msgstr "IDE mit allen Packages kompilieren. Optionale Compiler-Optionen werden nach den Optionen des verwendeten Build-Modus übergeben und können hier oder mit der Option --opt angegeben werden."
|
|
|
|
#: lazarusidestrconsts.lisbuilding
|
|
msgid "Building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
|
msgid "Building Lazarus failed"
|
|
msgstr "Neukompilieren von Lazarus fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lisbuildmode
|
|
#, object-pascal-format
|
|
msgid "Build Mode: %s"
|
|
msgstr "Erstellmodus: %s"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
|
msgid "Differences between build modes"
|
|
msgstr "Unterschiede zwischen den Erstellmodi"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
|
msgid "Differences from other build modes"
|
|
msgstr "Unterschiede zu anderen Erstellmodi"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffmode
|
|
msgid "Mode:"
|
|
msgstr "Modus:"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodes
|
|
msgid "Build mode"
|
|
msgstr "Erstellmodi"
|
|
|
|
#: lazarusidestrconsts.lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Neues Projekt kompilieren"
|
|
|
|
#: lazarusidestrconsts.lisbuildnumber
|
|
msgid "Build number"
|
|
msgstr "Nummer des Builds"
|
|
|
|
#: lazarusidestrconsts.lisbuildstage
|
|
msgctxt "lazarusidestrconsts.lisbuildstage"
|
|
msgid "Build"
|
|
msgstr "Neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lisbusy
|
|
msgid "Busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbyte
|
|
#, object-pascal-format
|
|
msgid "%s byte"
|
|
msgstr "%s Byte"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr "Laden dieser Komponente abbrechen"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Laden der Unit abbrechen"
|
|
|
|
#: lazarusidestrconsts.liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr "Umbenennen abbrechen"
|
|
|
|
#: lazarusidestrconsts.liscannotcompileproject
|
|
msgid "Cannot compile project"
|
|
msgstr "Kann Projekt nicht kompilieren"
|
|
|
|
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
|
msgid "Cannot copy top level component."
|
|
msgstr "Kann die obere Komponente nicht kopieren"
|
|
|
|
#: lazarusidestrconsts.liscannotcreatefile
|
|
#, object-pascal-format
|
|
msgid "Cannot create file \"%s\""
|
|
msgstr "Kann die Datei \"%s\" nicht anlegen"
|
|
|
|
#: lazarusidestrconsts.liscannotdeletelastmode
|
|
msgid "Cannot delete last mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotexecute
|
|
#, object-pascal-format
|
|
msgid "cannot execute \"%s\""
|
|
msgstr "kann \"%s\" nicht ausführen"
|
|
|
|
#: lazarusidestrconsts.liscannotfind
|
|
#, object-pascal-format
|
|
msgid "Cannot find %s"
|
|
msgstr "Kann %s nicht finden"
|
|
|
|
#: lazarusidestrconsts.liscannotfindexecutable
|
|
#, object-pascal-format
|
|
msgid "cannot find executable \"%s\""
|
|
msgstr "kann ausführbare Datei \"%s\" nicht finden"
|
|
|
|
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
|
#, object-pascal-format
|
|
msgid "Cannot find Lazarus starter:%s%s"
|
|
msgstr "Kann Lazarus-Starter %s%s nicht finden"
|
|
|
|
#: lazarusidestrconsts.liscannotopenform
|
|
#, object-pascal-format
|
|
msgid "Cannot open form \"%s\"."
|
|
msgstr "Kann Formular \"%s\" nicht öffnen."
|
|
|
|
#: lazarusidestrconsts.liscannotsaveform
|
|
#, object-pascal-format
|
|
msgid "Cannot save form \"%s\"."
|
|
msgstr "Kann Formular \"%s\" nicht speichern."
|
|
|
|
#: lazarusidestrconsts.liscannotsubstitutemacros
|
|
#, object-pascal-format
|
|
msgid "Cannot substitute macro \"%s\"."
|
|
msgstr "Kann Makro \"%s\" nicht ersetzen."
|
|
|
|
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
|
msgid "Cannot test the compiler while debugging or compiling."
|
|
msgstr "Kann den Compiler nicht testen während des Debuggens oder Kompilierens."
|
|
|
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr "Kann nur die Klasse von TComponents ändern."
|
|
|
|
#: lazarusidestrconsts.liscantfindavalidppu
|
|
#, object-pascal-format
|
|
msgid "Can't find a valid %s.ppu"
|
|
msgstr "Kann keine gültige %s.ppu finden"
|
|
|
|
#: lazarusidestrconsts.liscaptioncomparefiles
|
|
msgid "Compare files (not for creating patches)"
|
|
msgstr "Dateien vergleichen (nicht zum Erzeugen von Patches)"
|
|
|
|
#: lazarusidestrconsts.liscaptionofactivebuildmode
|
|
msgid "Caption of active build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscbpfiles
|
|
#, object-pascal-format
|
|
msgid "%s (%s files)"
|
|
msgstr "%s (%s Dateien)"
|
|
|
|
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
|
#, object-pascal-format
|
|
msgid "Really delete %s source files%s%s"
|
|
msgstr "%s Quelldateien%s%s wirklich löschen"
|
|
|
|
#: lazarusidestrconsts.lisccdchangeclassof
|
|
#, object-pascal-format
|
|
msgid "Change Class of %s"
|
|
msgstr "Klasse von %s ändern"
|
|
|
|
#: lazarusidestrconsts.lisccdnoclass
|
|
msgid "no class"
|
|
msgstr "keine Klasse"
|
|
|
|
#: lazarusidestrconsts.lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr "Unklarer Compiler"
|
|
|
|
#: lazarusidestrconsts.lisccochecktestdir
|
|
#, object-pascal-format
|
|
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
|
msgstr "Bitte prüfen Sie das Test-Verzeichnis unter %sWerkzeuge -> Einstellungen -> Umgebung -> Dateien -> Verzeichnis für das Anlegen von Testprojekten"
|
|
|
|
#: lazarusidestrconsts.lisccocompilernotanexe
|
|
#, object-pascal-format
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr "Der Compiler »%s« ist keine ausführbare Datei.%sDetails: %s"
|
|
|
|
#: lazarusidestrconsts.lisccocontains
|
|
msgid "contains "
|
|
msgstr "enthält "
|
|
|
|
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr "Ausgabe in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.lisccodatesdiffer
|
|
#, object-pascal-format
|
|
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr "Die Daten der .ppu-Dateien von FPC unterscheiden sich um mehr als eine Stunde.%sDas kann bedeuten, daß sie von zwei verschiedenen Installationen stammen.%sDatei1: %s%sDatei2: %s"
|
|
|
|
#: lazarusidestrconsts.lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr "FEHLER: "
|
|
|
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr "FPC-Unitpfad enthält eine Quelle: "
|
|
|
|
#: lazarusidestrconsts.lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr "Zeilenumbruchzeichen"
|
|
|
|
#: lazarusidestrconsts.lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr "ANMERKUNG: "
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr "Ungültiger Compiler"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr "Ungültiger Suchpfad"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr "Ungültiges Testverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr "Fehlende Unit"
|
|
|
|
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
|
|
#, object-pascal-format
|
|
msgid "RTL unit not found: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr "Mehrere Compilerkonfigurationen gefunden: "
|
|
|
|
#: lazarusidestrconsts.liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr "keine fpc.cfg gefunden"
|
|
|
|
#: lazarusidestrconsts.lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr "Nicht-ASCII"
|
|
|
|
#: lazarusidestrconsts.lisccoppuexiststwice
|
|
#, object-pascal-format
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr "ppu ist zweimal vorhanden: %s, %s"
|
|
|
|
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
|
#, object-pascal-format
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr "Es gibt eine .ppu Datei, die älter als der Compiler ist:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
|
|
#, object-pascal-format
|
|
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoseveralcompilers
|
|
#, object-pascal-format
|
|
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr "Es sind mehrere Free-Pascal-Compiler im Pfad.%s%s%sWurde vergessen, einen alten Compiler zu löschen?"
|
|
|
|
#: lazarusidestrconsts.lisccoskip
|
|
msgctxt "lazarusidestrconsts.lisccoskip"
|
|
msgid "Skip"
|
|
msgstr "Übergehen"
|
|
|
|
#: lazarusidestrconsts.lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr "Sonderzeichen"
|
|
|
|
#: lazarusidestrconsts.lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr "Alle Tests erfolgreich verlaufen."
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr "Kann Testdatei nicht erzeugen"
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
|
#, object-pascal-format
|
|
msgid "Unable to create Test Pascal file \"%s\"."
|
|
msgstr "Kann Test-Pascal-Datei »%s« nicht schreiben."
|
|
|
|
#: lazarusidestrconsts.lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr "ungewöhnliche Zeichen"
|
|
|
|
#: lazarusidestrconsts.lisccowarningcaption
|
|
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
|
msgid "Warning"
|
|
msgstr "Warnung"
|
|
|
|
#: lazarusidestrconsts.lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr "WARNUNG: "
|
|
|
|
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr "Falscher Pfadtrenner"
|
|
|
|
#: lazarusidestrconsts.liscecategories
|
|
msgid "Categories"
|
|
msgstr "Kategorien"
|
|
|
|
#: lazarusidestrconsts.liscecomplexitygroup
|
|
msgid "Complexity"
|
|
msgstr "Komplexität"
|
|
|
|
#: lazarusidestrconsts.lisceconstants
|
|
msgid "Constants"
|
|
msgstr "Konstanten"
|
|
|
|
#: lazarusidestrconsts.lisceemptyblocks
|
|
msgid "Empty blocks"
|
|
msgstr "Leere Blöcke"
|
|
|
|
#: lazarusidestrconsts.lisceemptyclasssections
|
|
msgid "Empty class sections"
|
|
msgstr "Leere Klassensektionen"
|
|
|
|
#: lazarusidestrconsts.lisceemptygroup
|
|
msgid "Empty constructs"
|
|
msgstr "Leere Konstrukte"
|
|
|
|
#: lazarusidestrconsts.lisceemptyprocedures
|
|
msgid "Empty procedures"
|
|
msgstr "Leere Prozeduren"
|
|
|
|
#: lazarusidestrconsts.liscefilter
|
|
msgid "(filter)"
|
|
msgstr "(Filter)"
|
|
|
|
#: lazarusidestrconsts.liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr "Cursor folgen"
|
|
|
|
#: lazarusidestrconsts.lisceisarootcontrol
|
|
msgid "Is a root control"
|
|
msgstr "Ist ein Wurzelelement"
|
|
|
|
#: lazarusidestrconsts.liscelongparamlistcount
|
|
msgid "Parameters count treated as \"many\""
|
|
msgstr "Parameterzahl als \"viele\" behandeln"
|
|
|
|
#: lazarusidestrconsts.liscelongprocedures
|
|
msgid "Long procedures"
|
|
msgstr "Lange Prozeduren"
|
|
|
|
#: lazarusidestrconsts.liscelongproclinecount
|
|
msgid "Line count of procedure treated as \"long\""
|
|
msgstr "Zeilenzählung der Prozedur als »lang« behandeln"
|
|
|
|
#: lazarusidestrconsts.liscemanynestedprocedures
|
|
msgid "Many nested procedures"
|
|
msgstr "Viele geschachtelte Prozeduren"
|
|
|
|
#: lazarusidestrconsts.liscemanyparameters
|
|
msgid "Many parameters"
|
|
msgstr "Viele Parameter"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr "Kategorien anzeigen"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr "Quellknoten anzeigen"
|
|
|
|
#: lazarusidestrconsts.liscenestedproccount
|
|
msgid "Nested procedures count treated as \"many\""
|
|
msgstr "Zählung der geschachtelten Prozeduren als »viele« behandeln"
|
|
|
|
#: lazarusidestrconsts.liscenteralostwindow
|
|
msgid "Center a lost window"
|
|
msgstr "Verschwundenes Fenster zentrieren"
|
|
|
|
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
|
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Kontrollelement waagrecht relativ zum angegebenen Geschwister zentrieren"
|
|
|
|
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
|
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Kontrollelement senkrecht relativ zum angegebenen Geschwister zentrieren"
|
|
|
|
#: lazarusidestrconsts.liscenterform
|
|
msgid "Center Form"
|
|
msgstr "Form zentrieren"
|
|
|
|
#: lazarusidestrconsts.liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Im Fenster zentrieren"
|
|
|
|
#: lazarusidestrconsts.liscenters
|
|
msgid "Centers"
|
|
msgstr "Zentriert"
|
|
|
|
#: lazarusidestrconsts.lisceomode
|
|
msgid "Preferred exhibition mode"
|
|
msgstr "Gewünschter Darstellungsmodus"
|
|
|
|
#: lazarusidestrconsts.lisceomodecategory
|
|
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
|
msgid "Category"
|
|
msgstr "Kategorie"
|
|
|
|
#: lazarusidestrconsts.lisceomodesource
|
|
msgctxt "lazarusidestrconsts.lisceomodesource"
|
|
msgid "Source"
|
|
msgstr "Quelle"
|
|
|
|
#: lazarusidestrconsts.lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Niemals automatisch"
|
|
|
|
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr "Nur im Kategorien-Modus verwendet"
|
|
|
|
#: lazarusidestrconsts.lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "Im Leerlauf"
|
|
|
|
#: lazarusidestrconsts.lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Automatische Aktualisierung"
|
|
|
|
#: lazarusidestrconsts.lisceothergroup
|
|
msgctxt "lazarusidestrconsts.lisceothergroup"
|
|
msgid "Other"
|
|
msgstr "Andere"
|
|
|
|
#: lazarusidestrconsts.lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Aktualisierung"
|
|
|
|
#: lazarusidestrconsts.lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Beim Umschalten von Dateien im Quelltexteditor"
|
|
|
|
#: lazarusidestrconsts.lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr "Prozeduren"
|
|
|
|
#: lazarusidestrconsts.lisceproperties
|
|
msgctxt "lazarusidestrconsts.lisceproperties"
|
|
msgid "Properties"
|
|
msgstr "Properties"
|
|
|
|
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
|
msgid "Published properties without default"
|
|
msgstr "Published-Eigensch. ohne Voreinstell."
|
|
|
|
#: lazarusidestrconsts.lisceshowcodeobserver
|
|
msgid "Show observations about"
|
|
msgstr "Zeige Überwachungen von"
|
|
|
|
#: lazarusidestrconsts.liscestylegroup
|
|
msgctxt "lazarusidestrconsts.liscestylegroup"
|
|
msgid "Style"
|
|
msgstr "Stil"
|
|
|
|
#: lazarusidestrconsts.liscesurrounding
|
|
msgid "Surrounding"
|
|
msgstr "Umgebung"
|
|
|
|
#: lazarusidestrconsts.liscetodos
|
|
msgid "ToDos"
|
|
msgstr "Zu Erledigendes"
|
|
|
|
#: lazarusidestrconsts.liscetypes
|
|
msgid "Types"
|
|
msgstr "Datentypen"
|
|
|
|
#: lazarusidestrconsts.lisceunnamedconstants
|
|
msgid "Unnamed constants"
|
|
msgstr "Unbenannte Konstanten"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedmembers
|
|
msgid "Unsorted members"
|
|
msgstr "Nicht sortierte Mitglieder"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedvisibility
|
|
msgid "Unsorted visibility"
|
|
msgstr "Nicht sortierte Sichtbarkeit"
|
|
|
|
#: lazarusidestrconsts.lisceuses
|
|
msgctxt "lazarusidestrconsts.lisceuses"
|
|
msgid "Uses"
|
|
msgstr "Uses"
|
|
|
|
#: lazarusidestrconsts.liscevariables
|
|
msgid "Variables"
|
|
msgstr "Variablen"
|
|
|
|
#: lazarusidestrconsts.liscewrongindentation
|
|
msgid "Wrong indentation"
|
|
msgstr "Falsche Einrückung"
|
|
|
|
#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
|
|
#, object-pascal-format
|
|
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
|
msgstr "Eine Ausnahme trat auf während des Löschens von%s\"%s:%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
|
msgid "Do not know how to copy this form editing selection"
|
|
msgstr "Ich weiß nicht, wie der ausgewählte Bereich der Formbearbeitung kopiert werden kann."
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
|
msgid "Do not know how to cut this form editing selection"
|
|
msgstr "Ich weiß nicht, wie der ausgewählte Bereich der Formbearbeitung ausgeschnitten werden kann."
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
|
msgid "Do not know how to delete this form editing selection"
|
|
msgstr "Ich weiß nicht, wie der ausgewählte Bereich der Formbearbeitung gelöscht werden kann."
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
|
msgid "Error creating component"
|
|
msgstr "Fehler beim Erzeugen der Komponente"
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
|
#, object-pascal-format
|
|
msgid "Error creating component: %s%s%s"
|
|
msgstr "Fehler beim Erzeugen der Komponente: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
|
msgid "Error destroying component"
|
|
msgstr "Fehler beim Zerstören der Komponente"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
|
#, object-pascal-format
|
|
msgid "Error destroying component of type %s of unit %s:%s%s"
|
|
msgstr "Fehler beim Zerstören der Komponente vom Typ %s der Unit %s:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
|
msgid "Error destroying mediator"
|
|
msgstr "Fehler beim Zerstören des Mediators"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
|
#, object-pascal-format
|
|
msgid "Error destroying mediator %s of unit %s:%s%s"
|
|
msgstr "Fehler beim Zerstören des Mediators %s der Unit %s:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeinfile
|
|
#, object-pascal-format
|
|
msgid "In file %s"
|
|
msgstr "In Datei %s"
|
|
|
|
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
|
msgid "Invalid component owner"
|
|
msgstr "Ungültiger Besitzer der Komponente"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
|
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
|
msgstr "TCustomFormEditor.CreateNonFormForm existiert bereits"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
|
#, object-pascal-format
|
|
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
|
msgstr "TCustomFormEditor.CreateNonFormForm Unbekannter Typ %s"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
|
#, object-pascal-format
|
|
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
|
msgstr "TCustomFormEditor.DeleteComponent Wo ist das TCustomNonFormDesignerForm? %s"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
|
#, object-pascal-format
|
|
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
|
msgstr "TCustomFormEditor.RegisterDesignerMediator ist bereits registriert: %s"
|
|
|
|
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
|
msgstr "Der Komponenteneditor von Klasse \"%s\"hat den Fehler:%s\"%s\" erzeugt"
|
|
|
|
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
|
#, object-pascal-format
|
|
msgid "The component of type %s failed to set its owner to %s:%s"
|
|
msgstr "Die Komponente vom Typ %s konnte ihren Besitzer nicht auf %s:%s setzen"
|
|
|
|
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
|
#, object-pascal-format
|
|
msgid "Unable to clear the form editing selection%s%s"
|
|
msgstr "Ausgewählter Bereich der Formularbearbeitung %s%s kann nicht gelöscht werden"
|
|
|
|
#: lazarusidestrconsts.lischange
|
|
msgctxt "lazarusidestrconsts.lischange"
|
|
msgid "Change"
|
|
msgstr "Ändern"
|
|
|
|
#: lazarusidestrconsts.lischangebuildmode
|
|
msgid "Change build mode"
|
|
msgstr "Erstellmodus ändern"
|
|
|
|
#: lazarusidestrconsts.lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Klasse ändern"
|
|
|
|
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
|
#, object-pascal-format
|
|
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr "Kodierung ändern"
|
|
|
|
#: lazarusidestrconsts.lischangefile
|
|
msgid "Change file"
|
|
msgstr "Datei ändern"
|
|
|
|
#: lazarusidestrconsts.lischangeparent
|
|
msgid "Change Parent"
|
|
msgstr "Elternobjekt ändern"
|
|
|
|
#: lazarusidestrconsts.lischangeswerenotsaved
|
|
msgid "Changes were not saved"
|
|
msgstr "Änderungen wurden nicht gespeichert"
|
|
|
|
#: lazarusidestrconsts.lischangetounix
|
|
msgid "Change to Unix /"
|
|
msgstr "zu Unix / geändert"
|
|
|
|
#: lazarusidestrconsts.lischangetowindows
|
|
msgid "Change to Windows \\"
|
|
msgstr "zu Windows \\ geändert"
|
|
|
|
#: lazarusidestrconsts.lischeckall
|
|
msgid "Check All"
|
|
msgstr "Alle auswählen"
|
|
|
|
#: lazarusidestrconsts.lischeckcompilerpath
|
|
msgid "Please make sure that the path to the compiler in the IDE options is correct."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
|
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
|
|
msgid "Check for disk file changes via content rather than timestamp"
|
|
msgstr "Dateiänderungen eher über den Inhalt als über den Zeitstempel ermitteln"
|
|
|
|
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
|
#, object-pascal-format
|
|
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
|
msgstr ". Prüfen, ob Package %s die %s.ppu erzeugt, nichts prüfen löscht diese Datei und prüft, daß keine zwei Packages Zugriff auf die Unit-Quellen haben."
|
|
|
|
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
|
|
msgid ". Check if package %s is in the dependencies"
|
|
msgstr ". Prüfen, ob Package %s in den Abhängigkeiten ist"
|
|
|
|
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
|
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
|
|
msgstr "prüfen, ob der nächste Token im Quelltext ein End ist und falls nicht, Zeilenende + End; + Zeilenende zurückgeben"
|
|
|
|
#: lazarusidestrconsts.lischeckoptions
|
|
msgid "Check options"
|
|
msgstr "Einstellungen prüfen"
|
|
|
|
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
|
|
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
|
msgstr ". Den Suchpfad von Package %s prüfen, eine saubere Neuerstellung versuchen, die uses-Abschnitte (implementation) prüfen."
|
|
|
|
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
|
|
msgid "Check the next token in source and add a semicolon if needed."
|
|
msgstr "Prüft das nächste Zeichen im Quelltext und ergänzt ein Semikolon falls notwendig."
|
|
|
|
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
|
#, object-pascal-format
|
|
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
|
msgstr "%s Überprüfen Sie das Ziel (OS, CPU, LCL Widgettyp). Vielleicht müssen Sie das Package für dieses Ziel neu kompilieren oder ein anderes Ziel für das Projekt angeben."
|
|
|
|
#: lazarusidestrconsts.lischeckuncheckall
|
|
msgid "Check/uncheck all"
|
|
msgstr "Alle auswählen/abwählen"
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname
|
|
msgctxt "lazarusidestrconsts.lischooseadifferentname"
|
|
msgid "Choose a different name"
|
|
msgstr "Anderen Dateinamen auswählen"
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname2
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lischooseadifferentname2"
|
|
msgid "Choose a different name"
|
|
msgstr "Anderen Dateinamen auswählen"
|
|
|
|
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
|
msgid "Choose a file with CodeTools templates"
|
|
msgstr "Eine Datei mit den CodeTools-Vorlagen auswählen"
|
|
|
|
#: lazarusidestrconsts.lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr "FPDoc-Link wählen"
|
|
|
|
#: lazarusidestrconsts.lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr "Taste auswählen..."
|
|
|
|
#: lazarusidestrconsts.lischooseanameforthecomponent
|
|
msgid "Choose a name for the component"
|
|
msgstr "Einen Namen für die Komponente wählen"
|
|
|
|
#: lazarusidestrconsts.lischooseanexamplefile
|
|
msgid "Choose an example file"
|
|
msgstr "Wählen Sie eine Beispieldatei"
|
|
|
|
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
|
msgid "Choose an FPC message file"
|
|
msgstr "Eine FPC-Nachrichtendatei auswählen"
|
|
|
|
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
|
msgid "Choose a Pascal file for indentation examples"
|
|
msgstr "Geben Sie eine Pascal-Datei für die Einrückungsbeispiele an"
|
|
|
|
#: lazarusidestrconsts.lischoosecompilerexecutable
|
|
#, object-pascal-format
|
|
msgid "Choose compiler executable (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosecompilermessages
|
|
msgid "Choose compiler messages file"
|
|
msgstr "Compiler Meldungen Datei auswählen"
|
|
|
|
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
|
msgid "Choose debugger executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr "Delphi-Package (*.dpk) auswählen"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr "Delphi-Projekt (*.dpr) auswählen"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Delphi-Unit (*.pas) auswählen"
|
|
|
|
#: lazarusidestrconsts.lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Verzeichnis auswählen"
|
|
|
|
#: lazarusidestrconsts.lischooseexecutable
|
|
msgid "Choose an executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "FPC-Quelltextverzeichnis auswählen"
|
|
|
|
#: lazarusidestrconsts.lischoosefppkgconfigurationfile
|
|
msgid "Choose the fppkg configuration file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Lazarus-Verzeichnis auswählen"
|
|
|
|
#: lazarusidestrconsts.lischoosemakeexecutable
|
|
msgid "Choose \"make\" executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosenameandtext
|
|
msgid "Choose name and text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr "Wählen Sie einen dieser Punkte, um eine neue Datei anzulegen"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr "Wählen Sie einen der Einträge, um ein neues Package zu erzeugen"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr "Wählen Sie einen der Einträge, um ein neues Projekt zu generieren"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr "Wählen Sie einen der Einträge aus, um von einem vorhandenen abzuleiten"
|
|
|
|
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Programmquelltext (*.pp, *.pas, *.lpr) auswählen"
|
|
|
|
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Wählen Sie die Struktur um die Auswahl einzuschließen"
|
|
|
|
#: lazarusidestrconsts.lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr "Verzeichnis für Tests auswählen"
|
|
|
|
#: lazarusidestrconsts.liscirculardependencydetected
|
|
msgid "Circular dependency detected"
|
|
msgstr "Zirkuläre Abhängigkeit gefunden"
|
|
|
|
#: lazarusidestrconsts.lisclass
|
|
msgid "&Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclasscompletion
|
|
msgid "Class Completion"
|
|
msgstr "Klassenvervollständigung"
|
|
|
|
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
|
msgid "Classes and properties exist. Values were not checked."
|
|
msgstr "Klassen und Eigenschaften existieren. Werte wurden nicht geprüft."
|
|
|
|
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
|
#, object-pascal-format
|
|
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
|
msgstr "Klasse \"%s\" ist keine registrierte Komponentenklasse.%sKann keine Übernahme durchführen."
|
|
|
|
#: lazarusidestrconsts.lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Klasse nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisclassnotfoundat
|
|
#, object-pascal-format
|
|
msgid "Class %s not found at %s(%s,%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassofmethodnotfound
|
|
#, object-pascal-format
|
|
msgid "Class \"%s\" of method \"%s\" not found."
|
|
msgstr "Klasse \"%s\" der Methode \"%s\" nicht gefunden."
|
|
|
|
#: lazarusidestrconsts.liscldirclean
|
|
msgid "Clean"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr "Verzeichnis säubern"
|
|
|
|
#: lazarusidestrconsts.liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Unterverzeichnisse säubern"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Alle Textdateien behalten"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Dateien, die mit dem Filter übereinstimmen, behalten"
|
|
|
|
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Entfernen der Dateien, auf die der Filter paßt"
|
|
|
|
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Einfache Syntax (z.B. * statt .*)"
|
|
|
|
#: lazarusidestrconsts.liscleanall
|
|
msgid "Clean all"
|
|
msgstr "Alle aufräumen"
|
|
|
|
#: lazarusidestrconsts.liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Lazarus-Quelltext aufräumen"
|
|
|
|
#: lazarusidestrconsts.liscleanonlyonce
|
|
msgid "Switch after building to automatically"
|
|
msgstr "Nach Neukompilierung zu Automatisch wechseln"
|
|
|
|
#: lazarusidestrconsts.liscleanup
|
|
msgid "Clean up"
|
|
msgstr "Aufräumen"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Aufräumen und Kompilieren"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuildproject
|
|
msgid "Clean up and build project"
|
|
msgstr "Aufräumen und Projekt kompilieren"
|
|
|
|
#: lazarusidestrconsts.liscleanuplazbuild
|
|
msgid "Clean up + lazbuild"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanuppackage
|
|
#, object-pascal-format
|
|
msgid "Clean up package \"%s\"."
|
|
msgstr "Package \"%s\" aufräumen."
|
|
|
|
#: lazarusidestrconsts.liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr "Unit-Pfad aufräumen?"
|
|
|
|
#: lazarusidestrconsts.lisclear
|
|
msgctxt "lazarusidestrconsts.lisclear"
|
|
msgid "Clear"
|
|
msgstr "Leeren"
|
|
|
|
#: lazarusidestrconsts.liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr "Verzeichnis leeren?"
|
|
|
|
#: lazarusidestrconsts.lisclearfilter
|
|
msgid "Clear filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclearthefilterforoptions
|
|
msgid "Clear the filter for options"
|
|
msgstr "Filter für Einstellungen zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr "Hier klicken um die Datei zu browsen"
|
|
|
|
#: lazarusidestrconsts.lisclicktoseethechoices
|
|
msgid "Click to see the choices"
|
|
msgstr "Auswahlmöglichkeiten per Klick"
|
|
|
|
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
|
msgid "Click to Select Palette Page"
|
|
msgstr "Klicken um Palettenseite auszuwählen"
|
|
|
|
#: lazarusidestrconsts.lisclone
|
|
msgid "Clone"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclose
|
|
msgctxt "lazarusidestrconsts.lisclose"
|
|
msgid "Close"
|
|
msgstr "S&chließen"
|
|
|
|
#: lazarusidestrconsts.liscloseallchecked
|
|
msgid "Close All Checked"
|
|
msgstr "Alle gewählten schließen"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsclose
|
|
msgid "Close files"
|
|
msgstr "Dateien schließen"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabshide
|
|
msgctxt "lazarusidestrconsts.lisclosealltabshide"
|
|
msgid "Hide window"
|
|
msgstr "Verstecke Fenster"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsquestion
|
|
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
|
msgstr "Ein Quelltextfenster wird geschlossen. Sollen alle Dateien geschlossen oder das Fenster versteckt werden?"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabstitle
|
|
msgid "Close Source Editor Window"
|
|
msgstr "Schließen des Quelltexteditors"
|
|
|
|
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "Schnittstellenspezische Einstellungen der LCL:"
|
|
|
|
#: lazarusidestrconsts.liscmparameter
|
|
msgid "Parameter"
|
|
msgstr "Parameter"
|
|
|
|
#: lazarusidestrconsts.liscmplstcomponents
|
|
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
|
msgid "Components"
|
|
msgstr "Komponenten"
|
|
|
|
#: lazarusidestrconsts.liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr "Vererbung"
|
|
|
|
#: lazarusidestrconsts.liscmplstlist
|
|
msgid "List"
|
|
msgstr "Liste"
|
|
|
|
#: lazarusidestrconsts.liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr "Palette"
|
|
|
|
#: lazarusidestrconsts.liscmppages
|
|
msgid "Pages"
|
|
msgstr "Seiten"
|
|
|
|
#: lazarusidestrconsts.liscmppalettevisible
|
|
msgid "Palette is &visible"
|
|
msgstr "Palette ist sichtbar"
|
|
|
|
#: lazarusidestrconsts.liscmprestoredefaults
|
|
msgid "&Restore defaults"
|
|
msgstr "Vo&rgaben wiederherst."
|
|
|
|
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr "Mehrdeutige zusätzliche Compiler-Konfigurationsdatei"
|
|
|
|
#: lazarusidestrconsts.liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Aufruf an:"
|
|
|
|
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
|
#, object-pascal-format
|
|
msgid "%s%sClick OK if you definitely want to do that."
|
|
msgstr "%s%sKlicken Sie OK, wenn Sie sicher sind."
|
|
|
|
#: lazarusidestrconsts.liscocommand
|
|
msgctxt "lazarusidestrconsts.liscocommand"
|
|
msgid "Command:"
|
|
msgstr "Befehl:"
|
|
|
|
#: lazarusidestrconsts.liscode
|
|
msgid "Code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodebrowser
|
|
msgctxt "lazarusidestrconsts.liscodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Code-Browser"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogcaption
|
|
msgid "Code creation options"
|
|
msgstr "Codeerzeugungseinstellungen"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogclasssection
|
|
msgid "Class section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialoglocation
|
|
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
|
|
msgid "Location"
|
|
msgstr "Position"
|
|
|
|
#: lazarusidestrconsts.liscodegenerationoptions
|
|
msgid "Code generation options"
|
|
msgstr "Einstellungen für Codeerzeugung"
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Neuer Pfad"
|
|
|
|
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
|
msgid "Browse"
|
|
msgstr "Pfadauswahl"
|
|
|
|
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr "Ersetzen bestätigen"
|
|
|
|
#: lazarusidestrconsts.liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr "Hilfepunkt erzeugen"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Pfad entfernen"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdescrtag
|
|
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
|
msgid "Description"
|
|
msgstr "Beschreibung"
|
|
|
|
#: lazarusidestrconsts.liscodehelperrorstag
|
|
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
|
msgid "Errors"
|
|
msgstr "Fehler"
|
|
|
|
#: lazarusidestrconsts.liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Beispiel"
|
|
|
|
#: lazarusidestrconsts.liscodehelpgroupbox
|
|
msgid "FPDoc settings"
|
|
msgstr "FPDoc-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr "Formatzeichen für Fettschrift einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr "Formatzeichen für Code einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr "Formatzeichen für Kursivschrift einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr "Formatzeichen für Kommentar einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr "Formatzeichen für Unterstreichung einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr "Formatzeichen für Var einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinherited
|
|
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
|
msgid "Inherited"
|
|
msgstr "Vererbt"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr "Einen Link einfügen ..."
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr "Absatzformat-Tag einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodehelpmainformcaption
|
|
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
|
msgid "FPDoc Editor"
|
|
msgstr "FPDoc-Editor"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
|
msgid "(no inherited description found)"
|
|
msgstr "(keine abgeleitete Beschreibung gefunden)"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<KEINE>"
|
|
|
|
#: lazarusidestrconsts.liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Siehe auch"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr "Kurzbeschreibung von"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr "Kurz"
|
|
|
|
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
|
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
|
msgid "Ignore constants in next functions"
|
|
msgstr "Übergehe Konstanten in den nächsten Funktionen"
|
|
|
|
#: lazarusidestrconsts.liscodeobscharconst
|
|
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
|
msgid "Search for unnamed char constants"
|
|
msgstr "Suche nach unbenannten Zeichenkonstanten"
|
|
|
|
#: lazarusidestrconsts.liscodeobserver
|
|
msgid "Code Observer"
|
|
msgstr "Codeüberwachung (Code Observer)"
|
|
|
|
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
|
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
|
msgid "Ignore next unnamed constants"
|
|
msgstr "Nächste unbenannte Konstanten übergehen"
|
|
|
|
#: lazarusidestrconsts.liscodetempladd
|
|
msgctxt "lazarusidestrconsts.liscodetempladd"
|
|
msgid "Add template"
|
|
msgstr "Vorlage hinzufügen"
|
|
|
|
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Codevorlage hinzufügen"
|
|
|
|
#: lazarusidestrconsts.liscodetemplautocompleteon
|
|
msgid "Auto complete on"
|
|
msgstr "Automatisches Vervollständigen an ..."
|
|
|
|
#: lazarusidestrconsts.liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Kommentar:"
|
|
|
|
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Code-Vorlage bearbeiten"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerror
|
|
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
|
msgid "Error"
|
|
msgstr "Fehler"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerroralreadyexists
|
|
msgid "A token already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplerroremptyname
|
|
msgid "The token cannot be empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplerrorinvalidname
|
|
msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Token:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsaction
|
|
#, object-pascal-format
|
|
msgid "Action: %s"
|
|
msgstr "Aktion: %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
|
#, object-pascal-format
|
|
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Automatisch erzeugte Einträge können weder bearbeitet werden,%s noch können sie manuelle Untereinträge haben."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
|
#, object-pascal-format
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, automatisch erzeugt"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
|
msgid "Auto generated nodes cannot be edited."
|
|
msgstr "Automatisch angelegte Einträge können nicht bearbeitet werden."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Block"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "Vorschau für CodeTools-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
|
msgid "Compiler path"
|
|
msgstr "Compilerpfad"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Wandle Knoten um"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
|
#, object-pascal-format
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Definitionen für das Verzeichnis %s anlegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Definitionen für den Free Pascal Compiler anlegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
msgid "Create Defines for Free Pascal Git Sources"
|
|
msgstr "Definitionen für Free-Pascal-Git-Quelltexte anlegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
|
#, object-pascal-format
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Defines für das Projekt %s anlegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "FPC-Makros und Pfaden für ein FPC-Projektverzeichnis anlegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Definition"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Rekursion festlegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Knoten löschen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Das %s Hauptverzeichnis,%sin dem Borland alle %s Quellen installiert hat, %sBeispielsweise C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Das %s Hauptverzeichnis,%sin dem Borland alle %s Quellen installiert hat,%sdie von diesem %s Projekt verwendet werden.%sBeispielsweise C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Beschreibung:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
|
#, object-pascal-format
|
|
msgid "%s directory"
|
|
msgstr "%s Verzeichnis"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr "Else"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr "ElseIf"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
|
msgid "FPC Git source directory"
|
|
msgstr "FPC-Git-Quelltextverzeichnis"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr "If"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr "IfNDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Verzeichnis"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Delphi-5-Compilervorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Delphi-5-Verzeichnisvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Delphi-5-Projektvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Delphi-6-Compilervorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Delphi-6-Verzeichnisvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Delphi-6-Projektvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Delphi-7-Compilervorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Delphi-7-Verzeichnisvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Delphi-7-Projektvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Free-Pascal-Compilervorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Free-Pascal-Projektvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
|
msgid "Insert Free Pascal Git Source Template"
|
|
msgstr "Free-Pascal-Git-Quellenverzeichnis einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Kylix 3-Compilervorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Kylix-3-Verzeichnisvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Kylix-3-Projektvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Knoten als Kind einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Knoten darunter einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Vorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Ungültiger Vorfahr"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Ungültiger Elternknoten"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Ungültiger Vorgängerknoten"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "Das %s Hauptverzeichnis%sin dem Borland alle %s Quellen installiert hat,%s.Beispielsweise /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "Das %s Hauptverzeichnis,%sin dem Borland alle %s Quellen installiert hat,%sdie von diesem %s-Projekt verwendet werden.%sBeispielsweise: /home/user/kylix/%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Knoten nach unten bewegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Knoten eine Ebene nach unten bewegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Knoten eine Ebene nach oben bewegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Knoten nach obenbewegen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsname
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
|
msgid "Name:"
|
|
msgstr "Name:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "Neuer Knoten"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Knoten ist schreibgeschützt"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "Nichts ausgewählt"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
|
msgid "Parent node cannot contain child nodes."
|
|
msgstr "Elternknoten kann keine Kindknoten enthalten."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Der vorherige Knoten kann keine Tochterknoten enthalten."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Projektverzeichnis"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
|
#, object-pascal-format
|
|
msgid "%s project directory"
|
|
msgstr "%s Projektverzeichnis"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Gewählter Knoten:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
|
|
msgstr "Das Free-Pascal-Git-Quellverzeichnis. Nicht unbedingt benötigt. Diese Angabe verbessert das Finden von Deklarationen und das Debugging."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "Das Free-Pascal-Projektverzeichnis"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
|
msgid "The Free Pascal Git source directory."
|
|
msgstr "Das Free-Pascal-Git-Quellverzeichnis"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
#, object-pascal-format
|
|
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr "Der Pfad zum Free-Pascal-Compiler.%s Zum Beispiel %s/usr/bin/%s -n%s oder %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
|
|
msgstr "Der Pfad zum Free-Pascal-Compiler für dieses Projekt. Nur benötigt, wenn unten die FPC-Git-Quelle gesetzt ist. Wird verwendet, um Makros automatisch zu erzeugen."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
|
#, object-pascal-format
|
|
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
|
msgstr "Der Pfad zum Free Pascal Compiler für diesen Quellcode.%sWird für die automatische Erzeugung von Makros verwendet."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
|
#, object-pascal-format
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "Das %s Projektverzeichnis,%sdas die .dpr- und dpk-Datei enthält."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "Zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "Alles zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Rekursion zurücknehmen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr "Werte als Dateipfade"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Wert als Text"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
|
#, object-pascal-format
|
|
msgid "%s:%svalue \"%s\" is invalid."
|
|
msgstr "%s:%sWert \"%s\" ist ungültig."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Variable:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr "@"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
|
msgid "Bracket"
|
|
msgstr "Klammer"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscaret
|
|
msgid "Caret (^)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Doppelpunkt"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Komma"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomment
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptscomment"
|
|
msgid "Comment"
|
|
msgstr "Kommentar"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscommentansi
|
|
msgid "ANSI Comment: (*"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscommentbor
|
|
msgid "Curly Comment: {"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscommentslash
|
|
msgid "Slash Comment: //"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Bezeichner"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptskeyword"
|
|
msgid "Keyword"
|
|
msgstr "Schlüsselwort"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Zeilenumbruch"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnone
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
|
msgid "None"
|
|
msgstr "Keine"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Zahl"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Punkt"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Semikolon"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsspace
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
|
msgid "Space"
|
|
msgstr "Leerzeichen"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstring
|
|
msgid "String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "Stringkonstante"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Symbol"
|
|
|
|
#: lazarusidestrconsts.liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Nachher ausführen"
|
|
|
|
#: lazarusidestrconsts.liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Vorher ausführen"
|
|
|
|
#: lazarusidestrconsts.liscollapse
|
|
msgid "Collapse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseall
|
|
msgid "Collapse All [Ctrl+Minus]"
|
|
msgstr "Alle falten [Ctrl+Minus]"
|
|
|
|
#: lazarusidestrconsts.liscollapseall2
|
|
msgid "Collapse All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr "Alle Klassen einfalten"
|
|
|
|
#: lazarusidestrconsts.liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr "Alle Packages einklappen"
|
|
|
|
#: lazarusidestrconsts.liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr "Alle Units einklappen"
|
|
|
|
#: lazarusidestrconsts.liscomboboxes
|
|
msgid "Combo Boxes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandlineparameters
|
|
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
|
msgid "Command line parameters"
|
|
msgstr "Kommandozeilenparameter"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Kommandozeilenparameter des Programms"
|
|
|
|
#: lazarusidestrconsts.liscompile
|
|
msgctxt "lazarusidestrconsts.liscompile"
|
|
msgid "Compile"
|
|
msgstr "Kompilieren"
|
|
|
|
#: lazarusidestrconsts.liscompileanddonotaskagain
|
|
msgid "Compile and do not ask again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilefollowingmodes
|
|
msgid "Compile the following modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilenormally
|
|
msgid "Compile normally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilepackagetwiceandcheckifanyunitwascompiledaga
|
|
msgid "Compile package twice and check if any unit was compiled again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompileproject
|
|
msgid "Compile Project"
|
|
msgstr "Projekt kompilieren"
|
|
|
|
#: lazarusidestrconsts.liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Compiler"
|
|
|
|
#: lazarusidestrconsts.liscompilercfgismissing
|
|
#, object-pascal-format
|
|
msgid "%s is missing."
|
|
msgstr "%s fehlt."
|
|
|
|
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
|
#, object-pascal-format
|
|
msgid "Compiler \"%s\" does not support target %s-%s"
|
|
msgstr "Compiler \"%s\" unterstützt nicht das Ziel %s-%s"
|
|
|
|
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
|
#, object-pascal-format
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Fehler: Ungültiger Compiler: %s"
|
|
|
|
#: lazarusidestrconsts.liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Compilerdateiname"
|
|
|
|
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
|
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgstr "Anmerkung: Sie können den Compilerpfad setzen unter Werkzeuge -> Einstellungen -> Umgebung -> Dateien -> Compilerpfad"
|
|
|
|
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
|
#, object-pascal-format
|
|
msgid "Compiler messages file not found:%s%s"
|
|
msgstr "Compilermeldungen-Datei nicht gefunden:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "Hinweis: CodeTools-Konfigurationsdatei nicht gefunden - verwende Voreinstellungen"
|
|
|
|
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "Hinweis: Lade alte Einstellungsdatei der CodeTools: "
|
|
|
|
#: lazarusidestrconsts.liscompilestage
|
|
msgctxt "lazarusidestrconsts.liscompilestage"
|
|
msgid "Compile"
|
|
msgstr "Kompilieren"
|
|
|
|
#: lazarusidestrconsts.liscompilewithprojectsettings
|
|
msgid "Compile with project settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
|
msgid "Compile with -vd for more details. Check for duplicates."
|
|
msgstr "Kompilieren Sie mit -vd für weitere Details. Prüfen Sie auf Duplikate."
|
|
|
|
#: lazarusidestrconsts.liscompiling
|
|
#, object-pascal-format
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (Kompilieren...)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
|
msgid "Show long line hints"
|
|
msgstr "Lange Zeilen-Hinweise anzeigen"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
|
msgid "Extend far left"
|
|
msgstr "Erweitern (weit links)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
|
msgid "Extend some left"
|
|
msgstr "Erweitern (etwas links)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
|
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
|
msgid "Never"
|
|
msgstr "Nie"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
|
msgid "Extend right only"
|
|
msgstr "Erweitern nur nach rechts"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameiskeyword
|
|
#, object-pascal-format
|
|
msgid "Component name \"%s\" is keyword"
|
|
msgstr "Der Komponentenname \"%s\" ist ein Schlüsselwort"
|
|
|
|
#: lazarusidestrconsts.liscomppalcomponentlist
|
|
msgid "View All"
|
|
msgstr "Alle anzeigen"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Package öffnen"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Unit öffnen"
|
|
|
|
#: lazarusidestrconsts.liscompress
|
|
msgid "Compress"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompresshint
|
|
msgid "The resulting directory will be compressed into a ZIP file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomptest
|
|
msgctxt "lazarusidestrconsts.liscomptest"
|
|
msgid "&Test"
|
|
msgstr "&Test"
|
|
|
|
#: lazarusidestrconsts.liscondition
|
|
msgid "Condition"
|
|
msgstr "Bedingung"
|
|
|
|
#: lazarusidestrconsts.lisconditionals
|
|
msgctxt "lazarusidestrconsts.lisconditionals"
|
|
msgid "Conditionals"
|
|
msgstr "Bedingungen:"
|
|
|
|
#: lazarusidestrconsts.lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Lazarus-Konfigurationsverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisconfigfileofadditions
|
|
msgid "Config file of additions:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuild
|
|
#, object-pascal-format
|
|
msgid "Configure Build %s"
|
|
msgstr "Neukompilieren von %s einrichten"
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\""
|
|
msgstr "\"Lazarus kompilieren\" einstellen"
|
|
|
|
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
|
msgid "Configure Toolbar"
|
|
msgstr "Symbolleiste konfigurieren"
|
|
|
|
#: lazarusidestrconsts.lisconfigurelazaruside
|
|
msgid "Configure Lazarus IDE"
|
|
msgstr "Lazarus-IDE einrichten"
|
|
|
|
#: lazarusidestrconsts.lisconfirm
|
|
msgid "Confirm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmation
|
|
msgid "Confirmation"
|
|
msgstr "Bestätigung"
|
|
|
|
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
|
#, object-pascal-format
|
|
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
|
msgstr "Lazarus wird neu erstellt mit den folgenden Profilen:%sFortsetzen?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr "Änderungen bestätigen"
|
|
|
|
#: lazarusidestrconsts.lisconfirmdelete
|
|
msgid "Confirm delete"
|
|
msgstr "Löschen bestätigen"
|
|
|
|
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
|
#, object-pascal-format
|
|
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
|
msgstr "Wollen Sie Lazarus mit Profil %s neu kompilieren?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr "Bestätigen Sie das neue Package-Set für die IDE"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageaction
|
|
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
|
msgid "Action"
|
|
msgstr "Aktion"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
|
msgid "New package set"
|
|
msgstr "Neues Package-Set"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
|
msgid "Old package set"
|
|
msgstr "Altes Package-Set"
|
|
|
|
#: lazarusidestrconsts.lisconfirmreplace
|
|
msgid "Confirm Replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconflict
|
|
msgid "Conflict"
|
|
msgstr "Konflikt"
|
|
|
|
#: lazarusidestrconsts.lisconflictdetected
|
|
msgid "Conflict detected"
|
|
msgstr "Konflikt festgestellt"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr "Konsolenanwendung"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
|
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
|
msgstr "Ein Free-Pascal-Kommandozeilenprogramm auf Basis von TCustomApplication um unkompliziert Kommandozeilenoptionen zu verwenden, Ausnahmen zu behandeln, etc."
|
|
|
|
#: lazarusidestrconsts.lisconstructorcode
|
|
msgid "Constructor code"
|
|
msgstr "Konstruktor-Code"
|
|
|
|
#: lazarusidestrconsts.liscontains
|
|
msgid "contains"
|
|
msgstr "enthält"
|
|
|
|
#: lazarusidestrconsts.liscontents
|
|
msgctxt "lazarusidestrconsts.liscontents"
|
|
msgid "Contents"
|
|
msgstr "Inhalte"
|
|
|
|
#: lazarusidestrconsts.liscontextsensitive
|
|
msgid "Context sensitive"
|
|
msgstr "Kontextabhängig"
|
|
|
|
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
|
msgid "Continue and do not ask again"
|
|
msgstr "Fortsetzen und nicht mehr nachfragen"
|
|
|
|
#: lazarusidestrconsts.liscontinuebuilding
|
|
msgid "Continue building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr "Fortsetzen das Form zu laden"
|
|
|
|
#: lazarusidestrconsts.liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Mitwirkende"
|
|
|
|
#: lazarusidestrconsts.liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr "Komponente benötigt Vorgänger"
|
|
|
|
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
|
msgid "Add comment after replacement"
|
|
msgstr "Kommentar nach Ersetzung hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
|
|
msgid "Added MODE Delphi syntax modifier after unit name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvaddingflagforregister
|
|
#, object-pascal-format
|
|
msgid "Adding flag for \"Register\" procedure in unit %s."
|
|
msgstr "Füge Flag für \"Register\" Prozedur in Unit %s hinzu."
|
|
|
|
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
|
#, object-pascal-format
|
|
msgid "\")\" is missing from replacement function: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvbracketnotfound
|
|
msgid "Bracket not found"
|
|
msgstr "Klammer nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisconvconvertedfrom
|
|
#, object-pascal-format
|
|
msgid " { *Converted from %s* }"
|
|
msgstr " { *Konvertiert von %s* }"
|
|
|
|
#: lazarusidestrconsts.lisconvcoordhint
|
|
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
|
msgstr "Ein Offset wird zur oberen Koordinate von Steuerelementen in sichtbaren Containern addiert"
|
|
|
|
#: lazarusidestrconsts.lisconvcoordoffs
|
|
msgid "Coordinate offsets"
|
|
msgstr "Koordinaten-Offsets"
|
|
|
|
#: lazarusidestrconsts.lisconvdeletedfile
|
|
#, object-pascal-format
|
|
msgid "Deleted file %s"
|
|
msgstr "Datei %s gelöscht"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
|
#, object-pascal-format
|
|
msgid "Added defines %s in custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
|
#, object-pascal-format
|
|
msgid "Added Package %s as a dependency."
|
|
msgstr "Package %s als Abhängigkeit hinzugefügt."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
|
|
#, object-pascal-format
|
|
msgid "Added unit \"%s\" to uses section."
|
|
msgstr "Unit \"%s\" zum uses-Abschnitt hinzugefügt."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
|
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
|
msgid "All sub-directories will be scanned for unit files"
|
|
msgstr "Alle Unterverzeichnisse werden nach Unit-Dateien durchsucht"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
|
msgid "BeginCodeTools failed!"
|
|
msgstr "BeginCodeTools ist fehlgeschlagen!"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphicategories
|
|
msgid "Categories:"
|
|
msgstr "Kategorien:"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
|
#, object-pascal-format
|
|
msgid "Changed encoding from %s to UTF-8"
|
|
msgstr "Kodierung von %s zu UTF-8 geändert"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
|
msgid "Conversion Aborted."
|
|
msgstr "Konvertierung abgebrochen."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionready
|
|
msgid "Conversion Ready."
|
|
msgstr "Umwandlung ist fertig."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
|
#, object-pascal-format
|
|
msgid "Conversion took: %s"
|
|
msgstr "Konvertierung benötigte: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
|
msgid "Convert Delphi package"
|
|
msgstr "Delphi-Package konvertieren"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
|
msgid "Convert Delphi project"
|
|
msgstr "Delphi-Projekt konvertieren"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
|
msgid "Convert Delphi unit"
|
|
msgstr "Delphi-Unit konvertieren"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
|
msgid "*** Converting unit files found during conversion ***"
|
|
msgstr "*** Wandle die während der Umwandlung gefundenen Unit-Dateien um ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
|
msgid "*** Converting unit files belonging to project/package ***"
|
|
msgstr "*** Wandle zum Projekt/Package gehörende Unit-Dateien um ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphierror
|
|
#, object-pascal-format
|
|
msgid "Error=\"%s\""
|
|
msgstr "Fehler=\"%s\""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
|
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
|
msgstr "Eine Ausnahme ist während der Unitumwandlung aufgetreten. Setze mit Formular-Dateien bereits umgewandelter Units fort..."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
|
msgid "Failed converting unit"
|
|
msgstr "Unitkonvertierung fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
|
#, object-pascal-format
|
|
msgid "Failed to convert unit \"%s\""
|
|
msgstr "Fehler beim Konvertieren der Unit \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
|
#, object-pascal-format
|
|
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
|
msgstr "Zeichenschreibweise von Unit \"%s\" auf \"%s\" korrigiert."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
|
msgid "Found all unit files"
|
|
msgstr "Alle Unit-Dateien gefunden"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifunc
|
|
msgid "Delphi Function"
|
|
msgstr "Delphi Funktion"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
|
#, object-pascal-format
|
|
msgid "%s(%s,%s) missing include file"
|
|
msgstr "%s(%s,%s) fehlende Include-Datei"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiname
|
|
msgid "Delphi Name"
|
|
msgstr "Delphi Name"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
|
msgid "Package name exists"
|
|
msgstr "Package-Name existiert"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
|
#, object-pascal-format
|
|
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
|
msgstr "Package %s wird benötigt, ist aber nicht in Lazarus installiert! Später installieren."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
|
#, object-pascal-format
|
|
msgid "Omitted unit %s from project"
|
|
msgstr "Unit %s aus Projekt entfernt"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
|
|
#, object-pascal-format
|
|
msgid "Removed unit \"%s\" from uses section."
|
|
msgstr "Unit \"%s\" aus dem uses-Abschnitt entfernt."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
|
msgid "*** Fixing used units and Repairing form files ***"
|
|
msgstr "*** Repariere verwendete Units und Formulardateien ... ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
|
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
|
msgstr "Unit \"%s\" mit \"%s\" im uses Abschnitt ersetzt."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
|
#, object-pascal-format
|
|
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
|
msgstr "Es gibt bereits ein Package namens \"%s\"%sBitte schließen sie zuerst dieses Package."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
|
msgid "Unitname exists in LCL"
|
|
msgstr "Unitname existiert in der LCL"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
|
#, object-pascal-format
|
|
msgid "Units to replace in %s"
|
|
msgstr "Units zum Ersetzen in %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
|
#, object-pascal-format
|
|
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
|
msgstr "Die LCL enthält bereits eine Unit namens %s. Lokale Datei %s löschen?"
|
|
|
|
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
|
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
|
msgstr ".dproj-Dateien werden noch nicht unterstützt. Diese Dateien werden von Delphi 2007 und neuer verwendet. Bitte wählen Sie eine .dpr-Datei für Projekte oder eine .dpk-Datei für Packages."
|
|
|
|
#: lazarusidestrconsts.lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr "Konvertierungsfehler"
|
|
|
|
#: lazarusidestrconsts.lisconvert
|
|
msgid "Convert"
|
|
msgstr "Umwandeln"
|
|
|
|
#: lazarusidestrconsts.lisconvertencoding
|
|
msgid "Convert Encoding"
|
|
msgstr "Kodierung umwandeln"
|
|
|
|
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
|
msgid "Convert encoding of projects/packages"
|
|
msgstr "Kodierung von Projekten/Packages umwandeln"
|
|
|
|
#: lazarusidestrconsts.lisconvertotherhint
|
|
msgid "Other options affecting the conversion"
|
|
msgstr "Andere Einstellungen beeinflussen die Umwandlung."
|
|
|
|
#: lazarusidestrconsts.lisconvertprojectorpackage
|
|
msgid "Convert project or package"
|
|
msgstr "Projekt oder Package umwandeln"
|
|
|
|
#: lazarusidestrconsts.lisconverttarget
|
|
msgid "Target"
|
|
msgstr "Ziel"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
|
msgid "Cross-platform"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
|
msgid "Cross-platform versus Windows-only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargethint
|
|
msgid "Converter adds conditional compilation to support different targets"
|
|
msgstr "Der Konverter fügt bedingte Kompilierung zur Unterstützung verschiedener Plattformen hinzu"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
|
msgid "Use the same DFM form file"
|
|
msgstr "Verwende die gleiche DFM Formdatei"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
|
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
|
msgstr "Gleiche DFM-Datei für Lazarus und Delphi anstatt sie in eine LFM zu kopieren"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
|
msgid "Support Delphi"
|
|
msgstr "Delphi unterstützen"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
|
msgid "Use conditional compilation to support Delphi"
|
|
msgstr "Verwende bedingte Kompilierung zur Unterstützung von Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvfixedunitname
|
|
#, object-pascal-format
|
|
msgid "Fixed unit name from %s to %s."
|
|
msgstr "Unitname von %s auf %s berichtigt."
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplacements
|
|
msgid "Function Replacements"
|
|
msgstr "Funktionsersetzungen"
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplhint
|
|
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
|
msgid "Some Delphi functions can be replaced with LCL function"
|
|
msgstr "Einige Delphi Funktionen können mit LCL Funktionen ersetzt werden"
|
|
|
|
#: lazarusidestrconsts.lisconvfuncstoreplace
|
|
msgid "Functions / procedures to replace"
|
|
msgstr "Funktionen / Prozeduren zum Entfernen"
|
|
|
|
#: lazarusidestrconsts.lisconvleftoff
|
|
msgid "Left offset"
|
|
msgstr "Linker Offset"
|
|
|
|
#: lazarusidestrconsts.lisconvnewname
|
|
msgid "New Name"
|
|
msgstr "Neuer Name"
|
|
|
|
#: lazarusidestrconsts.lisconvparentcontainer
|
|
msgid "Parent Container"
|
|
msgstr "Eltern-Container"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
|
#, object-pascal-format
|
|
msgid "Problems when trying to find all units from project file %s"
|
|
msgstr "Probleme beim Finden aller Units aus Projektdatei %s"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
|
#, object-pascal-format
|
|
msgid "Problems when fixing include files in file %s"
|
|
msgstr "Probleme beim Berichtigen der Includedateien in Datei %s"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
|
#, object-pascal-format
|
|
msgid "Problems when repairing form file %s"
|
|
msgstr "Probleme beim Reparieren der Formulardatei %s"
|
|
|
|
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
|
msgid "Repairing include files : "
|
|
msgstr "Repariere Include-Dateien : "
|
|
|
|
#: lazarusidestrconsts.lisconvreplacedcall
|
|
#, object-pascal-format
|
|
msgid "Replaced call %s with %s"
|
|
msgstr "Aufruf %s mit %s ersetzt"
|
|
|
|
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
|
#, object-pascal-format
|
|
msgid "Replacement function parameter number should be >= 1: %s"
|
|
msgstr "Parameternummer der Ersatzfunktion sollte >= 1 sein: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
|
#, object-pascal-format
|
|
msgid "\"$\" should be followed by a number: %s"
|
|
msgstr "auf \"$\" sollte eine Zahl folgen: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
|
msgid "Stopped because there already is a package with the same name"
|
|
msgstr "Gestoppt, weil es bereits ein Package mit dem selben Namen gibt"
|
|
|
|
#: lazarusidestrconsts.lisconvthislogwassaved
|
|
#, object-pascal-format
|
|
msgid "This log was saved to %s"
|
|
msgstr "Dieses Protokoll wurde gespeichert in %s"
|
|
|
|
#: lazarusidestrconsts.lisconvtopoff
|
|
msgid "Top offset"
|
|
msgstr "Oberer Offset"
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplacements
|
|
msgid "Type Replacements"
|
|
msgstr "Ersatz-Datentypen"
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplhint
|
|
msgid "Unknown types in form file (DFM/LFM)"
|
|
msgstr "Unbekannte Typen in Formulardatei (DFM/LFM)"
|
|
|
|
#: lazarusidestrconsts.lisconvtypestoreplace
|
|
msgid "Types to replace"
|
|
msgstr "Zu ersetzende Datentypen"
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplacements
|
|
msgid "Unit Replacements"
|
|
msgstr "Ersatz-Units"
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplhint
|
|
msgid "Unit names in uses section of a source unit"
|
|
msgstr "Unitnamen im uses Abschnitt einer Quelltext-Unit"
|
|
|
|
#: lazarusidestrconsts.lisconvunitstoreplace
|
|
msgid "Units to replace"
|
|
msgstr "Zu ersetzende Units"
|
|
|
|
#: lazarusidestrconsts.lisconvunknownprops
|
|
msgid "Unknown properties"
|
|
msgstr "Unbekannte Eigenschaften"
|
|
|
|
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
|
#, object-pascal-format
|
|
msgid "User selected to end conversion with file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
|
msgid "Add/Config/Delete Toolbar(s)"
|
|
msgstr "Symbolleiste(n) hinzufügen/konfigurieren/löschen"
|
|
|
|
#: lazarusidestrconsts.liscoolbaradddivider
|
|
msgid "Add Divider"
|
|
msgstr "Trenner hinzufügen"
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddselected
|
|
msgid "Add selected item to toolbar"
|
|
msgstr "Gewähltes Element zur Symbolleiste hinzufügen"
|
|
|
|
#: lazarusidestrconsts.liscoolbaravailablecommands
|
|
msgid "Available commands"
|
|
msgstr "Verfügbare Kommandos"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyle
|
|
msgid "Toolbars border style"
|
|
msgstr "Symbolleisten-Umrandungsstil"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
|
msgid "None"
|
|
msgstr "Keine"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
|
msgid "Single"
|
|
msgstr "Einfach"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Code-Explorer"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodetemplates
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
|
msgid "Code Templates"
|
|
msgstr "Quelltextvorlagen"
|
|
|
|
#: lazarusidestrconsts.liscoolbarconfigure
|
|
msgid "&Configure"
|
|
msgstr "Konfigurieren"
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
|
msgid "Are you sure you want to delete the selected toolbar?"
|
|
msgstr "Wollen Sie die ausgewählte Symbolleiste wirklich löschen?"
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletewarning
|
|
msgid "There must be at least one toolbar!"
|
|
msgstr "Es muß wenigstens eine Symbolleiste geben!"
|
|
|
|
#: lazarusidestrconsts.liscoolbardesigner
|
|
msgid "Designer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargeneralsettings
|
|
msgid "General Coolbar Settings"
|
|
msgstr "Allgemeine Coolbar-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyle
|
|
msgid "Toolbars grab style"
|
|
msgstr "Symbolleisten-Griffstil"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
|
msgid "Simple"
|
|
msgstr "Einfach"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
|
msgid "Double"
|
|
msgstr "Doppelt"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
|
msgid "HorLines"
|
|
msgstr "Horizontale Linien"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
|
msgid "VerLines"
|
|
msgstr "Vertikale Linien"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
|
msgid "Gripper"
|
|
msgstr "Greifer"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
|
msgid "Button"
|
|
msgstr "Schaltfläche"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabwidth
|
|
msgid "Grab width"
|
|
msgstr "Griffbreite"
|
|
|
|
#: lazarusidestrconsts.liscoolbaridemainmenu
|
|
msgid "IDE Main Menu"
|
|
msgstr "IDE-Hauptmenü"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmessages
|
|
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
|
msgid "Messages"
|
|
msgstr "Meldungen"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
|
msgid "Move selected toolbar item down"
|
|
msgstr "Gewähltes Symbolleisten-Element nach unten verschieben"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
|
msgid "Move selected toolbar item up"
|
|
msgstr "Gewähltes Symbolleisten-Element nach oben verschieben"
|
|
|
|
#: lazarusidestrconsts.liscoolbaroptions
|
|
msgid "IDE CoolBar"
|
|
msgstr "IDE-CoolBar"
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditor
|
|
msgid "Package Editor"
|
|
msgstr "Package-Editor"
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
|
msgid "Package Editor Files"
|
|
msgstr "Package-Editordateien"
|
|
|
|
#: lazarusidestrconsts.liscoolbarremoveselected
|
|
msgid "Remove selected item from toolbar"
|
|
msgstr "Gewähltes Element aus der Symbolleiste entfernen"
|
|
|
|
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
|
msgid "Restore defaults"
|
|
msgstr "Vorgaben wiederherstellen"
|
|
|
|
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
|
msgid "Please select a toolbar first!"
|
|
msgstr "Bitte wählen Sie zunächst eine Symbolleiste aus!"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourceeditor
|
|
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Quelltexteditor"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourcetab
|
|
msgid "Source Tab"
|
|
msgstr "Quelltext-Tabulator"
|
|
|
|
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
|
msgid "Toolbar commands"
|
|
msgstr "Symbolleisten-Kommandos"
|
|
|
|
#: lazarusidestrconsts.liscoolbarvisible
|
|
msgid "Coolbar is &visible"
|
|
msgstr "Coolbar ist sichtbar"
|
|
|
|
#: lazarusidestrconsts.liscoolbarwidth
|
|
msgid "Coolbar width"
|
|
msgstr "Coolbar-Breite"
|
|
|
|
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
|
msgid "Copy All Items to Clipboard"
|
|
msgstr "Alle Einträge in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
|
msgid "Copy All/Original Messages to Clipboard"
|
|
msgstr "Alle/Originale Nachrichten in Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
|
msgid "Copy All Shown Messages to Clipboard"
|
|
msgstr "Alle gezeigten Meldungen in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.liscopydescription
|
|
msgid "Copy description to clipboard"
|
|
msgstr "Beschreibung in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Kopierfehler"
|
|
|
|
#: lazarusidestrconsts.liscopyfilename
|
|
#, object-pascal-format
|
|
msgid "Copy Filename %s"
|
|
msgstr "Kopiere Dateiname %s"
|
|
|
|
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
|
msgid "Copy File Name to Clipboard"
|
|
msgstr "Dateinamen in Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.liscopyfilesfailed
|
|
msgid "Copying files failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyidentifier
|
|
#, object-pascal-format
|
|
msgid "Copy \"%s\" to clipboard"
|
|
msgstr "Kopiere \"%s\" in die Zwischenablage"
|
|
|
|
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr "Kopieren eines ganzen Formulars ist nicht implementiert"
|
|
|
|
#: lazarusidestrconsts.liscopyitemtoclipboard
|
|
msgid "Copy Item to Clipboard"
|
|
msgstr "Eintrag in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.liscopymovefiletodirectory
|
|
msgid "Copy/Move File to Directory"
|
|
msgstr "Datei in Verzeichnis kopieren/verschieben"
|
|
|
|
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
|
msgid "Copy Selected Items to Clipboard"
|
|
msgstr "Ausgewählte Einträge in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
|
msgid "Copy Selected Messages to Clipboard"
|
|
msgstr "Ausgewählte Meldungen in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Nach FPC-Meldungen durchsuchen"
|
|
|
|
#: lazarusidestrconsts.liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Nach Make-Meldungen durchsuchen"
|
|
|
|
#: lazarusidestrconsts.liscoskipcallingcompiler
|
|
msgid "Skip calling compiler"
|
|
msgstr "Aufruf des Compilers übergehen"
|
|
|
|
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr "Warnung: Die zusätzliche Compilerkonfigurationsdatei besitzt den gleichen Namen wie eine der Standard-Konfigurationsdateien nach denen FPC sucht. Das kann dazu führen, daß NUR diese und nicht die Standard-Datei verwendet wird."
|
|
|
|
#: lazarusidestrconsts.liscpopenpackage
|
|
#, object-pascal-format
|
|
msgid "Open Package %s"
|
|
msgstr "Package %s öffnen"
|
|
|
|
#: lazarusidestrconsts.liscpopenunit
|
|
#, object-pascal-format
|
|
msgid "Open Unit %s"
|
|
msgstr "Unit %s öffnen"
|
|
|
|
#: lazarusidestrconsts.liscpu
|
|
#, object-pascal-format
|
|
msgid ", CPU: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateandedit
|
|
msgid "Create and edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Erzeugen Sie zuerst ein Projekt!"
|
|
|
|
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
|
msgid "Create Debug and Release modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr "Verzeichnis anlegen?"
|
|
|
|
#: lazarusidestrconsts.liscreatefilter
|
|
msgid "Create Filter"
|
|
msgstr "Filter erstellen"
|
|
|
|
#: lazarusidestrconsts.liscreatefppkgconfig
|
|
msgid "Restore Fppkg configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefunction
|
|
msgid "Create function"
|
|
msgstr "Funktion anlegen"
|
|
|
|
#: lazarusidestrconsts.liscreatehelpnode
|
|
msgid "Create Help node"
|
|
msgstr "Hilfe-Knoten anlegen"
|
|
|
|
#: lazarusidestrconsts.liscreateit
|
|
msgid "Create it"
|
|
msgstr "Anlegen"
|
|
|
|
#: lazarusidestrconsts.liscreatelocalvariable
|
|
#, object-pascal-format
|
|
msgid "Create local variable \"%s\""
|
|
msgstr "Erzeuge lokale Variable \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscreatenewaddition
|
|
msgid "Create new addition"
|
|
msgstr "Neue Hinzufügung erstellen"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackage
|
|
msgid "(Create new package)"
|
|
msgstr "(Neues Package erstellen)"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
|
msgid "Create new package component"
|
|
msgstr "Neue Package-Komponente erstellen"
|
|
|
|
#: lazarusidestrconsts.liscreateproject
|
|
msgid "Create project"
|
|
msgstr "Projekt anlegen"
|
|
|
|
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
|
msgid "Create/update .po file when saving a lfm file"
|
|
msgstr ".po-Datei beim Speichern einer .lfm-Datei erstellen/aktualisieren"
|
|
|
|
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
|
#, object-pascal-format
|
|
msgid "Creating file index of FPC sources %s ..."
|
|
msgstr "Erzeuge Datei-Index des FPC-Quelltextverzeichnisses %s ..."
|
|
|
|
#: lazarusidestrconsts.lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Verzeichnis auswählen"
|
|
|
|
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "CodeTools-Verzeichniswerte"
|
|
|
|
#: lazarusidestrconsts.lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Vorlagen definieren"
|
|
|
|
#: lazarusidestrconsts.lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<Keine Variable gewählt>"
|
|
|
|
#: lazarusidestrconsts.lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Vorschau öffnen"
|
|
|
|
#: lazarusidestrconsts.lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Werkzeuge"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariable
|
|
#, object-pascal-format
|
|
msgid "Variable: %s"
|
|
msgstr "Variable: %s"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Variablenname"
|
|
|
|
#: lazarusidestrconsts.lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Vorlagen"
|
|
|
|
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
|
msgid "Update all method signatures"
|
|
msgstr "Alle Methoden-Signaturen aktualisieren"
|
|
|
|
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
|
msgid "Update multiple procedure signatures"
|
|
msgstr "Mehrfache Prozedur-Signaturen aktualisieren"
|
|
|
|
#: lazarusidestrconsts.lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr "Bitte wählen Sie ein Makro aus."
|
|
|
|
#: lazarusidestrconsts.lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr "Code-Makro auswählen"
|
|
|
|
#: lazarusidestrconsts.liscurrentlclwidgetset
|
|
#, object-pascal-format
|
|
msgid "Current LCL widgetset: \"%s\""
|
|
msgstr "Aktuelles LCL-Widgetset: \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscurrentstate
|
|
msgid "Current state: "
|
|
msgstr "Aktueller Status: "
|
|
|
|
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Cursor-Spalte im aktuellem Editor"
|
|
|
|
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Cursor-Zeile im aktuellem Editor"
|
|
|
|
#: lazarusidestrconsts.liscustomopthint
|
|
msgid "These options are passed to the compiler after macros are replaced."
|
|
msgstr "Diese Einstellungen werden direkt an den Compiler geleitet. Makros werden ersetzt und Zeilenumbrüche durch einzelne Leerzeichen ersetzt."
|
|
|
|
#: lazarusidestrconsts.liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "Benutzerdefinierte Einstellungen"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Benutzerdefinierte Einstellungen"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions3
|
|
msgid "Custom Options"
|
|
msgstr "Benutzerdefinierte Einstellungen"
|
|
|
|
#: lazarusidestrconsts.liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr "Benutzerdefiniertes Programm"
|
|
|
|
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
|
msgid "A Custom Free Pascal program."
|
|
msgstr "Ein benutzerdefiniertes Free-Pascal-Programm."
|
|
|
|
#: lazarusidestrconsts.lisdatamodule
|
|
msgid "Data Module"
|
|
msgstr "Datenmodul"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
|
msgid "Breakpoint Evaluation"
|
|
msgstr "Haltepunkt-Auswertung"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
|
msgid "Breakpoint Hit"
|
|
msgstr "Haltepunkt-Treffer"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
|
msgid "Breakpoint Message"
|
|
msgstr "Haltepunkt-Nachricht"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
|
msgid "Breakpoint Stack Dump"
|
|
msgstr "Haltepunkt-Stackauszug"
|
|
|
|
#: lazarusidestrconsts.lisdbgendefaultcolor
|
|
msgid "Default Color"
|
|
msgstr "Vorgabefarbe"
|
|
|
|
#: lazarusidestrconsts.lisdbgenexceptionraised
|
|
msgid "Exception Raised"
|
|
msgstr "Ausnahme ausgelöst"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleload
|
|
msgid "Module Load"
|
|
msgstr "Laden des Moduls"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleunload
|
|
msgid "Module Unload"
|
|
msgstr "Entladen des Moduls"
|
|
|
|
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
|
msgid "Output Debug String"
|
|
msgstr "Ausgabe-Debug-String"
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessexit
|
|
msgid "Process Exit"
|
|
msgstr "Prozess verlassen"
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessstart
|
|
msgid "Process Start"
|
|
msgstr "Prozess starten"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadexit
|
|
msgid "Thread Exit"
|
|
msgstr "Thread verlassen"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadstart
|
|
msgid "Thread Start"
|
|
msgstr "Thread starten"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
|
msgid "Windows Message Posted"
|
|
msgstr "Windows Message geposted"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
|
msgid "Windows Message Sent"
|
|
msgstr "Windows Message abgeschickt"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Kein Debugger angegeben"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr "Haltepunkt trotzdem setzen"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
#, object-pascal-format
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
|
msgstr "Es ist kein Debugger angegeben.%sDas Setzen von Haltepunkten ist wirkungslos solange nicht im Debugger-Einstellungsdialog im Menü ein Debugger festgelegt ist."
|
|
|
|
#: lazarusidestrconsts.lisdebug
|
|
msgctxt "lazarusidestrconsts.lisdebug"
|
|
msgid "Debug"
|
|
msgstr "Debug"
|
|
|
|
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks
|
|
msgid "Confirm to delete all Breakpoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile
|
|
msgid "Confirm to delete Breakpoints in same file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugdialogconfirmdelhistory
|
|
msgid "Confirm to clear History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugdialogconfirmdelwatches
|
|
msgid "Confirm to delete all Watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Debugger"
|
|
|
|
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
#, object-pascal-format
|
|
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
|
|
msgstr "Der Debugger ist auf einen internen Fehler gestoßen.%0:s%0:sSpeichern Sie Ihre Arbeit.%0:sSie können dann \"Stop\" oder \"Reset debugger\" drücken, um die Debug-Sitzung zu beenden."
|
|
|
|
#: lazarusidestrconsts.lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Debugger ungültig"
|
|
|
|
#: lazarusidestrconsts.lisdebugging
|
|
#, object-pascal-format
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (Debuggen...)"
|
|
|
|
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
|
msgid "Automatic typecast for objects"
|
|
msgstr "Automatische Typumwandlung für Objekte"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
|
msgid "Add Exception"
|
|
msgstr "Ausnahme hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Zusätzlicher Suchpfad"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
|
|
msgid "BETA: Allow function calls in watches (if supported by backend)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
|
|
msgid "Automatically close the assembler window, after source not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
|
|
msgid "Automatically set \"use instance class type\" for new watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbackend
|
|
msgid "Debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Haltepunkt"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "Protokoll beim Start löschen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Debugger"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
|
|
msgid "Debugger Backend:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings
|
|
msgid "Debugger dialogs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Allgemeine Debuggereinstellungen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Spezifische Debuggereinstellungen (abhängig vom Typ des Debuggers)"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront
|
|
msgid "Always bring debug-windows (watches, locals) to front when adding items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
|
msgid "Duplicate Exception name"
|
|
msgstr "Doppelte Ausnahmebezeichnung"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
|
|
msgid "Change type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
|
|
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
|
msgid "Enter the name of the exception"
|
|
msgstr "Name der Ausnahme eingeben"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
|
msgid "Event Log"
|
|
msgstr "Ereignisprotokoll"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr "Behandelt von"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr "Vom Debugger behandelt"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr "Vom Programm behandelt"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Diese Ausnahmen übergehen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Sprach-Ausnahmen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
|
msgid "Limit line count to"
|
|
msgstr "Zeilenzählung begrenzen auf"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
|
msgid "Module"
|
|
msgstr "Modul"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmname
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
|
|
msgid "Name:"
|
|
msgstr "Name:"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
|
msgid "Notify on Exceptions"
|
|
msgstr "Bei Lazarus-Ausnahmen benachrichtigen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr "Betriebssystem-Ausnahmen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr "Ausgabe"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Prozeß"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
|
msgid "Reset Debugger after each run"
|
|
msgstr "Debugger nach jedem Lauf zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
|
|
msgid "Show message on stop with Error (Exit-code <> 0)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Meldung beim Anhalten anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Signale"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Thread"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
|
|
#, object-pascal-format
|
|
msgid "Unknown Debugger backend \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
|
msgid "Use event log colors"
|
|
msgstr "Ereignisprotokollfarben verwenden"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
|
|
msgid "-- Use IDE default Debugger --"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
|
|
msgid "-- Use project Debugger --"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
|
msgid "Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Datei kann nicht geladen werden"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
|
#, object-pascal-format
|
|
msgid "Unable to load file \"%s\"."
|
|
msgstr "Datei \"%s\" kann nicht geladen werden."
|
|
|
|
#: lazarusidestrconsts.lisdefault
|
|
msgctxt "lazarusidestrconsts.lisdefault"
|
|
msgid "Default"
|
|
msgstr "Voreinstellung"
|
|
|
|
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
|
|
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
|
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultplaceholder
|
|
msgid "(default)"
|
|
msgstr "(Vorgabe)"
|
|
|
|
#: lazarusidestrconsts.lisdefaultsectionofmethods
|
|
msgid "Default section of methods"
|
|
msgstr "Vorgabe-Abschnitt der Methoden"
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionbox
|
|
msgid "Delay for completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
|
msgid "Delay for long line hints in completion box"
|
|
msgstr "Verzögerung für lange Zeilenhinweise in Vervollständigungsbox"
|
|
|
|
#: lazarusidestrconsts.lisdelayforhints
|
|
msgid "Delay for hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelete2
|
|
msgid "Delete?"
|
|
msgstr "Löschen?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteaddition
|
|
#, object-pascal-format
|
|
msgid "Delete addition \"%s\"?"
|
|
msgstr "Hinzufügung \"%s\" löschen?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr "Alle &löschen"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Alle diese Dateien löschen?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Mehrdeutige Datei löschen?"
|
|
|
|
#: lazarusidestrconsts.lisdeletemacro
|
|
#, object-pascal-format
|
|
msgid "Delete macro \"%s\"?"
|
|
msgstr "Lösche Makro \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeletemode
|
|
#, object-pascal-format
|
|
msgid "Delete mode \"%s\""
|
|
msgstr "Lösche Modus \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile
|
|
#, object-pascal-format
|
|
msgid "Delete old file \"%s\"?"
|
|
msgstr "Alte Datei \"%s\" löschen?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedmacro
|
|
msgid "Delete selected macro?"
|
|
msgstr "Ausgewähltes Makro löschen?"
|
|
|
|
#: lazarusidestrconsts.lisdeletethisaddition
|
|
msgid "Delete this addition"
|
|
msgstr "Diese Hinzufügung löschen"
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue
|
|
#, object-pascal-format
|
|
msgid "Delete value \"%s\"?"
|
|
msgstr "Wert \"%s\" löschen?"
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue2
|
|
#, object-pascal-format
|
|
msgid "Delete value %s"
|
|
msgstr "Lösche Wert %s"
|
|
|
|
#: lazarusidestrconsts.lisdelimiterissemicolon
|
|
msgid "Delimiter is semicolon."
|
|
msgstr "Trenner ist Semikolon."
|
|
|
|
#: lazarusidestrconsts.lisdelphicompatibleresources
|
|
msgid "Delphi compatible resources. Recommended."
|
|
msgstr "Delphi-kompatible Ressourcen. Empfohlen."
|
|
|
|
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
|
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
|
msgstr "\"Entwicklungszeit\"-Packages fügen Komponenten und Menüeinträge zur IDE hinzu. Sie können von Projekten benutzt werden, aber nicht in das Projekt kompiliert werden. Der Compiler wird Units dieses Packages nicht finden, während das Projekt kompiliert wird."
|
|
|
|
#: lazarusidestrconsts.lisdesktops
|
|
msgid "Desktops ..."
|
|
msgstr "Desktops ..."
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Zielverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisdestructorcode
|
|
msgid "Destructor code"
|
|
msgstr "Destruktor-Code"
|
|
|
|
#: lazarusidestrconsts.lisdfileswererenamedtol
|
|
#, object-pascal-format
|
|
msgid "%d files were renamed to lowercase."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Schreibweise übergehen"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile1
|
|
msgid "File1"
|
|
msgstr "Datei1"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile2
|
|
msgid "File2"
|
|
msgstr "Datei2"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Zufügen und Löschen leerer Zeilen übergehen"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Unterschiedliche Zeilenenden (z.B. #10 = #13#10) übergehen"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Zahl der Leerzeichen übergehen"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Leerzeichen übergehen (Zeilenumbruchzeichen nicht enthalten)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Leerzeichen am Ende der Zeile übergehen"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Leerzeichen am Beginn der Zeile übergehen"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Nur Auswahl"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
|
msgid "Open difference in editor"
|
|
msgstr "Öffne Vergleich im Editor"
|
|
|
|
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
|
#, object-pascal-format
|
|
msgid "different unit %s found at new position \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectives
|
|
msgid "Directives"
|
|
msgstr "Anweisungen"
|
|
|
|
#: lazarusidestrconsts.lisdirectivesfornewunit
|
|
msgid "Directives for new unit"
|
|
msgstr "Direktiven für neue Unit"
|
|
|
|
#: lazarusidestrconsts.lisdirectories
|
|
msgid "Directories"
|
|
msgstr "Verzeichnisse"
|
|
|
|
#: lazarusidestrconsts.lisdirectory
|
|
msgid "Directory: "
|
|
msgstr "Verzeichnis: "
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound
|
|
#, object-pascal-format
|
|
msgid "Directory \"%s\" not found."
|
|
msgstr "Verzeichnis \"%s\" nicht gefunden."
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound2
|
|
#, object-pascal-format
|
|
msgid "directory %s not found"
|
|
msgstr "Verzeichnis %s nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
|
msgid "Directory where the IDE puts the .po files"
|
|
msgstr "Verzeichnis wo die IDE die .po-Dateien ablegt"
|
|
|
|
#: lazarusidestrconsts.lisdisablei18nforlfm
|
|
msgid "Disable I18N for LFM"
|
|
msgstr "i18n für .lfm-Dateien ausschalten"
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg
|
|
msgid "Disable Option -Xg?"
|
|
msgstr "Option -Xg deaktivieren?"
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg2
|
|
msgid "Disable option -Xg"
|
|
msgstr "Option -Xg deaktivieren"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Änderungen verwerfen"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesall
|
|
msgid "Discard all changes"
|
|
msgstr "Alle Änderungen verwerfen"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
|
msgid "Discard changes and open project"
|
|
msgstr "Änderungen verwerfen und Projekt öffnen"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandquit
|
|
msgid "Discard changes and quit"
|
|
msgstr "Änderungen verwerfen und beenden"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
|
msgid "Discard changes, create new project"
|
|
msgstr "Änderungen verwerfen, neues Projekt erzeugen"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Klicken Sie auf einen der obigen Einträge, um den Vergleich anzuzeigen"
|
|
|
|
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
|
#, object-pascal-format
|
|
msgid "Error reading file: %s"
|
|
msgstr "Fehler beim Lesen der Datei: %s"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
|
|
msgid "Ignore all disk changes"
|
|
msgstr "Änderungen auf Platte ignorieren"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
|
|
msgid "Reload checked files from disk"
|
|
msgstr "Geänderte Dateien neu laden"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Dateien auf dem Datenträger wurden geändert:"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
|
|
msgid "Some files have local changes. Either local or external changes will be overwritten."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr "Groß- und Kleinschreibung unterscheiden"
|
|
|
|
#: lazarusidestrconsts.lisdlgalloptions
|
|
msgid "All options ..."
|
|
msgstr "Alle Einstellungen ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgchangeclass
|
|
msgid "Change Class ..."
|
|
msgstr "Klasse ändern ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgdefines
|
|
msgid "Defines ..."
|
|
msgstr "Definitionen ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgedit
|
|
msgctxt "lazarusidestrconsts.lisdlgedit"
|
|
msgid "Edit ..."
|
|
msgstr "Bearbeiten ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgexport
|
|
msgctxt "lazarusidestrconsts.lisdlgexport"
|
|
msgid "Export ..."
|
|
msgstr "Export ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgimport
|
|
msgctxt "lazarusidestrconsts.lisdlgimport"
|
|
msgid "Import ..."
|
|
msgstr "Import ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgmore
|
|
msgctxt "lazarusidestrconsts.lisdlgmore"
|
|
msgid "More ..."
|
|
msgstr "Mehr ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgopen
|
|
msgctxt "lazarusidestrconsts.lisdlgopen"
|
|
msgid "Open ..."
|
|
msgstr "Öffnen ..."
|
|
|
|
#: lazarusidestrconsts.lisdoesnotexists
|
|
#, object-pascal-format
|
|
msgid "%s does not exist: %s"
|
|
msgstr "%s nicht verfügbar: %s"
|
|
|
|
#: lazarusidestrconsts.lisdonotchange
|
|
msgid "Do not change"
|
|
msgstr "unverändert"
|
|
|
|
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
|
msgid "Do not check if another IDE instance is already running."
|
|
msgstr "Nicht prüfen, ob eine andere Lazarus-Instanz bereits läuft."
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr "Schließen Sie das Projekt nicht"
|
|
|
|
#: lazarusidestrconsts.lisdonotcompiledependencies
|
|
msgid "Do not compile dependencies."
|
|
msgstr "Abhängigkeiten nicht kompilieren."
|
|
|
|
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen."
|
|
msgstr "Startbildschirm nicht anzeigen."
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
|
msgid "Do not show this dialog for this project"
|
|
msgstr "Zeige diesen Dialog nicht für dieses Projekt"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
|
msgid "Do not show this message again"
|
|
msgstr "Diese Nachricht nicht mehr anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
|
|
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonwloadonlinepackages
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"The following package(s) are not available locally: %s.\n"
|
|
"In order to install it, you must download them first. Download now?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdown
|
|
msgctxt "lazarusidestrconsts.lisdown"
|
|
msgid "Down"
|
|
msgstr "Hinunter"
|
|
|
|
#: lazarusidestrconsts.lisdowngrade
|
|
msgid "Downgrade"
|
|
msgstr "Zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.lisdowngradeconfiguration
|
|
msgid "Downgrade configuration"
|
|
msgstr "Konfiguration zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.lisdownload
|
|
msgid "Download"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
|
msgid "Do you still want to create the new project?"
|
|
msgstr "Wollen Sie das neue Projekt immer noch erzeugen?"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
|
msgid "Do you still want to open another project?"
|
|
msgstr "Wollen Sie immer noch ein anderes Projekt öffnen?"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
|
msgid "Do you still want to quit?"
|
|
msgstr "Wollen Sie wirklich beenden?"
|
|
|
|
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
|
msgid "Draw grid lines"
|
|
msgstr "Gitterlinien zeichnen"
|
|
|
|
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
|
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdropdowncount
|
|
msgid "Drop Down Count"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdropdowncounthint
|
|
msgid "Used for all ComboBoxes in IDE dialogs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Ausgewählte Komponenten in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Ausgewählte Komponenten in die Zwischenablage ausschneiden"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr "Komponente um eins nach hinten bewegen"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr "Komponente um eins nach vorn bewegen"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr "Komponente nach hinten bewegen"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr "Komponente nach vorn bewegen"
|
|
|
|
#: lazarusidestrconsts.lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Ausgewählte Komponenten aus der Zwischenablage einfügen"
|
|
|
|
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Elternkomponente auswählen"
|
|
|
|
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
|
|
msgid "Show nonvisual components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
|
|
msgid "Toggle showing nonvisual components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicate
|
|
msgid "Duplicate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateentry
|
|
msgid "Duplicate entry"
|
|
msgstr "Doppelter Eintrag"
|
|
|
|
#: lazarusidestrconsts.lisduplicatefilename
|
|
msgid "Duplicate File Name"
|
|
msgstr "Doppelter Dateiname"
|
|
|
|
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
|
#, object-pascal-format
|
|
msgid "Duplicate found of value \"%s\"."
|
|
msgstr "Duplikat des Werts \"%s\" gefunden."
|
|
|
|
#: lazarusidestrconsts.lisduplicatemodename
|
|
#, object-pascal-format
|
|
msgid "Mode \"%s\" is already present in the list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatename
|
|
msgid "Duplicate Name"
|
|
msgstr "Doppelter Name"
|
|
|
|
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
#, object-pascal-format
|
|
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
|
msgstr "Doppelter Name: Eine Komponente namens \"%s\" existiert bereits in der ererbten Komponente %s"
|
|
|
|
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
|
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr "Doppelte .ppu-Dateien. Löschen sie eine oder stellen sie die richtige Reihenfolge ihrer Suchpfade sicher (Hinweis: FPC verwendet den letzten Pfad zuerst)."
|
|
|
|
#: lazarusidestrconsts.lisduplicatesearchpath
|
|
msgid "Duplicate search path"
|
|
msgstr "Suchpfad duplizieren"
|
|
|
|
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
|
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr "Doppelte Quelldateien. Löschen sie eine oder stellen sie die richtige Reihenfolge ihrer Suchpfade sicher (Hinweis: FPC verwendet den letzten Pfad zuerst)."
|
|
|
|
#: lazarusidestrconsts.lisduplicateunit
|
|
msgid "Duplicate Unit"
|
|
msgstr "Doppelte Unit"
|
|
|
|
#: lazarusidestrconsts.lisduplicateunitin
|
|
#, object-pascal-format
|
|
msgid "Duplicate unit \"%s\" in \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollin
|
|
msgid "Amount to scroll in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
|
|
msgid "Amount to scroll in (%)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
|
|
msgid "Amount to scroll in (Max)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
|
|
msgid "Auto Scroll on delete past left border"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
|
|
msgid "Auto Scroll on type past right border"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
|
|
msgid "Trigger on min chars (% of width)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
|
|
msgid "Trigger on min chars visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedit
|
|
msgctxt "lazarusidestrconsts.lisedit"
|
|
msgid "Edit"
|
|
msgstr "Bearbeiten"
|
|
|
|
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
|
msgid "Edit additional help for messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditbuildmodes
|
|
msgid "Edit build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditcontexthelp
|
|
msgid "Edit context help"
|
|
msgstr "Kontexthilfe bearbeiten"
|
|
|
|
#: lazarusidestrconsts.lisedithelp
|
|
msgid "Edit help"
|
|
msgstr "Hilfe bearbeiten"
|
|
|
|
#: lazarusidestrconsts.liseditkey
|
|
msgid "Edit Key"
|
|
msgstr "Taste zuweisen"
|
|
|
|
#: lazarusidestrconsts.liseditorcolors
|
|
msgid "Editor Colors"
|
|
msgstr "Editorfarben"
|
|
|
|
#: lazarusidestrconsts.liseditormacros
|
|
msgctxt "lazarusidestrconsts.liseditormacros"
|
|
msgid "Editor Macros"
|
|
msgstr "Editormakros"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbar
|
|
msgid "Editor ToolBar"
|
|
msgstr "Editor-Symbolleiste"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarsettings
|
|
msgid "Editor Toolbar Settings"
|
|
msgstr "Editor-Symbolleisten-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarvisible
|
|
msgid "Editor Toolbar is &visible"
|
|
msgstr "Editor-Symbolleiste ist sichtbar"
|
|
|
|
#: lazarusidestrconsts.lisedoptsloadascheme
|
|
msgid "Load a scheme"
|
|
msgstr "Ein Schema laden"
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Aktuelles Projekt"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Ein gültiges Werkzeug benötigt wenigstens einen Namen und eine auszuführende Datei."
|
|
|
|
#: lazarusidestrconsts.lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Werkzeug bearbeiten"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolkey
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
|
msgid "Key"
|
|
msgstr "Taste"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolmacros
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
|
msgid "Macros"
|
|
msgstr "Makros"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parameter:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr "Programmdateiname:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
msgid "Scan output for FPC messages"
|
|
msgstr "Ausgabe nach Free Pascal-Compilermeldungen durchsuchen"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
|
msgid "Scan output for \"make\" messages"
|
|
msgstr "Ausgabe nach Make-Meldungen durchsuchen"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Titel und Dateiname benötigt"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Arbeitsverzeichnis:"
|
|
|
|
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
|
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdall
|
|
msgctxt "lazarusidestrconsts.lisemdall"
|
|
msgid "All"
|
|
msgstr "Alle"
|
|
|
|
#: lazarusidestrconsts.lisemdemptymethods
|
|
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
|
msgid "Empty Methods"
|
|
msgstr "Leere Methoden"
|
|
|
|
#: lazarusidestrconsts.lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr "Leere Methoden gefunden:"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclass
|
|
msgid "No class"
|
|
msgstr "Keine Klasse"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclassat
|
|
#, object-pascal-format
|
|
msgid "No class at %s(%s,%s)"
|
|
msgstr "Keine Klasse bei %s(%s,%s)"
|
|
|
|
#: lazarusidestrconsts.lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr "Nur Published"
|
|
|
|
#: lazarusidestrconsts.lisemdpublic
|
|
msgid "Public"
|
|
msgstr "Public"
|
|
|
|
#: lazarusidestrconsts.lisemdpublished
|
|
msgid "Published"
|
|
msgstr "Published"
|
|
|
|
#: lazarusidestrconsts.lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr "Methoden entfernen"
|
|
|
|
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr "In diesen Klassenbereichen suchen:"
|
|
|
|
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
|
#, object-pascal-format
|
|
msgid "Unable to show empty methods of the current class, because%s%s"
|
|
msgstr "Kann keine leeren Methoden der aktuellen Klasse anzeigen weil%s%s"
|
|
|
|
#: lazarusidestrconsts.lisempty
|
|
msgid "Empty"
|
|
msgstr "Leer"
|
|
|
|
#: lazarusidestrconsts.lisemptydestinationforpublishing
|
|
msgid "Destination directory for publishing is either a relative path or empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenabledonlyforpackages
|
|
msgid "Enabled only for packages."
|
|
msgstr "Nur für Packages aktiviert."
|
|
|
|
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
|
#, object-pascal-format
|
|
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablei18nforlfm
|
|
msgid "Enable I18N for LFM"
|
|
msgstr "i18n für .lfm-Dateien einschalten"
|
|
|
|
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
|
msgid "Enable internationalization and translation support"
|
|
msgstr "Unterstützung für Internationalisierung und Übersetzung aktivieren"
|
|
|
|
#: lazarusidestrconsts.lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Makros einschalten"
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf2
|
|
msgid "Enable Dwarf 2 (-gw)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf2sets
|
|
msgid "Enable Dwarf 2 with sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf3
|
|
msgid "Enable Dwarf 3 (-gw3)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableoptionxg
|
|
msgid "Enable Option -Xg?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
|
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
|
|
msgstr "Aktivieren = drücken von Enter ersetzt den ganzen Bezeichner und Shift+Enter ersetzt den Präfix, Deaktivieren = drücken von Enter ersetzt denPräfix und Shift+Enter ersetzt den ganzen Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lisencloseinifdef
|
|
msgid "Enclose in $IFDEF"
|
|
msgstr "In $IFDEF einschließen"
|
|
|
|
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
|
#, object-pascal-format
|
|
msgid "Number of files failed to convert: %d"
|
|
msgstr "Anzahl der nicht konvertierten Dateien: %d"
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
|
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
|
msgstr "Die Kodierung der Datei \"%s\"%sauf dem Datenträger ist %s. Neue Kodierung ist %s."
|
|
|
|
#: lazarusidestrconsts.lisenternewnameformacros
|
|
#, object-pascal-format
|
|
msgid "Enter new name for Macro \"%s\""
|
|
msgstr "Neuen Namen für Makro \"%s\" eingeben"
|
|
|
|
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
|
msgid "Environment variable, name as parameter"
|
|
msgstr "Umgebungsvariable, Name als Parameter"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Ungültiger Debuggerdateiname"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
|
#, object-pascal-format
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "Die Debugger-Datei »%s« ist nicht ausführbar."
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
|
#, object-pascal-format
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Testverzeichnis »%s« nicht gefunden."
|
|
|
|
#: lazarusidestrconsts.liserrinvalidoption
|
|
#, object-pascal-format
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr "Ungültige Einstellung bei %d: »%s«"
|
|
|
|
#: lazarusidestrconsts.liserrnooptionallowed
|
|
#, object-pascal-format
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr "Die Einstellung an %d erlaubt keinen Parameter: %s"
|
|
|
|
#: lazarusidestrconsts.liserroptionneeded
|
|
#, object-pascal-format
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr "Die Einstellung an %d benötigt einen Parameter: %s"
|
|
|
|
#: lazarusidestrconsts.liserror
|
|
msgid "Error: "
|
|
msgstr "Fehler: "
|
|
|
|
#: lazarusidestrconsts.liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Fehler beim Erzeugen der Datei"
|
|
|
|
#: lazarusidestrconsts.liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Fehler beim Löschen der Datei"
|
|
|
|
#: lazarusidestrconsts.liserrorin
|
|
#, object-pascal-format
|
|
msgid "Error in %s"
|
|
msgstr "Fehler in %s"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
|
msgid "Error in the compiler file name:"
|
|
msgstr "Fehler im Compilerdateinamen:"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
|
msgid "Error in the custom compiler options (Other):"
|
|
msgstr "Fehler in den benutzerdefinierten Compilereinstellungen (Andere):"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
|
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
|
msgstr "Fehler in den benutzerdefinierten Linkereinstellungen (Linken / Einstellungen an Linker übergeben):"
|
|
|
|
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
|
msgid "Error in the \"Debugger path addition\":"
|
|
msgstr "Fehler im \"Zusätzlichen Debuggerpfad\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
|
msgid "Error in the search path for \"Include files\":"
|
|
msgstr "Fehler im Suchpfad für \"Include-Dateien\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
|
msgid "Error in the search path for \"Libraries\":"
|
|
msgstr "Fehler im Suchpfad für \"Bibliotheken\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
|
msgid "Error in the search path for \"Object files\":"
|
|
msgstr "Fehler im Suchpfad für \"Object files\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
|
msgid "Error in the search path for \"Other sources\":"
|
|
msgstr "Fehler im Suchpfad für \"Andere Quellen\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
|
msgid "Error in the search path for \"Other unit files\":"
|
|
msgstr "Fehler im Suchpfad für \"Andere Units\":"
|
|
|
|
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
|
msgid "Error in the \"unit output directory\":"
|
|
msgstr "Fehler im \"Unit-Ausgabeverzeichnis\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
|
#, object-pascal-format
|
|
msgid "Error: invalid build mode \"%s\""
|
|
msgstr "Fehler: Ungültiger Erstellmodus \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr "Fehler beim Dateiladen"
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile2
|
|
#, object-pascal-format
|
|
msgid "Error loading file \"%s\":"
|
|
msgstr "Fehler beim Laden von \"%s\":"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr "Fehler beim Verschieben der Komponente"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent2
|
|
#, object-pascal-format
|
|
msgid "Error moving component %s:%s"
|
|
msgstr "Fehler beim Verschieben der Komponente %s:%s"
|
|
|
|
#: lazarusidestrconsts.liserrornamingcomponent
|
|
msgid "Error naming component"
|
|
msgstr "Fehler beim Benennen der Komponente"
|
|
|
|
#: lazarusidestrconsts.liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr "Fehler beim Öffnen der Komponente"
|
|
|
|
#: lazarusidestrconsts.liserroropeningform
|
|
msgid "Error opening form"
|
|
msgstr "Fehler beim Öffnen des Formulars"
|
|
|
|
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr "Fehler beim Parsen des lfm-Komponenten-Streams."
|
|
|
|
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
|
#, object-pascal-format
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr "Fehler beim Lesen der Package-Liste aus der Datei%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr "Fehler beim XML-Lesen"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxmlfile
|
|
#, object-pascal-format
|
|
msgid "Error reading xml file \"%s\"%s%s"
|
|
msgstr "Fehler beim Lesen der .xml-Datei \"%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Fehler beim Umbenennen der Datei"
|
|
|
|
#: lazarusidestrconsts.liserrors
|
|
msgctxt "lazarusidestrconsts.liserrors"
|
|
msgid "Errors"
|
|
msgstr "Fehler"
|
|
|
|
#: lazarusidestrconsts.liserrors2
|
|
#, object-pascal-format
|
|
msgid ", Errors: %s"
|
|
msgstr ", Fehler: %s"
|
|
|
|
#: lazarusidestrconsts.liserrorsavingform
|
|
msgid "Error saving form"
|
|
msgstr "Fehler beim Speichern des Formulars"
|
|
|
|
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
|
#, object-pascal-format
|
|
msgid "Error setting the name of a component %s to %s"
|
|
msgstr "Fehler beim Festlegen des Names einer Komponente %s zu %s"
|
|
|
|
#: lazarusidestrconsts.liserrorwritingfile
|
|
#, object-pascal-format
|
|
msgid "Error writing file \"%s\""
|
|
msgstr "Fehler beim Schreiben der Datei \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
|
#, object-pascal-format
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr "Fehler beim Schreiben der Package-Liste in die Datei%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liseverynthlinenumber
|
|
msgid "Show every n-th line number"
|
|
msgstr "Zeige jede n-te Zeile:"
|
|
|
|
#: lazarusidestrconsts.lisexamplefile
|
|
msgid "Example file:"
|
|
msgstr "Beispieldatei:"
|
|
|
|
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
#, object-pascal-format
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr "Beispiele:%sBezeichner%sTMyEnum.Enum%sUnitname.Bezeichner%s#PackageName.UnitName.Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lisexclude
|
|
msgid "Exclude"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludedatruntime
|
|
#, object-pascal-format
|
|
msgid "%s excluded at run time"
|
|
msgstr "%s zur Laufzeit ausgenommen"
|
|
|
|
#: lazarusidestrconsts.lisexcludesforstars
|
|
msgid "Excludes for * and ** in unit and include search paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutableisadirectory
|
|
#, object-pascal-format
|
|
msgid "executable \"%s\" is a directory"
|
|
msgstr "ausführbare Datei \"%s\" ist ein Verzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
|
#, object-pascal-format
|
|
msgid "executable \"%s\" lacks the permission to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecuteafter
|
|
msgid "Execute After"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutebefore
|
|
msgid "Execute Before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Ausführung beendet"
|
|
|
|
#: lazarusidestrconsts.lisexecutionstoppedexitcode
|
|
#, object-pascal-format
|
|
msgid "Execution stopped with exit-code %1:d ($%2:s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexit
|
|
msgctxt "lazarusidestrconsts.lisexit"
|
|
msgid "Exit"
|
|
msgstr "Beenden"
|
|
|
|
#: lazarusidestrconsts.lisexitcode
|
|
#, object-pascal-format
|
|
msgid "Exit code %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpand
|
|
msgid "Expand"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandall
|
|
msgid "Expand All [Ctrl+Plus]"
|
|
msgstr "Alle ausklappen [Ctrl+Plus]"
|
|
|
|
#: lazarusidestrconsts.lisexpandall2
|
|
msgid "Expand All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr "Alle Klassen ausklappen"
|
|
|
|
#: lazarusidestrconsts.lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr "Alle Packages ausklappen"
|
|
|
|
#: lazarusidestrconsts.lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr "Alle Units ausklappen"
|
|
|
|
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Vollständiger Name der Datei im aktuellen Editor"
|
|
|
|
#: lazarusidestrconsts.lisexport
|
|
msgctxt "lazarusidestrconsts.lisexport"
|
|
msgid "Export"
|
|
msgstr "Export ..."
|
|
|
|
#: lazarusidestrconsts.lisexportall
|
|
msgid "Export all"
|
|
msgstr "Alle exportieren"
|
|
|
|
#: lazarusidestrconsts.lisexportallitemstofile
|
|
msgid "Export All Items to File"
|
|
msgstr "Alle Elemente in Datei exportieren"
|
|
|
|
#: lazarusidestrconsts.lisexportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
|
msgid "Export environment options"
|
|
msgstr "Umgebungseinstellungen exportieren"
|
|
|
|
#: lazarusidestrconsts.lisexporthtml
|
|
msgid "Export as HTML"
|
|
msgstr "Als HTML exportieren"
|
|
|
|
#: lazarusidestrconsts.lisexportimport
|
|
msgid "Export / Import"
|
|
msgstr "Export / Import"
|
|
|
|
#: lazarusidestrconsts.lisexportpackagelistxml
|
|
msgid "Export package list"
|
|
msgstr "Package-Liste exportieren"
|
|
|
|
#: lazarusidestrconsts.lisexportselected
|
|
msgid "Export selected"
|
|
msgstr "Ausgewählte exportieren"
|
|
|
|
#: lazarusidestrconsts.lisexportsub
|
|
msgid "Export >>"
|
|
msgstr "Export >>"
|
|
|
|
#: lazarusidestrconsts.lisextract
|
|
msgid "Extract"
|
|
msgstr "Extrahieren"
|
|
|
|
#: lazarusidestrconsts.lisextractprocedure
|
|
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
|
msgid "Extract Procedure"
|
|
msgstr "Prozedur extrahieren"
|
|
|
|
#: lazarusidestrconsts.lisextraopts
|
|
msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextremelyverbose
|
|
msgid "Extremely Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolexternaltools
|
|
msgid "External Tools"
|
|
msgstr "Externe Werkzeuge"
|
|
|
|
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Maximale Zahl von Werkzeugen erreicht"
|
|
|
|
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
|
#, object-pascal-format
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Es gibt eine Obergrenze von %s Werkzeugen."
|
|
|
|
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
|
#, object-pascal-format
|
|
msgid "Failed to add %d not unique resource(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
|
#, object-pascal-format
|
|
msgid "Failed to create Application Bundle for \"%s\""
|
|
msgstr "Erzeugung des Anwendungsbundle für \"%s\" fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
|
msgid "Failed to load fold state"
|
|
msgstr "Laden des Status des Faltens fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
|
msgid "failed to resolve macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtosavefile
|
|
msgid "Failed to save file."
|
|
msgstr "Speichern der Datei fehlgeschlagen."
|
|
|
|
#: lazarusidestrconsts.lisfatal
|
|
msgctxt "lazarusidestrconsts.lisfatal"
|
|
msgid "Fatal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfile
|
|
msgctxt "lazarusidestrconsts.lisfile"
|
|
msgid "File"
|
|
msgstr "Datei"
|
|
|
|
#: lazarusidestrconsts.lisfile2
|
|
msgid "File: "
|
|
msgstr "Datei: "
|
|
|
|
#: lazarusidestrconsts.lisfilealreadyexists
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr "Dateiendung des Programms"
|
|
|
|
#: lazarusidestrconsts.lisfilefilter
|
|
msgid "File filter"
|
|
msgstr "Dateifilter"
|
|
|
|
#: lazarusidestrconsts.lisfilefilters
|
|
msgid "File Filters"
|
|
msgstr "Dateifilter"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersaddrow
|
|
msgid "Add Row"
|
|
msgstr "Zeile hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
|
msgid "Delete Row"
|
|
msgstr "Zeile löschen"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
|
msgid "Insert Row"
|
|
msgstr "Zeile einfügen"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersmask
|
|
msgid "File mask"
|
|
msgstr "Dateimaske"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
|
msgid "Set defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilterstitle
|
|
msgid "These are file filters that will appear in all File Open dialogs"
|
|
msgstr "Diese Dateifilter erscheinen in allen 'Datei öffnen'-Dialogen"
|
|
|
|
#: lazarusidestrconsts.lisfilefound
|
|
msgid "File found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilehaschangedsave
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" has changed. Save?"
|
|
msgstr "Datei \"%s\" wurde geändert. Speichern?"
|
|
|
|
#: lazarusidestrconsts.lisfilehasnoproject
|
|
msgid "File has no project"
|
|
msgstr "Datei gehört zu keinem Projekt"
|
|
|
|
#: lazarusidestrconsts.lisfileisdirectory
|
|
msgid "File is directory"
|
|
msgstr "Datei ist Verzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisfileisnotanexecutable
|
|
msgid "File is not an executable"
|
|
msgstr "Datei ist keine ausführbare Datei"
|
|
|
|
#: lazarusidestrconsts.lisfileisvirtual
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" is virtual."
|
|
msgstr "Die Datei \"%s\" wurde noch nicht gespeichert."
|
|
|
|
#: lazarusidestrconsts.lisfilenamestyle
|
|
msgid "Filename Style"
|
|
msgstr "Dateinamen-Stil"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "Datei nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound3
|
|
#, object-pascal-format
|
|
msgid "file %s not found"
|
|
msgstr "Datei %s nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound4
|
|
msgid "file not found"
|
|
msgstr "Datei nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound5
|
|
#, object-pascal-format
|
|
msgid "File not found:%s%s"
|
|
msgstr "Datei nicht gefunden:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" not found.%sDo you want to create it?"
|
|
msgstr "Datei \"%s\" nicht gefunden.%sWollen Sie sie erzeugen?"
|
|
|
|
#: lazarusidestrconsts.lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "Datei nicht in Kleinbuchstaben"
|
|
|
|
#: lazarusidestrconsts.lisfilescountconvertedtotextformat
|
|
#, object-pascal-format
|
|
msgid "%d files were converted to text format."
|
|
msgstr "%d Dateien wurden ins Textformat konvertiert."
|
|
|
|
#: lazarusidestrconsts.lisfilesettings
|
|
msgid "File Settings"
|
|
msgstr "Dateieinstellungen"
|
|
|
|
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
|
#, object-pascal-format
|
|
msgid "File %s has incorrect syntax."
|
|
msgstr "Datei %s hat eine fehlerhafte Syntax."
|
|
|
|
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
|
#, object-pascal-format
|
|
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
|
msgstr "Dateien: %s, besitzt Register Prozedur: %s, im Package-uses-Abschnitt: %s"
|
|
|
|
#: lazarusidestrconsts.lisfileshaverightencoding
|
|
msgid "*** All found files already have the right encoding ***"
|
|
msgstr "*** Alle gefundenen Dateien haben bereits die richtige Kodierung ***"
|
|
|
|
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
|
msgid "Files in ASCII or UTF-8 encoding"
|
|
msgstr "Dateien in ASCII- oder UTF-8-Kodierung"
|
|
|
|
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
|
#, object-pascal-format
|
|
msgid "File %s was converted to text format."
|
|
msgstr "Datei %s wurde ins Textformat umgewandelt."
|
|
|
|
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
|
msgid "Files not in ASCII nor UTF-8 encoding"
|
|
msgstr "Dateien sind weder ASCII- nach UTF-8-kodiert"
|
|
|
|
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
|
msgid "File where debug output is written to. Default is write to the console."
|
|
msgstr "Datei, in die Debug-Ausgaben geschrieben werden. Die Voreinstellung ist Schreiben auf die Konsole."
|
|
|
|
#: lazarusidestrconsts.lisfilter
|
|
msgid "Filter"
|
|
msgstr "Filter"
|
|
|
|
#: lazarusidestrconsts.lisfilter3
|
|
#, object-pascal-format
|
|
msgid "Filter: %s"
|
|
msgstr "Filter: %s"
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
|
msgid "Filter all messages of certain type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
|
#, object-pascal-format
|
|
msgid "Filter all messages of type %s"
|
|
msgstr "Alle Nachrichten vom Typ %s filtern"
|
|
|
|
#: lazarusidestrconsts.lisfilteralreadyexists
|
|
msgid "Filter already exists"
|
|
msgstr "Filter existiert bereits"
|
|
|
|
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
|
msgid "Filter Debug Messages and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterhintsandbelow
|
|
msgid "Filter Hints and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
|
msgid "Filter Hints without Source Position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
|
msgid "Filter None, do not filter by urgency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternonurgentmessages
|
|
msgid "Filter non urgent Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternotesandbelow
|
|
msgid "Filter Notes and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiltersets
|
|
msgid "Filter Sets"
|
|
msgstr "Filtergruppen"
|
|
|
|
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
|
msgid "Filter the available options list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
|
msgid "Filter Verbose Messages and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
|
msgid "Filter Warnings and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfind
|
|
msgid "Find ..."
|
|
msgstr "Suchen ..."
|
|
|
|
#: lazarusidestrconsts.lisfinddeclarationof
|
|
#, object-pascal-format
|
|
msgid "Find Declaration of %s"
|
|
msgstr "Finde Deklaration von %s"
|
|
|
|
#: lazarusidestrconsts.lisfindfiledirectories
|
|
msgid "D&irectories"
|
|
msgstr "Verze&ichnisse"
|
|
|
|
#: lazarusidestrconsts.lisfindfilefilemask
|
|
msgid "Fi&le mask"
|
|
msgstr "Dateimaske"
|
|
|
|
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
|
msgid "Include &sub directories"
|
|
msgstr "Unterverzeichni&sse einbeziehen"
|
|
|
|
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr "&Mehrzeiliges Muster"
|
|
|
|
#: lazarusidestrconsts.lisfindfilereplacementisnotpossible
|
|
msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
|
msgid "all files in &project"
|
|
msgstr "Alle Dateien im &Projekt"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
|
msgid "all &open files"
|
|
msgstr "alle &offenen Dateien"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
|
msgid "&active file"
|
|
msgstr "&aktive Datei"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
|
msgid "&directories"
|
|
msgstr "&Verzeichnisse"
|
|
|
|
#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
|
|
msgid "project &group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilewhere
|
|
msgid "Search location"
|
|
msgstr "Ort suchen"
|
|
|
|
#: lazarusidestrconsts.lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr "Tastenkombination suchen"
|
|
|
|
#: lazarusidestrconsts.lisfindmissingunit
|
|
msgid "Find missing unit"
|
|
msgstr "Fehlende Unit suchen"
|
|
|
|
#: lazarusidestrconsts.lisfindoption
|
|
msgid "Find option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindoverridestoo
|
|
msgid "Find overrides too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfirst
|
|
msgid "First"
|
|
msgstr "als erste"
|
|
|
|
#: lazarusidestrconsts.lisfirsttest
|
|
msgid "&First test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr ".lfm-Datei korrigieren"
|
|
|
|
#: lazarusidestrconsts.lisfocushint
|
|
msgid "Focus hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr "Umbenennen erzwingen"
|
|
|
|
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
|
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisform
|
|
msgid "Form"
|
|
msgstr "Form"
|
|
|
|
#: lazarusidestrconsts.lisformacosdarwin
|
|
msgid "For macOS (Darwin)"
|
|
msgstr "Für macOS (Darwin)"
|
|
|
|
#: lazarusidestrconsts.lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Formatfehler"
|
|
|
|
#: lazarusidestrconsts.lisforwindows
|
|
msgid "For Windows"
|
|
msgstr "Für Windows"
|
|
|
|
#: lazarusidestrconsts.lisfoundversionexpected
|
|
#, object-pascal-format
|
|
msgid "Found version %s, expected %s"
|
|
msgstr "Version %s gefunden, erwartet wurde %s"
|
|
|
|
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
|
msgid "FPC version as one number (e.g. 20701)"
|
|
msgstr "FPC-Version als eine Zahl (z.B. 20701)"
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagefile2
|
|
msgid "FPC message file:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagesappendix
|
|
msgid "FPC messages: Appendix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcresources
|
|
msgid "FPC resources (.res)"
|
|
msgstr "FPC-Ressourcen (.res)"
|
|
|
|
#: lazarusidestrconsts.lisfpcsources
|
|
msgid "FPC sources"
|
|
msgstr "FPC-Quellen"
|
|
|
|
#: lazarusidestrconsts.lisfpctooold
|
|
msgid "FPC too old"
|
|
msgstr "FPC ist zu alt"
|
|
|
|
#: lazarusidestrconsts.lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr "FPC-Version: "
|
|
|
|
#: lazarusidestrconsts.lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr "FPC-Version (z.B. 2.2.2)"
|
|
|
|
#: lazarusidestrconsts.lisfpdoceditor
|
|
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr "FPDoc-Editor"
|
|
|
|
#: lazarusidestrconsts.lisfpdocerrorwriting
|
|
#, object-pascal-format
|
|
msgid "Error writing \"%s\"%s%s"
|
|
msgstr "Fehler beim Schreiben von \"%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
|
msgid "FPDoc syntax error"
|
|
msgstr "FPDoc Syntaxfehler"
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagename
|
|
msgid "FPDoc package name:"
|
|
msgstr "FPDoc-Packagename:"
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
|
msgid "FPDoc package name. Default is project file name."
|
|
msgstr "FPDoc-Packagename. Vorgabe ist der Projekt-Dateiname."
|
|
|
|
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
|
#, object-pascal-format
|
|
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
|
msgstr "Es gibt einen Syntaxfehler im fpdoc Element \"%s\":%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfppkgcompilerproblem
|
|
msgid "there is a problem with the Free Pascal compiler executable, "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgconfgenproblems
|
|
msgid "Warnings have to be resolved first"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgconfiguration
|
|
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgconfigurationfilenotfound
|
|
#, object-pascal-format
|
|
msgid "Fppkg configuration file not found:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgcreatefilefailed
|
|
#, object-pascal-format
|
|
msgid "Failed to generate the configuration file \"%s\": %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfilestobewritten
|
|
msgid "Files to be written:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfixconfiguration
|
|
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
|
|
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
|
|
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
|
|
msgid "An up-to-date version is needed to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
|
|
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
|
|
msgid "It is probably too old to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
|
|
#, object-pascal-format
|
|
msgid "The fpcmkcfg configuration tool it too old [%s]."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkginstallationpath
|
|
#, object-pascal-format
|
|
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkglibprefix
|
|
#, object-pascal-format
|
|
msgid "Fpc library prefix: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgprefix
|
|
#, object-pascal-format
|
|
msgid "Fpc prefix: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgproblem
|
|
msgid "Problem with Fppkg configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
|
|
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconfexception
|
|
#, object-pascal-format
|
|
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
|
|
msgstr "Beim Versuch eine neue Fppkg-Konfiguration zu erstellen trat ein Problem auf: %s"
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconffailed
|
|
#, object-pascal-format
|
|
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconfigfile
|
|
msgid "Write new configuration files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisframe
|
|
msgid "Frame"
|
|
msgstr "Frame"
|
|
|
|
#: lazarusidestrconsts.lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr "&Rückwärts suchen"
|
|
|
|
#: lazarusidestrconsts.lisfreeingbufferlines
|
|
#, object-pascal-format
|
|
msgid "freeing buffer lines: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
|
msgid "Free Pascal Compiler messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalprefix
|
|
msgid "Free Pascal compiler prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
|
msgid "Free Pascal source directory"
|
|
msgstr "Free-Pascal-Quelltextverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr "&Vorwärts suchen"
|
|
|
|
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr "Zusätzliche zu suchende Dateien (z.B. *.pas;*.pp)"
|
|
|
|
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Bezeichner suchen oder umbenennen"
|
|
|
|
#: lazarusidestrconsts.lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Referenz suchen"
|
|
|
|
#: lazarusidestrconsts.lisfriidentifier
|
|
#, object-pascal-format
|
|
msgid "Identifier: %s"
|
|
msgstr "Bezeichner: %s"
|
|
|
|
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr "in allen offenen Packages und Projekten"
|
|
|
|
#: lazarusidestrconsts.lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "in aktueller Unit"
|
|
|
|
#: lazarusidestrconsts.lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "Im Hauptprojekt"
|
|
|
|
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr "im Projekt/Package, dem die aktuelle Unit gehört"
|
|
|
|
#: lazarusidestrconsts.lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Ungültiger Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr "Umbenennen aller Referenzen"
|
|
|
|
#: lazarusidestrconsts.lisfrirenaming
|
|
msgid "Renaming"
|
|
msgstr "Umbenennung"
|
|
|
|
#: lazarusidestrconsts.lisfrisearch
|
|
msgid "Search"
|
|
msgstr "Suche"
|
|
|
|
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr "Auch in Kommentaren suchen"
|
|
|
|
#: lazarusidestrconsts.lisfull
|
|
msgid "Full"
|
|
msgstr "Vollständig"
|
|
|
|
#: lazarusidestrconsts.lisfunction
|
|
msgctxt "lazarusidestrconsts.lisfunction"
|
|
msgid "Function"
|
|
msgstr "Funktion"
|
|
|
|
#: lazarusidestrconsts.lisgeneral
|
|
msgctxt "lazarusidestrconsts.lisgeneral"
|
|
msgid "General"
|
|
msgstr "Allgemein"
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgcfg
|
|
#, object-pascal-format
|
|
msgid "Fppkg configuration: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgcompcfg
|
|
#, object-pascal-format
|
|
msgid "Fppkg compiler configuration: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgconfiguration
|
|
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
|
|
msgid "Generate new Fppkg configuration files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetbuildmodes
|
|
msgid "Print a list of build modes in the project. Active mode is listed first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetexpandtext
|
|
msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
|
msgid "get word at current cursor position"
|
|
msgstr "Wort an der aktuellen Cursorposition lesen"
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
|
|
msgid "Get word at current cursor position."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisglobalsettings
|
|
msgid "Global settings"
|
|
msgstr "Globale Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lisgotoline
|
|
msgid "Goto Line"
|
|
msgstr "Zu Zeile springen"
|
|
|
|
#: lazarusidestrconsts.lisgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
"\n"
|
|
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
"<Beschreibung>\n"
|
|
"\n"
|
|
"Copyright (C) <Jahr> <Name des Autors> <Kontakt>\n"
|
|
"\n"
|
|
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
"\n"
|
|
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lisgroup
|
|
msgid "Group"
|
|
msgstr "Gruppe"
|
|
|
|
#: lazarusidestrconsts.lisgrouplocalvariables
|
|
msgid "Group automatically defined local variables"
|
|
msgstr "Automatisch definierte lokale Variablen gruppieren"
|
|
|
|
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
|
msgid "Enable or disable groups of debug output. Valid options are:"
|
|
msgstr "Gruppen von Debuggerausgaben aktivieren oder deaktivieren. Gültige Optionen sind:"
|
|
|
|
#: lazarusidestrconsts.lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr "Zum größten hin wachsen"
|
|
|
|
#: lazarusidestrconsts.lisgutterpartmargin
|
|
msgid "Margin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgutterpartvisible
|
|
msgid "Visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgutterpartwidth
|
|
msgid "Width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishashelp
|
|
msgid "Has Help"
|
|
msgstr "Besitzt Onlinehilfe"
|
|
|
|
#: lazarusidestrconsts.lisheadercolors
|
|
msgid "Header colors"
|
|
msgstr "Header-Farben"
|
|
|
|
#: lazarusidestrconsts.lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Header-Kommentar für die Klasse"
|
|
|
|
#: lazarusidestrconsts.lishelpentries
|
|
msgid "Help entries"
|
|
msgstr "Hilfeeinträge"
|
|
|
|
#: lazarusidestrconsts.lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr "Hilfe-Wähler"
|
|
|
|
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
|
msgid "Help for Free Pascal Compiler message"
|
|
msgstr "Hilfe für Free Pascal-Compilermeldung"
|
|
|
|
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
|
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
|
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
|
msgid "Hide message by inserting IDE directive {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
|
|
#, object-pascal-format
|
|
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidesearch
|
|
msgid "Hide Search"
|
|
msgstr "Suche ausblenden"
|
|
|
|
#: lazarusidestrconsts.lishidewindow
|
|
msgctxt "lazarusidestrconsts.lishidewindow"
|
|
msgid "Hide window"
|
|
msgstr "Verstecke Fenster"
|
|
|
|
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
|
#, object-pascal-format
|
|
msgid "Hide with package option (-vm%s)"
|
|
msgstr "Verbergen mit Package-Einstellung (-vm%s)"
|
|
|
|
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
|
#, object-pascal-format
|
|
msgid "Hide with project option (-vm%s)"
|
|
msgstr "Verbergen mit Projekt-Einstellung (-vm%s)"
|
|
|
|
#: lazarusidestrconsts.lishint
|
|
msgctxt "lazarusidestrconsts.lishint"
|
|
msgid "Hint"
|
|
msgstr "Hinweis"
|
|
|
|
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
|
msgid "Hint: A default value can be defined in the conditionals."
|
|
msgstr "Hinweis: Ein Standardwert kann in den bedingten Anweisungen festgelegt werden."
|
|
|
|
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
|
msgid "A hint at property's name shows its description."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr "Hinweis: Prüfen Sie, ob zwei Packages Units mit gleichen Namen enthalten."
|
|
|
|
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
|
|
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishints
|
|
#, object-pascal-format
|
|
msgid ", Hints: %s"
|
|
msgstr ", Hinweise: %s"
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
|
#, object-pascal-format
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr "Anmerkung: Die Funktion »Make Resourcestring« erwartet eine Zeichenkettenkonstante.%s Bitte wählen Sie den Ausdruck und versuchen Sie es noch einmal."
|
|
|
|
#: lazarusidestrconsts.lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Formulare anzeigen"
|
|
|
|
#: lazarusidestrconsts.lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Units anzeigen"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Datenbanken"
|
|
|
|
#: lazarusidestrconsts.lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Hilfeeinstellungen"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Eigenschaften"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Betrachter"
|
|
|
|
#: lazarusidestrconsts.lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "FPC-Doc-HTML-Pfad"
|
|
|
|
#: lazarusidestrconsts.lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Waagrecht"
|
|
|
|
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
|
msgid "Horizontal lines between properties."
|
|
msgstr "Horizontale Linien zwischen den Eigenschaften."
|
|
|
|
#: lazarusidestrconsts.lisid
|
|
msgctxt "lazarusidestrconsts.lisid"
|
|
msgid "ID"
|
|
msgstr "ID"
|
|
|
|
#: lazarusidestrconsts.lisidcaddition
|
|
msgid "Addition"
|
|
msgstr "Hinzufügung"
|
|
|
|
#: lazarusidestrconsts.lisidcopening
|
|
msgid "Opening"
|
|
msgstr "Auslösung"
|
|
|
|
#: lazarusidestrconsts.liside
|
|
msgid "IDE"
|
|
msgstr "IDE"
|
|
|
|
#: lazarusidestrconsts.lisidebuildoptions
|
|
msgid "IDE build options"
|
|
msgstr "Kompilieroptionen der IDE"
|
|
|
|
#: lazarusidestrconsts.lisidecaptioncustomhint
|
|
msgid "Additional info to display in the IDE title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidecompileandrestart
|
|
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
|
msgstr "Die IDE wird neu kompiliert und neu gestartet während der (De-)Installation von Packages."
|
|
|
|
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
|
#, object-pascal-format
|
|
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
|
msgstr "Willkommen zu Lazarus.%0:sDie gefundene IDE-Konfiguration wurde zuvor von einer anderen Lazarus-Installation verwendet.%0:sWenn Sie zwei oder mehr separate Lazarus-Installationen haben, dann sollten sie nicht die selbe Konfiguration teilen. Dies könnte zu Konflikten führen und Ihre Lazarus-Installationen können unbenutzbar werden.%0:s%0:sWenn Sie nur eine Installation haben und die ausführbare Datei kopiert oder verschoben haben, dann können Sie diese Konfiguration aktualisieren.%0:s%1:s%0:s%0:sWählen Sie:%0:s%0:s* Aktualisierungsinformation: Verwenden Sie diese Konfiguration und aktualisieren Sie sie, um sie in Zukunft mit diesem Lazarus zu verwenden. Die alte Installation wird sie nicht länger verwenden.%0:s* Ignorieren: Verwenden Sie diese Konfiguration, aber behalten Sie die Warnung bei. Dies kann zu Konflikten mit der anderen Installation führen.%0:s* Abbruch: Jetzt beenden. Sie können dann das Problem beheben, indem Sie dieses Lazarus mit der korrekten Konfiguration starten.%0:s%0:sZusätzliche Informationen:%0:sDiese Konfiguration befindet sich in: %2:s%0:sSie gehört zur Lazarus-Installation bei: %3:s%0:sDie aktuelle IDE wurde gestartet von: %4:s%0:s"
|
|
|
|
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
|
msgid "Information about the IDE"
|
|
msgstr "Informationen über die IDE"
|
|
|
|
#: lazarusidestrconsts.lisidemacros
|
|
msgid "IDE Macros"
|
|
msgstr "IDE-Makros"
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
|
|
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
|
msgid "The IDE maintains the title in main unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifier
|
|
msgid "identifier"
|
|
msgstr "Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr "Bezeichner beginnt mit ..."
|
|
|
|
#: lazarusidestrconsts.lisidentifiercannotbedotted
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" cannot be dotted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifiercannotbeempty
|
|
msgid "Identifier cannot be empty"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr "Bezeichner enthält ..."
|
|
|
|
#: lazarusidestrconsts.lisidentifierisalreadyused
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is already used"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisalreadyused2
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is already used."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerfunction
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is a declared compiler function."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerprocedure
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is a declared compiler procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisinvalid
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisreservedword
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is a reserved word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "IDE-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lisidetitlecustom
|
|
msgid "Custom IDE title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidetitleoptions
|
|
msgid "IDE main window and taskbar title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
|
#, fuzzy
|
|
#| msgid "IDE title starts with project name"
|
|
msgid "Show custom IDE title before built-in IDE title or info"
|
|
msgstr "IDE-Titel beginnt mit Projektname"
|
|
|
|
#: lazarusidestrconsts.lisiecoallbuildmodes
|
|
msgid "All build modes"
|
|
msgstr "Alle Erstellmodi"
|
|
|
|
#: lazarusidestrconsts.lisiecocompileroptionsof
|
|
msgid "Compiler options of"
|
|
msgstr "Compilereinstellungen von"
|
|
|
|
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
|
msgid "Current build mode"
|
|
msgstr "Aktueller Erstellmodus"
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxml
|
|
msgid "Error opening XML"
|
|
msgstr "Fehler beim Öffnen von XML"
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
|
#, object-pascal-format
|
|
msgid "Error opening XML file \"%s\":%s%s"
|
|
msgstr "Fehler beim Öffnen der .xml-Datei \"%s\":%s%s"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
|
msgid "Export Compiler Options"
|
|
msgstr "Compilereinstellungen exportieren"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr "Zu exportierende Datei ist vorhanden"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
#, object-pascal-format
|
|
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr "Die exportierte Datei \"%s\" ist vorhanden.%sSoll die Datei geöffnet und nur die Compilereinstellungen ersetzt werden?%s(Andere Einstellungen bleiben erhalten.)"
|
|
|
|
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
|
msgid "Import Compiler Options"
|
|
msgstr "Compilereinstellungen importieren"
|
|
|
|
#: lazarusidestrconsts.lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Aus Datei laden"
|
|
|
|
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" does not contain compiler options."
|
|
msgstr "Datei \"%s\" enthält keine Compilereinstellungen."
|
|
|
|
#: lazarusidestrconsts.lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "In Datei sichern"
|
|
|
|
#: lazarusidestrconsts.lisifnotchecked
|
|
msgid "If not checked:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
|
msgid "If only the session info changed, ask about saving it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
|
#, object-pascal-format
|
|
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
|
msgstr "Wenn Sie zwei verschiedene Lazarus-Versionen verwenden wollen, müssen Sie das zweite Lazarus mit dem Kommandozeilenparameter primary-config-path oder pcp starten.%sZum Beispiel:"
|
|
|
|
#: lazarusidestrconsts.lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr "Alle übergehen"
|
|
|
|
#: lazarusidestrconsts.lisignoreuseasancestor
|
|
#, object-pascal-format
|
|
msgid "Ignore, use %s as ancestor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
|
msgid "Imitate indentation of current unit, project or package"
|
|
msgstr "Einrückung der aktuellen Unit, des Projekts oder des Packages übernehmen"
|
|
|
|
#: lazarusidestrconsts.lisimplementationcommentforclass
|
|
msgid "Implementation comment for class"
|
|
msgstr "Implementierungs-Kommentar für die Klasse"
|
|
|
|
#: lazarusidestrconsts.lisimport
|
|
msgctxt "lazarusidestrconsts.lisimport"
|
|
msgid "Import"
|
|
msgstr "Import ..."
|
|
|
|
#: lazarusidestrconsts.lisimportant
|
|
msgctxt "lazarusidestrconsts.lisimportant"
|
|
msgid "Important"
|
|
msgstr "Wichtig"
|
|
|
|
#: lazarusidestrconsts.lisimportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
|
msgid "Import environment options"
|
|
msgstr "Umgebungseinstellungen importieren"
|
|
|
|
#: lazarusidestrconsts.lisimportfromfile
|
|
msgid "Import from File"
|
|
msgstr "Aus Datei importieren"
|
|
|
|
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
|
msgid "Importing BuildModes is not supported for packages."
|
|
msgstr "Der Import von Erstellmodi wird nicht unterstützt für Packages."
|
|
|
|
#: lazarusidestrconsts.lisimportpackagelistxml
|
|
msgid "Import package list"
|
|
msgstr "Package-Liste importieren"
|
|
|
|
#: lazarusidestrconsts.lisimpossible
|
|
msgid "Impossible"
|
|
msgstr "Unmöglich"
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
|
#, object-pascal-format
|
|
msgid "In a source directory of the package \"%s\"."
|
|
msgstr "In einem Quellverzeichnis des Packages \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
|
msgid "In a source directory of the project. Check for duplicates."
|
|
msgstr "In einem Quellverzeichnis des Projekts. Prüfen Sie auf Duplikate."
|
|
|
|
#: lazarusidestrconsts.lisincludepath
|
|
msgid "include path"
|
|
msgstr "Include-Pfad"
|
|
|
|
#: lazarusidestrconsts.lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr "Include-Pfade"
|
|
|
|
#: lazarusidestrconsts.lisincluderecursive
|
|
msgid "Include, recursive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincompatibleppu
|
|
#, object-pascal-format
|
|
msgid ", incompatible ppu=%s"
|
|
msgstr ", inkompatible ppu=%s"
|
|
|
|
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
|
msgid "Incorrect configuration directory found"
|
|
msgstr "Fehlerhaftes Konfigurationsverzeichnis gefunden"
|
|
|
|
#: lazarusidestrconsts.lisincorrectfppkgconfiguration
|
|
#, object-pascal-format
|
|
msgid "there is a problem with the Fppkg configuration. (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindentationforpascalsources
|
|
msgid "Indentation for Pascal sources"
|
|
msgstr "Einrückung für Pascal Quellcode"
|
|
|
|
#: lazarusidestrconsts.lisinformation
|
|
msgid "Information"
|
|
msgstr "Information"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutunit
|
|
#, object-pascal-format
|
|
msgid "Information about %s"
|
|
msgstr "Informationen zu %s"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
|
msgid "Information about used FPC"
|
|
msgstr "Informationen über verwendeten FPC"
|
|
|
|
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
|
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
|
msgstr "Im FPC-Unit-Suchpfad. Vermutlich durch das FPC-Package installiert. Prüfen Sie, ob der Compiler und die .ppu-Datei aus der gleichen Installation stammen."
|
|
|
|
#: lazarusidestrconsts.lisinfrontofrelated
|
|
msgid "In front of related"
|
|
msgstr "vor ähnlichen"
|
|
|
|
#: lazarusidestrconsts.lisinheriteditem
|
|
msgid "Inherited Item"
|
|
msgstr "Abgeleiteter Punkt"
|
|
|
|
#: lazarusidestrconsts.lisinheritedparameters
|
|
msgid "Inherited parameters"
|
|
msgstr "Übernommene Parameter"
|
|
|
|
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
|
msgid "Inherited project component"
|
|
msgstr "Abgeleitete Projekt-Komponente"
|
|
|
|
#: lazarusidestrconsts.lisinitialchecks
|
|
msgid "Initial Checks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinitializelocalvariable
|
|
msgid "Initialize Local Variable"
|
|
msgstr "Lokale Variable initialisieren"
|
|
|
|
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
#, object-pascal-format
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
|
msgstr "Um eine saubere Kopie des Projekts oder Packages zu erhalten, werden alle Dateien im folgenden Verzeichnis gelöscht, der gesamte Inhalt geht verloren.%sAlle Dateien in \"%s\" löschen?"
|
|
|
|
#: lazarusidestrconsts.lisinsert
|
|
msgctxt "lazarusidestrconsts.lisinsert"
|
|
msgid "Insert"
|
|
msgstr "Einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinsertassignment
|
|
#, object-pascal-format
|
|
msgid "Insert Assignment %s := ..."
|
|
msgstr "Füge Zuweisung %s := ein ..."
|
|
|
|
#: lazarusidestrconsts.lisinsertdate
|
|
msgid "insert date"
|
|
msgstr "Datum einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtime
|
|
msgid "insert date and time"
|
|
msgstr "Datum und Zeit einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
|
msgid "Insert date and time. Optional: format string."
|
|
msgstr "Datum und Zeit einfügen. Optional: Formatstring"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
|
msgid "Insert date. Optional: format string."
|
|
msgstr "Datum einfügen. Optional: Formatstring"
|
|
|
|
#: lazarusidestrconsts.lisinsertendifneeded
|
|
msgid "insert end if needed"
|
|
msgstr "end bei Bedarf einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
|
|
msgid ""
|
|
"Insert header of current procedure.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
|
|
"WithoutClassKeyword,// without 'class' proc keyword\n"
|
|
"AddClassName, // extract/add ClassName.\n"
|
|
"WithoutClassName, // skip classname\n"
|
|
"WithoutName, // skip function name\n"
|
|
"WithoutParamList, // skip param list\n"
|
|
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
|
|
"WithParameterNames, // extract parameter names\n"
|
|
"WithoutParamTypes, // skip colon, param types and default values\n"
|
|
"WithDefaultValues, // extract default values\n"
|
|
"WithResultType, // extract colon + result type\n"
|
|
"WithOfObject, // extract 'of object'\n"
|
|
"WithCallingSpecs, // extract cdecl; inline;\n"
|
|
"WithProcModifiers, // extract forward; alias; external;\n"
|
|
"WithComments, // extract comments and spaces\n"
|
|
"InUpperCase, // turn to uppercase\n"
|
|
"CommentsToSpace, // replace comments with a single space\n"
|
|
" // (default is to skip unnecessary space,\n"
|
|
" // e.g 'Do ;' normally becomes 'Do;'\n"
|
|
" // with this option you get 'Do ;')\n"
|
|
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
|
|
"WithoutSemicolon, // skip semicolon at end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertmacro
|
|
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
|
msgid "Insert Macro"
|
|
msgstr "Makro einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
|
msgid "Insert name of current procedure."
|
|
msgstr "Name der aktuellen Prozedur eintragen"
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag2
|
|
msgid "Insert printshort tag"
|
|
msgstr "Druckkürzel eintragen"
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurehead
|
|
msgid "insert procedure head"
|
|
msgstr "Prozedurkopf einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurename
|
|
msgid "insert procedure name"
|
|
msgstr "Prozedurname einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinsertsemicolonifneeded
|
|
msgid "Insert semicolon if needed"
|
|
msgstr "Semikolon einfügen falls benötigt"
|
|
|
|
#: lazarusidestrconsts.lisinserttime
|
|
msgid "insert time"
|
|
msgstr "Zeit einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
|
msgid "Insert time. Optional: format string."
|
|
msgstr "Zeit einfügen. Optional: Formatstring"
|
|
|
|
#: lazarusidestrconsts.lisinserturltag
|
|
msgid "Insert url tag"
|
|
msgstr "URL-Tag einfügen"
|
|
|
|
#: lazarusidestrconsts.lisinsession
|
|
msgid "In session"
|
|
msgstr "In der Sitzung"
|
|
|
|
#: lazarusidestrconsts.lisinstalled
|
|
msgid "installed"
|
|
msgstr "installiert"
|
|
|
|
#: lazarusidestrconsts.lisinstallitilikethefat
|
|
msgid "Install it, I like the fat"
|
|
msgstr "Installieren, ich will es so"
|
|
|
|
#: lazarusidestrconsts.lisinstallpackagesmsg
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"The following packages are not installed, but available in the main repository: %s.\n"
|
|
"Do you wish to install missing packages?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Auswahl installieren"
|
|
|
|
#: lazarusidestrconsts.lisinstalluninstallpackages
|
|
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
|
msgid "Install/Uninstall Packages"
|
|
msgstr "Packages de-/installieren"
|
|
|
|
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
|
msgid "Instead of compiling a package create a simple Makefile."
|
|
msgstr "Erzeuge eine einfache Make-Datei anstatt das Package zu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lisinsufficientencoding
|
|
msgid "Insufficient encoding"
|
|
msgstr "Unzureichende Kodierung"
|
|
|
|
#: lazarusidestrconsts.lisinteractive
|
|
msgid "Interactive"
|
|
msgstr "Interaktiv"
|
|
|
|
#: lazarusidestrconsts.lisinternalerror
|
|
#, object-pascal-format
|
|
msgid "internal error: %s"
|
|
msgstr "interner Fehler: %s"
|
|
|
|
#: lazarusidestrconsts.lisinvaliddeclaration
|
|
msgid "Invalid Declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr "Ungültiger Löschvorgang"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutable
|
|
msgid "Invalid Executable"
|
|
msgstr "Ungültige ausführbare Datei"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is not executable."
|
|
msgstr "Die Datei \"%s\" ist nicht ausführbar."
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
|
#, object-pascal-format
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Ungültiger Ausdruck.%sHinweis: Das »Make« für Ressourcenstrings erwartet eine Zeichenkettenkonstante in einer einzelnen Datei. Bitte wählen Sie den Ausdruck und versuchen Sie es noch einmal."
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilename
|
|
msgid "Invalid file name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr "Ungültiger Filter"
|
|
|
|
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
|
#, object-pascal-format
|
|
msgid "Invalid line, column in message%s%s"
|
|
msgstr "Ungültige Zeile, Spalte in Nachricht %s%s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosin
|
|
#, object-pascal-format
|
|
msgid "Invalid macros in \"%s\""
|
|
msgstr "Ungültige Makros in \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
|
#, object-pascal-format
|
|
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
|
msgstr "Ungültige Makros \"%s\" in externem Werkzeug \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
|
#, object-pascal-format
|
|
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
|
msgstr "Ungültiges Makro \"%s\". Der Makroname muß ein gültiger Pascal-Bezeichner sein."
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
|
#, object-pascal-format
|
|
msgid "Invalid macro name \"%s\". The name is a keyword."
|
|
msgstr "Ungültiger Makroname \"%s\". Der Name ist ein Schlüsselwort."
|
|
|
|
#: lazarusidestrconsts.lisinvalidmask
|
|
msgid "Invalid Mask"
|
|
msgstr "Ungültige Maske"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmode
|
|
#, object-pascal-format
|
|
msgid "Invalid mode %s"
|
|
msgstr "Ungültiger Modus %s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr "Ungültige Mehrfachauswahl"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Ungültiger Pascal-Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiername
|
|
#, object-pascal-format
|
|
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
|
|
msgstr "Der Name \"%s\" ist kein gültiger Pascal-Bezeichner.%sTrotzdem verwenden?"
|
|
|
|
#: lazarusidestrconsts.lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr "Ungültiger Proc-Name"
|
|
|
|
#: lazarusidestrconsts.lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Ungültiger Projektdateiname"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
|
msgid "Invalid publishing Directory"
|
|
msgstr "Ungültiges Ausgabeverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr "Ungültige Auswahl"
|
|
|
|
#: lazarusidestrconsts.lisinvalidversionin
|
|
#, object-pascal-format
|
|
msgid "invalid version in %s"
|
|
msgstr "ungültige Version in %s"
|
|
|
|
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
|
#, object-pascal-format
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s ist bereits im Projekt enthalten."
|
|
|
|
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "\"%s\" ist als Projektname ungültig.%sBitte wählen Sie einen anderen (z.B. project1.lpi)"
|
|
|
|
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
|
#, object-pascal-format
|
|
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
|
msgstr "%s ist ein %s.%sDiese zirkuläre Abhängigkeit ist nicht erlaubt."
|
|
|
|
#: lazarusidestrconsts.lisisddirectorynotfound
|
|
msgid "directory not found"
|
|
msgstr "Verzeichnis nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisissues
|
|
msgid "Issues"
|
|
msgstr "Probleme"
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
|
#, object-pascal-format
|
|
msgid "I wonder how you did that. Error in the %s:"
|
|
msgstr "Wie haben Sie das geschafft? Fehler in %s:"
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
|
msgid "I wonder how you did that: Error in the base directory:"
|
|
msgstr "Wie haben Sie das geschafft? Fehler im Basisverzeichnis:"
|
|
|
|
#: lazarusidestrconsts.lisjhjumphistory
|
|
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Sprungliste"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerror
|
|
msgid "Jump to error"
|
|
msgstr "Zum Fehler springen"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
|
msgid "When an error in the sources is found at identifier completion, jump to it."
|
|
msgstr "Wenn ein Fehler in den Quellen bei der Bezeichnervervollständigung gefunden wird, springe dorthin."
|
|
|
|
#: lazarusidestrconsts.lisjumptoprocedure
|
|
#, object-pascal-format
|
|
msgid "Jump to procedure %s"
|
|
msgstr "Springe zu Prozedur %s"
|
|
|
|
#: lazarusidestrconsts.liskb
|
|
#, object-pascal-format
|
|
msgid "%s KB"
|
|
msgstr "%s KB"
|
|
|
|
#: lazarusidestrconsts.liskeep2
|
|
msgid "Keep"
|
|
msgstr "Beibehalten"
|
|
|
|
#: lazarusidestrconsts.liskeepfileopen
|
|
msgid "Keep converted files open in editor"
|
|
msgstr "Konvertierte Dateien im Editor geöffnet halten"
|
|
|
|
#: lazarusidestrconsts.liskeepfileopenhint
|
|
msgid "All project files will be open in editor after conversion"
|
|
msgstr "Alle Projektdateien werden nach der Konvertierung im Editor geöffnet."
|
|
|
|
#: lazarusidestrconsts.liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Name behalten"
|
|
|
|
#: lazarusidestrconsts.liskeepopen
|
|
msgid "Keep open"
|
|
msgstr "Offen halten"
|
|
|
|
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
|
msgid "Keep absolute indentation, regardless of the current cursor indentation in the text."
|
|
msgstr "Absolute Einrückung beibehalten, unabhängig von der aktuellen Cursoreinrückung im Text."
|
|
|
|
#: lazarusidestrconsts.liskeepsubindentation
|
|
msgid "Absolute indentation"
|
|
msgstr "Einrückung beibehalten"
|
|
|
|
#: lazarusidestrconsts.liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr "Beibehalten und fortsetzen"
|
|
|
|
#: lazarusidestrconsts.liskey
|
|
msgctxt "lazarusidestrconsts.liskey"
|
|
msgid "Key"
|
|
msgstr "Taste"
|
|
|
|
#: lazarusidestrconsts.liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Benutzerdefinierte Anweisungen"
|
|
|
|
#: lazarusidestrconsts.liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Designer-Befehle"
|
|
|
|
#: lazarusidestrconsts.liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr "Objektinspektorbefehle"
|
|
|
|
#: lazarusidestrconsts.liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr "Taste (oder 2-Tasten-Kombination)"
|
|
|
|
#: lazarusidestrconsts.liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr "Kompilieren abbrechen"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpaddress
|
|
msgid "Add Address Breakpoint"
|
|
msgstr "Adress-Haltepunkt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpsource
|
|
msgid "Add Source Breakpoint"
|
|
msgstr "Quell-Haltepunkt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
|
msgid "Add Data/WatchPoint"
|
|
msgstr "Daten-/Überwachungspunkt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.liskmaddwatch
|
|
msgctxt "lazarusidestrconsts.liskmaddwatch"
|
|
msgid "Add watch"
|
|
msgstr "Überwachung hinzufügen"
|
|
|
|
#: lazarusidestrconsts.liskmbuildmanymodes
|
|
msgid "Build many modes"
|
|
msgstr "Viele Modi erstellen"
|
|
|
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr "Projekt/Programm neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr "Tastaturbelegungsschema auswählen"
|
|
|
|
#: lazarusidestrconsts.liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Klassisch"
|
|
|
|
#: lazarusidestrconsts.liskmcleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Aufräumen und Kompilieren"
|
|
|
|
#: lazarusidestrconsts.liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Projekt schließen"
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr "Definitioneneditor der Codetools"
|
|
|
|
#: lazarusidestrconsts.liskmcompileprojectprogram
|
|
msgid "Compile project/program"
|
|
msgstr "Projekt/Programm kompilieren"
|
|
|
|
#: lazarusidestrconsts.liskmconfigbuildfile
|
|
msgid "Config \"Build File\""
|
|
msgstr "\"Neukompilieren der Datei\" einrichten"
|
|
|
|
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
|
msgid "Configure Custom Components"
|
|
msgstr "Externe Komponenten einrichten"
|
|
|
|
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr "Kontextsensitive Hilfe"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Delphi- in Lazarus-Package umwandeln"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
|
msgid "Convert Delphi Project to Lazarus Project"
|
|
msgstr "Delphi- in Lazarus-Projekt umwandeln"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
|
msgid "Convert Delphi Unit to Lazarus Unit"
|
|
msgstr "Delphi- in Lazarus-Unit umwandeln"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
|
msgid "Convert DFM File to LFM"
|
|
msgstr ".dfm- in .lfm-Datei umwandeln"
|
|
|
|
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
|
msgid "Copy selected components"
|
|
msgstr "Ausgewählte Komponenten kopieren"
|
|
|
|
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
|
msgid "Cut selected components"
|
|
msgstr "Ausgewählte Komponenten ausschneiden"
|
|
|
|
#: lazarusidestrconsts.liskmdefaulttoosx
|
|
msgid "Default adapted to macOS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Letztes Zeichen löschen"
|
|
|
|
#: lazarusidestrconsts.liskmdiffeditorfiles
|
|
msgid "Diff Editor Files"
|
|
msgstr "Editordateien vergleichen"
|
|
|
|
#: lazarusidestrconsts.liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr "Vorlagen bearbeiten"
|
|
|
|
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr "Kontextsensitive Hilfe bearbeiten"
|
|
|
|
#: lazarusidestrconsts.liskmencloseselection
|
|
msgid "Enclose Selection"
|
|
msgstr "Bereich einschließen"
|
|
|
|
#: lazarusidestrconsts.liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr "Überprüfen/Ändern"
|
|
|
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr "Einstellungen für externe Werkzeuge"
|
|
|
|
#: lazarusidestrconsts.liskmfindincremental
|
|
msgid "Find Incremental"
|
|
msgstr "Inkrementelle Suche"
|
|
|
|
#: lazarusidestrconsts.liskminspect
|
|
msgid "Inspect"
|
|
msgstr "Inspizieren"
|
|
|
|
#: lazarusidestrconsts.liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr "Tastaturbelegung"
|
|
|
|
#: lazarusidestrconsts.liskmlazarusdefault
|
|
msgid "Lazarus default"
|
|
msgstr "Lazarus (Voreinstellung)"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxapple
|
|
msgid "macOS, Apple style"
|
|
msgstr "macOS (Apple-Stil)"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxlaz
|
|
msgid "macOS, Lazarus style"
|
|
msgstr "macOS (Lazarus-Stil)"
|
|
|
|
#: lazarusidestrconsts.liskmnewpackage
|
|
msgid "New package"
|
|
msgstr "Neues Package"
|
|
|
|
#: lazarusidestrconsts.liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Neues Projekt"
|
|
|
|
#: lazarusidestrconsts.liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Neues Projekt aus Datei"
|
|
|
|
#: lazarusidestrconsts.liskmnewunit
|
|
msgctxt "lazarusidestrconsts.liskmnewunit"
|
|
msgid "New Unit"
|
|
msgstr "Neue Unit"
|
|
|
|
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
|
msgid "Note: All keys will be set to the values of the chosen scheme."
|
|
msgstr "Anmerkung: Alle Tasten werden auf die Werte des gewählten Schemas gesetzt."
|
|
|
|
#: lazarusidestrconsts.liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr "Packagedatei öffnen"
|
|
|
|
#: lazarusidestrconsts.liskmopenrecent
|
|
msgctxt "lazarusidestrconsts.liskmopenrecent"
|
|
msgid "Open Recent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenrecentpackage
|
|
msgid "Open recent package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenrecentproject
|
|
msgid "Open recent project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
|
msgid "Paste Components"
|
|
msgstr "Komponenten einfügen"
|
|
|
|
#: lazarusidestrconsts.liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr "Programm anhalten"
|
|
|
|
#: lazarusidestrconsts.liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Projekt veröffentlichen"
|
|
|
|
#: lazarusidestrconsts.liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr "Schnelles Kompilieren, kein Linken"
|
|
|
|
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
|
msgid "Remove Active File from Project"
|
|
msgstr "Aktive Datei aus Projekt entfernen"
|
|
|
|
#: lazarusidestrconsts.liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Programm starten"
|
|
|
|
#: lazarusidestrconsts.liskmsaveall
|
|
msgctxt "lazarusidestrconsts.liskmsaveall"
|
|
msgid "Save All"
|
|
msgstr "Alles speichern"
|
|
|
|
#: lazarusidestrconsts.liskmsaveas
|
|
msgid "Save As"
|
|
msgstr "Speichern als"
|
|
|
|
#: lazarusidestrconsts.liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Projekt speichern"
|
|
|
|
#: lazarusidestrconsts.liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr "Projekt speichern als"
|
|
|
|
#: lazarusidestrconsts.liskmstopprogram
|
|
msgid "Stop Program"
|
|
msgstr "Programm stoppen"
|
|
|
|
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr "Zwischen Unit und Form umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewassembler
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
|
msgid "View Assembler"
|
|
msgstr "Assembleransicht anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
|
msgid "View Breakpoints"
|
|
msgstr "Haltepunkte anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Aufrufstack anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
|
msgid "Toggle view Code Browser"
|
|
msgstr "Code-Browser-Ansicht umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr "Ansicht des Code-Explorers umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
|
msgid "Toggle View Component Palette"
|
|
msgstr "Ansicht der Komponentenpalette umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
|
msgid "View Debuger Event Log"
|
|
msgstr "Debug-Ereignisse anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
|
msgid "View Debugger Output"
|
|
msgstr "Debugger-Ausgabe anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr "Ansicht des Dokumentationseditor umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewhistory
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
|
msgid "View History"
|
|
msgstr "Historie anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr "Ansicht der IDE-Speedbuttons umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
|
msgid "View Local Variables"
|
|
msgstr "Lokale Variablen anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmemviewer
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer"
|
|
msgid "View Mem viewer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr "Ansicht der Meldungen umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr "Ansicht des Objektinspektors umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
|
msgid "View Console In/Output"
|
|
msgstr "Zeige die Ein/Ausgaben der Konsole"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewregisters
|
|
msgid "View Registers"
|
|
msgstr "Registeransicht anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr "Ansicht der Suchergebnisse umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr "Ansicht des Quelltexteditors umschalten"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewthreads
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Threads anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewwatches
|
|
msgid "View Watches"
|
|
msgstr "Überwachte Ausdrücke anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr "Sprungverlauf anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr "Projekteinstellungen anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectsource
|
|
msgid "View Project Source"
|
|
msgstr "Projektquelltext anzeigen"
|
|
|
|
#: lazarusidestrconsts.liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr "Unit-Informationen anzeigen"
|
|
|
|
#: lazarusidestrconsts.lislastopened
|
|
msgid "Last opened"
|
|
msgstr "Zuletzt geöffnet"
|
|
|
|
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr "Startprogramm ungültig"
|
|
|
|
#: lazarusidestrconsts.lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Startbefehl des Projekts"
|
|
|
|
#: lazarusidestrconsts.lislazarusdefault
|
|
msgid "Lazarus Default"
|
|
msgstr "Lazarus-Vorgabe"
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Lazarus-Verzeichnis"
|
|
|
|
#: lazarusidestrconsts.lislazarusdirhint
|
|
#, object-pascal-format
|
|
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdiroverride
|
|
msgid "Directory to be used as a basedirectory."
|
|
msgstr "Verzeichnis wird als Basisordner festgelegt"
|
|
|
|
#: lazarusidestrconsts.lislazaruseditorv
|
|
#, object-pascal-format
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr "Lazarus-IDE v%s"
|
|
|
|
#: lazarusidestrconsts.lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr "Lazarus-IDE"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr "Lazarus-Sprach-ID (z.B. en, de, br, fi)"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr "Name der Sprache für Lazarus (z.B. english, deutsch)"
|
|
|
|
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [Einstellungen] <Projektdatei>"
|
|
|
|
#: lazarusidestrconsts.lislazbuild
|
|
msgid "lazbuild"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr "Ausgabeverzeichnis der ausführbaren IDE wählen "
|
|
|
|
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
|
msgid "Are you sure you want to delete this build profile?"
|
|
msgstr "Wollen sie dieses Erstellprofil wirklich löschen?"
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildmany
|
|
msgid "Build Many"
|
|
msgstr "Viele erstellen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildcommonsettings
|
|
msgid "Common Settings"
|
|
msgstr "Allgemeine Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
|
msgid "Confirm before build"
|
|
msgstr "Kompilieren von Lazarus bestätigen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
|
msgid "Confirm deletion"
|
|
msgstr "Löschung bestätigen"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddebugide
|
|
msgid "Debug IDE"
|
|
msgstr "IDE mit Debugger-Informationen"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefines
|
|
msgid "Defines"
|
|
msgstr "Definitionen"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
|
msgid "Defines without -d"
|
|
msgstr "Definitionen ohne -d"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditdefines
|
|
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
|
msgid "Edit Defines"
|
|
msgstr "Bearbeite Definitionen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
|
msgid "Edit list of defines which can be used by any profile"
|
|
msgstr "Bearbeiten der Liste von Definitionen, die von jedem Profil verwendet werden können"
|
|
|
|
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Fehler beim Schreiben der Datei"
|
|
|
|
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
|
#, object-pascal-format
|
|
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
|
msgstr "%s%s%s%sLazBuild ist nicht interaktiv, es wird abgebrochen."
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
|
msgid "Manage Build Profiles"
|
|
msgstr "Erstellprofile verwalten"
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
|
msgid "Manage profiles"
|
|
msgstr "Profile verwalten"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
|
msgid "Name of the active profile"
|
|
msgstr "Name des aktiven Profils"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprof
|
|
msgid "Add New Profile"
|
|
msgstr "Neues Profil hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
|
msgid "Current build options will be associated with:"
|
|
msgstr "Aktuelle Erstellungs-Optionen werden verbunden mit:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnormalide
|
|
msgid "Normal IDE"
|
|
msgstr "Normale IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptimizedide
|
|
msgid "Optimized IDE"
|
|
msgstr "Optimierte IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Einstellungen:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
|
msgid "Options passed to compiler"
|
|
msgstr "An den Compiler weitergereichte Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionssyntax
|
|
msgid "lazbuild [options] <project/package filename or package name>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildprofile
|
|
msgid "Profile to build"
|
|
msgstr "Profil zum Kompilieren"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprof
|
|
msgid "Rename Profile"
|
|
msgstr "Profil umbenennen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
|
msgid "New name for profile:"
|
|
msgstr "Neuer Name für Profil:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
|
msgid "Restart after building IDE"
|
|
msgstr "Nach dem Kompilieren neu starten"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
|
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
|
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
|
msgstr "Startet Lazarus nach dem Erstellen der IDE automatisch neu (hat keinen Effekt beim Erstellen anderer Teile)"
|
|
|
|
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
|
msgid "Select profiles to build"
|
|
msgstr "Profile zum Erstellen auswählen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
|
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
|
msgid "Show confirmation dialog when building directly from Tools menu"
|
|
msgstr "Zeigt einen Bestätigungsdialog beim Erstellen aus dem Werkzeuge-Menü heraus"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
|
msgid "Show options and defines for command line"
|
|
msgstr "Zeige Einstellungen und Definitionen für die Kommandzeile"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Ziel-CPU:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr "Zielverzeichnis:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Zielsystem:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
|
#, object-pascal-format
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr "Kann Datei \"%s\" nicht schreiben: %s"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
|
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
|
msgid "Update revision.inc"
|
|
msgstr "Aktualisiere revision.inc"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
|
msgid "Update revision info in \"About Lazarus\" dialog"
|
|
msgstr "Aktualisiert die Revisions-Info im \"Über Lazarus\" Dialog"
|
|
|
|
#: lazarusidestrconsts.lislazcleanupbuildall
|
|
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
|
msgid "Clean Up + Build all"
|
|
msgstr "Aufräumen und neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lislazver
|
|
msgid "Lazarus Version (e.g. 1.2.4)"
|
|
msgstr "Lazarus Version (z.B. 1.2.4)"
|
|
|
|
#: lazarusidestrconsts.lislclwidgettype
|
|
msgid "LCL widget type"
|
|
msgstr "LCL-Schnittstelle"
|
|
|
|
#: lazarusidestrconsts.lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr "Link zum Vorgänger hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr "Vom Vorläufer kopieren"
|
|
|
|
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
|
#, object-pascal-format
|
|
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr "%s besitzt keinen gültigen FPDoc-Pfad.%sKann die FPDoc-Datei für %s nicht erzeugen"
|
|
|
|
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr "Einträge zu den vererbten verschieben"
|
|
|
|
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
|
msgid "No valid FPDoc path"
|
|
msgstr "Kein gültiger FPDoc-Pfad"
|
|
|
|
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
#, object-pascal-format
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr "Die Unit %s gehört zu keinem Package oder Projekt.%sBitte fügen Sie die Unit zu einem Package oder Projekt hinzu.%sKann die FPDoc-Datei nicht generieren."
|
|
|
|
#: lazarusidestrconsts.lisleft
|
|
msgctxt "lazarusidestrconsts.lisleft"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr "Linker Randabstand. Der Wert wird zum Grund-Randabstand addiert und für den Platz links vom Element verwendet."
|
|
|
|
#: lazarusidestrconsts.lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Linke Verankerung"
|
|
|
|
#: lazarusidestrconsts.lisleftgutter
|
|
msgctxt "lazarusidestrconsts.lisleftgutter"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Das ist das Geschwistercontro, an das die linke Seite verankert wurde. Für den Parent leerlassen."
|
|
|
|
#: lazarusidestrconsts.lisleftsides
|
|
msgid "Left sides"
|
|
msgstr "Linke Seiten"
|
|
|
|
#: lazarusidestrconsts.lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr "Linker Abstand gleich"
|
|
|
|
#: lazarusidestrconsts.lisless
|
|
msgctxt "lazarusidestrconsts.lisless"
|
|
msgid "Less"
|
|
msgstr "Weniger"
|
|
|
|
#: lazarusidestrconsts.lislevels
|
|
msgctxt "lazarusidestrconsts.lislevels"
|
|
msgid "Levels"
|
|
msgstr "Stufen"
|
|
|
|
#: lazarusidestrconsts.lislfmfile
|
|
msgid "LFM file"
|
|
msgstr ".lfm-Datei"
|
|
|
|
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
|
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
|
msgstr "Die .lfm-Datei enthält unbekannte Eigenschaften/Klassen, die in der LCL nicht existieren. Sie können ersetzt oder entfernt werden."
|
|
|
|
#: lazarusidestrconsts.lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr ".lfm-Datei ist defekt"
|
|
|
|
#: lazarusidestrconsts.lislfmisok
|
|
msgid "LFM is ok"
|
|
msgstr "LFM ist ok"
|
|
|
|
#: lazarusidestrconsts.lislgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
"<Beschreibung>\n"
|
|
"\n"
|
|
"Copyright (C) <Jahr> <Names des Autors> <Kontakt>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lislibrarypath
|
|
msgid "library path"
|
|
msgstr "Bibliothekspfad"
|
|
|
|
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
|
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
|
|
msgstr "Eine mit Free Pascal erstellte dynamische Bibliothek (.dll unter Windows, .so unter Linux, .dylib unter MacOS)."
|
|
|
|
#: lazarusidestrconsts.lislink
|
|
msgid "Link:"
|
|
msgstr "Link:"
|
|
|
|
#: lazarusidestrconsts.lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr "Linker-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lislinktarget
|
|
msgid "Link target"
|
|
msgstr "Link-Ziel"
|
|
|
|
#: lazarusidestrconsts.lislistofallcasevalues
|
|
msgid "list of all case values"
|
|
msgstr "Liste aller Case-Werte"
|
|
|
|
#: lazarusidestrconsts.lisloadingfailed
|
|
#, object-pascal-format
|
|
msgid "Loading %s failed."
|
|
msgstr "Laden von %s fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lisloadmacrofrom
|
|
msgid "Load macro from"
|
|
msgstr "Lade Makro aus"
|
|
|
|
#: lazarusidestrconsts.lislocal
|
|
msgid "&Local"
|
|
msgstr "&Lokal"
|
|
|
|
#: lazarusidestrconsts.lislowercasestring
|
|
msgid "lowercase string"
|
|
msgstr "Zeichenkette in Kleinbuchstaben"
|
|
|
|
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
|
msgid "Lowercase string given as parameter."
|
|
msgstr "Kleinbuchstabige Zeichenkette als Parameter gegeben"
|
|
|
|
#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
|
|
msgid "Maximize compatibility of project files (LPI and LPS)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
|
|
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
|
|
msgid "Maximize compatibility of package file (LPK)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
|
|
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
|
#, object-pascal-format
|
|
msgid "lpk has vanished on disk. Using as alternative%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkismissing
|
|
msgid "lpk is missing"
|
|
msgstr "fehlende .lpk-Datei"
|
|
|
|
#: lazarusidestrconsts.lislrsincludefiles
|
|
msgid "Lazarus resources (.lrs) include files"
|
|
msgstr "lrs Include-Dateien"
|
|
|
|
#: lazarusidestrconsts.lismacpreferences
|
|
msgid "Preferences..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacro
|
|
#, object-pascal-format
|
|
msgid "Macro %s"
|
|
msgstr "Makro %s"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Daten eingeben"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "»Start«-Parameter angeben"
|
|
|
|
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
|
msgid "Main unit has Uses section containing all units of project"
|
|
msgstr "Die Hauptunit enthält einen uses-Abschnitt mit allen Units des Projekts."
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsource
|
|
msgid "Main unit is Pascal source"
|
|
msgstr "Hauptunit ist ein Pascal-Quelltext"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
|
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
|
msgstr "Nehme Pascal an auch ohne .pas/.pp Dateierweiterung"
|
|
|
|
#: lazarusidestrconsts.lismajorchangesdetected
|
|
msgid "Major changes detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakecurrent
|
|
msgctxt "lazarusidestrconsts.lismakecurrent"
|
|
msgid "Current"
|
|
msgstr "Aktuell"
|
|
|
|
#: lazarusidestrconsts.lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Erzeuge ausführbare Datei"
|
|
|
|
#: lazarusidestrconsts.lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr "Make nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Ressourcenstring erzeugen"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "An Ressourcenstring-Abschnitt anhängen"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
|
#, object-pascal-format
|
|
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "Der Ressourcenstring \"%s\" ist bereits angelegt.%sBitte wählen Sie einen anderen Namen.%sDrücken Sie »Übergehen«, um ihn trotzdem zuzufügen."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Konvertierungseinstellungen"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr "Benutzerdefinierter Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
|
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Bezeichnerlänge:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr "Bezeichner-Präfix"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Alphabetisch einfügen"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Kontextsensitiv einfügen"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Ungültiger Ressourcenstring-Abschnitt"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr "Bitte wählen Sie einen Ressourcenstring aus der Liste."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "Ressourcenstring bereits vorhanden"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Ressourcenstring-Abschnitt:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Quelltext-Vorschau"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "Stringkonstanten im Quelltext"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "Strings mit gleichen Werten:"
|
|
|
|
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
|
msgid "Make sure all ppu files of a package are in its output directory."
|
|
msgstr "Stellen Sie sicher, daß alle .ppu-Dateien eines Packages sich in dessem Ausgabeverzeichnis befinden."
|
|
|
|
#: lazarusidestrconsts.lismanagesourceeditors
|
|
msgid "Manage Source Editors ..."
|
|
msgstr "Quelltexteditoren verwalten ..."
|
|
|
|
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
|
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
|
#, object-pascal-format
|
|
msgid "Maximum parallel processes, 0 means default (%s)"
|
|
msgstr "Maximale Anzahl paralleler Prozesse, 0 bedeutet Vorgabe (%s)"
|
|
|
|
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
|
#, object-pascal-format
|
|
msgid "%s Maybe you have to recompile the package."
|
|
msgstr "%s Vielleicht müssen sie das Package neu kompilieren."
|
|
|
|
#: lazarusidestrconsts.lismb
|
|
#, object-pascal-format
|
|
msgid "%s MB"
|
|
msgstr "%s MB"
|
|
|
|
#: lazarusidestrconsts.lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Kompilieren abbrechen"
|
|
|
|
#: lazarusidestrconsts.lismenuaboutfpc
|
|
msgid "About FPC"
|
|
msgstr "Über FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuaddbreakpoint
|
|
msgid "Add &Breakpoint"
|
|
msgstr "Neuer Haltepunkt"
|
|
|
|
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
|
msgid "Add Active File to Package ..."
|
|
msgstr "Aktive Datei zu einem Package hinzufügen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
|
msgid "Add Jump Point to History"
|
|
msgstr "Sprungmarke speichern"
|
|
|
|
#: lazarusidestrconsts.lismenuaddtoproject
|
|
msgid "Add Editor File to Project"
|
|
msgstr "Datei im Editor ins Projekt aufnehmen"
|
|
|
|
#: lazarusidestrconsts.lismenuaddwatch
|
|
msgid "Add &Watch ..."
|
|
msgstr "Überwachung hinzufügen ..."
|
|
|
|
#: lazarusidestrconsts.lismenubeaklinesinselection
|
|
msgid "Break Lines in Selection"
|
|
msgstr "Zeilen in der Auswahl umbrechen"
|
|
|
|
#: lazarusidestrconsts.lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Datei neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarus
|
|
msgid "Build Lazarus with Current Profile"
|
|
msgstr "Lazarus mit aktuellem Profil neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarusprof
|
|
#, object-pascal-format
|
|
msgid "Build Lazarus with Profile: %s"
|
|
msgstr "Kompiliere Lazarus mit Profil: %s"
|
|
|
|
#: lazarusidestrconsts.lismenuchecklfm
|
|
msgid "Check LFM File in Editor"
|
|
msgstr ".lfm-Datei im Editor überprüfen"
|
|
|
|
#: lazarusidestrconsts.lismenucleandirectory
|
|
msgid "Clean Directory ..."
|
|
msgstr "Verzeichnis säubern ..."
|
|
|
|
#: lazarusidestrconsts.lismenucleanupandbuild
|
|
msgid "Clean up and Build ..."
|
|
msgstr "Aufräumen und Kompilieren ..."
|
|
|
|
#: lazarusidestrconsts.lismenucloseeditorfile
|
|
msgid "&Close Editor File"
|
|
msgstr "Editordatei s&chließen"
|
|
|
|
#: lazarusidestrconsts.lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Projekt schließen"
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor ..."
|
|
msgstr "Editor für CodeTools-Eigenschaften ..."
|
|
|
|
#: lazarusidestrconsts.lismenucommentselection
|
|
msgid "Comment Selection"
|
|
msgstr "Auswahl kommentieren"
|
|
|
|
#: lazarusidestrconsts.lismenucomparefiles
|
|
msgid "Compare files ..."
|
|
msgstr "Vergleiche Dateien ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompilemanymodes
|
|
msgid "Compile many Modes ..."
|
|
msgstr "Viele Modi kompilieren ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompletecode
|
|
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Quelltext vervollständigen"
|
|
|
|
#: lazarusidestrconsts.lismenucompletecodeinteractive
|
|
msgid "Complete Code (with dialog)"
|
|
msgstr "Codevervollständigung (mit Dialog)"
|
|
|
|
#: lazarusidestrconsts.lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Kompilieren+Starten der Datei einrichten..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
|
msgid "Configure Custom Components ..."
|
|
msgstr "Externe Komponenten einrichten ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigexternaltools
|
|
msgid "Configure External Tools ..."
|
|
msgstr "Externe Werkzeuge einrichten ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "»Lazarus kompilieren« einrichten ..."
|
|
|
|
#: lazarusidestrconsts.lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr "Kontextsensitive Hilfe"
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
|
msgid "Convert Delphi Package to Lazarus Package ..."
|
|
msgstr "Delphi- in Lazarus-Package umwandeln ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
|
msgid "Convert Delphi Project to Lazarus Project ..."
|
|
msgstr "Delphi- in Lazarus-Projekt umwandeln ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
|
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
|
msgstr "Delphi- in Lazarus-Unit umwandeln ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
|
msgid "Convert Binary DFM to LFM ..."
|
|
msgstr "DFM- in LFM-Datei umwandeln ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertencoding
|
|
msgid "Convert Encoding of Projects/Packages ..."
|
|
msgstr "Kodierungen von Projekten/Packages umwandeln ..."
|
|
|
|
#: lazarusidestrconsts.lismenudebugwindows
|
|
msgid "Debug Windows"
|
|
msgstr "Debuggerfenster"
|
|
|
|
#: lazarusidestrconsts.lismenudelphiconversion
|
|
msgid "Delphi Conversion"
|
|
msgstr "Delphi-Umwandlung"
|
|
|
|
#: lazarusidestrconsts.lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "B&earbeiten"
|
|
|
|
#: lazarusidestrconsts.lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Vorlagen ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr "Kontextsensitive Hilfe bearbeiten"
|
|
|
|
#: lazarusidestrconsts.lismenueditinstallpkgs
|
|
msgid "Install/Uninstall Packages ..."
|
|
msgstr "Installierte Packages einrichten ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
|
|
#, object-pascal-format
|
|
msgid "Accelerator(&&) key \"%s\" needs changing"
|
|
msgstr "Schnellzugriffstaste (&&) \"%s\" muss geändert werden"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
|
|
msgid "Add a new item above selected item"
|
|
msgstr "Neuen Eintrag oberhalb des gewählten Eintrags hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
|
|
msgid "Add a new item after selected item"
|
|
msgstr "Neuen Eintrag nach gewähltem Eintrag hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
|
|
msgid "Add a new item before selected item"
|
|
msgstr "Neuen Eintrag vor gewähltem Eintrag hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
|
|
msgid "Add a new item below selected item"
|
|
msgstr "Neuen Eintrag unterhalb des gewählten Eintrags hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
|
|
msgid "Add a submenu at the right of selected item"
|
|
msgstr "Untermenü rechts von gewähltem Eintrag hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
|
|
msgid "Add a submenu below selected item"
|
|
msgstr "Untermenü unterhalb des gewählten Eintrags hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddfromtemplate
|
|
msgid "&Add from template ..."
|
|
msgstr "&Aus Vorlage hinzufügen ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddiconfroms
|
|
#, object-pascal-format
|
|
msgid "Add icon from %s"
|
|
msgstr "Icon hinzufügen aus %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddimagelisticon
|
|
msgid "Add imagelist &icon"
|
|
msgstr "Imagelisten-Icon hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddmenuitem
|
|
msgid "Add menu item"
|
|
msgstr "Menüeintrag hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemabove
|
|
msgid "&Add new item above"
|
|
msgstr "Neuen Eintrag oberhalb hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemafter
|
|
msgid "Add ne&w item after"
|
|
msgstr "Neuen Eintag danach einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembefore
|
|
msgid "&Add new item before"
|
|
msgstr "Neuen Eintrag davor einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembelow
|
|
msgid "Add ne&w item below"
|
|
msgstr "Neuen Eintrag unterhalb einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddonclickhandler
|
|
msgid "Add &OnClick handler"
|
|
msgstr "&OnClick-Handler hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorafter
|
|
msgid "Add separator &after"
|
|
msgstr "Trennlinie d&anach hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
|
|
msgid "Add separator &before"
|
|
msgstr "Trennlinie davor hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenu
|
|
msgid "Add submenu"
|
|
msgstr "Untermenü einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
|
|
msgid "Add &submenu below"
|
|
msgstr "Untermenü unterhalb einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenuright
|
|
msgid "Add &submenu right"
|
|
msgstr "Untermenü rechts einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
|
#, object-pascal-format
|
|
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
|
msgstr "Eine neue Menüvorlage namens \"%s\", basierend auf %s, mit %d Unterelementen, wurde gespeichert"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
|
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
|
msgstr "B&earbeiten,Basis für Bearbeiten-Menü,Rückgängig,Ctrl+Z,Wiede&rherstellen,,-,,&Alles auswählen,Ctrl+A,A&usschneiden,Ctrl+X,K&opieren,Ctrl+C,Einfügen,Ctrl+V,Paste &Special,,-,,Suchen,,&Ersetzen,,&Gehe zu ...,,"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
|
|
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
|
|
msgstr "Datei,Basis für Datei-Menü,&Neu,,Öffnen ...,,&Speichern,,Speichern unter,,-,,&Drucken,,D&rucker einrichten ...,,-,,Beenden,,"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
|
|
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
|
|
msgstr "&Hilfe,Basis für Hilfe-Menü,Hilfeinhalte,F1,Hilfe-&Index,,&Onlinehilfe,,-,,&Lizenzinformation,,Na&ch Updates suchen,,-,,Über,,"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
|
|
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
|
|
msgstr "Fenster,Basis für Fenster-Menü,&Neues Fenster,,Kachel,,Hintereinander,,&Alle anordnen,,-,,Verbergen,,Anzeigen,,"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaption
|
|
msgid "Caption"
|
|
msgstr "Beschriftung"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptioneditemss
|
|
#, object-pascal-format
|
|
msgid "Captioned items: %s"
|
|
msgstr "Beschriftete Einträge: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
|
|
msgid "Caption should not be blank"
|
|
msgstr "Beschriftung sollte nicht leer sein"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
|
|
#, object-pascal-format
|
|
msgid "Change conflicting accelerator \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
|
|
msgid "Change imagelist &icon"
|
|
msgstr "Imagelisten-Icon ändern"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
|
|
#, object-pascal-format
|
|
msgid "Change %s for %s"
|
|
msgstr "Ändere %s für %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
|
|
#, object-pascal-format
|
|
msgid "Change shortcut conflict \"%s\""
|
|
msgstr "Tastaturbefehl-Konflikt \"%s\" ändern"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
|
|
#, object-pascal-format
|
|
msgid "Change the shortCut for %s"
|
|
msgstr "Tastaturbefehl für %s ändern"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
|
|
#, object-pascal-format
|
|
msgid "Change the shortCutKey2 for %s"
|
|
msgstr "Tastaturbefehl2 für %s ändern"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
|
|
msgid "Choose template to delete"
|
|
msgstr "Vorlage zum Löschen auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
|
|
msgid "Choose template to insert"
|
|
msgstr "Vorlage zum Einfügen auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
|
|
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
|
|
msgid "Component is unexpected kind"
|
|
msgstr "Komponente besitzt unerwartete Art"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
|
|
msgid "Component is unnamed"
|
|
msgstr "Komponente ist unbenannt"
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
|
|
msgid "<conflict resolution complete>"
|
|
msgstr "<Konfliktauflösung komplett>"
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
|
|
#, object-pascal-format
|
|
msgid "Conflicts found initially: %d"
|
|
msgstr "Eingangs gefundene Konflikte: %d"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
|
|
#, object-pascal-format
|
|
msgid "Deepest nested menu level: %s"
|
|
msgstr "Tiefstes verschachteltes Menü-Level: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteitem
|
|
msgid "&Delete item"
|
|
msgstr "Eintrag löschen"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletemenutemplate
|
|
msgid "&Delete menu template ..."
|
|
msgstr "Menü-Vorlage löschen ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
|
|
msgid "Delete saved menu template"
|
|
msgstr "Gespeicherte Menüvorlage löschen"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
|
|
msgid "Delete selected menu template"
|
|
msgstr "Gewählte Menüvorlage löschen"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
|
|
msgid "Delete this item and its subitems?"
|
|
msgstr "Diesen Eintrag und seine Unterelemente löschen?"
|
|
|
|
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
|
|
msgid "Display preview as &Popup menu"
|
|
msgstr "Vorschau als &Popup-Menü anzeigen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditcaption
|
|
msgid "Edit &Caption"
|
|
msgstr "Beschriftung ändern"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
|
|
#, object-pascal-format
|
|
msgid "Editing Caption of %s"
|
|
msgstr "Beschriftung von %s bearbeiten"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsdots
|
|
#, object-pascal-format
|
|
msgid "To resolve conflict edit %s.%s"
|
|
msgstr "Um den Konflikt aufzulösen bearbeiten Sie %s.%s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsfors
|
|
#, object-pascal-format
|
|
msgid "Editing %s for %s"
|
|
msgstr "Bearbeite %s für %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
|
|
#, object-pascal-format
|
|
msgid "Editing %s.%s - no menuitem selected"
|
|
msgstr "Bearbeite %s.%s - kein Menüeintrag ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteramenudescription
|
|
msgid "Enter a menu &Description:"
|
|
msgstr "Geben Sie eine Menübeschreibung ein:"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
|
|
#, object-pascal-format
|
|
msgid "Enter a new ShortCut for %s"
|
|
msgstr "Geben Sie einen neuen Tastaturbefehl für %s ein"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
|
|
#, object-pascal-format
|
|
msgid "Enter a new ShortCutKey2 for %s"
|
|
msgstr "Geben Sie einen neuen Tastaturbefehl2 für %s ein"
|
|
|
|
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
|
|
msgid "Existing saved templates"
|
|
msgstr "Existierende gespeicherte Vorlagen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
|
|
msgid "Further shortcut conflict"
|
|
msgstr "Weiterer Tastaturbefehl-Konflikt"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
|
|
msgid "Get help to use this editor"
|
|
msgstr "Hilfe für die Verwendung dieses Editors"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgrabkey
|
|
msgid "&Grab key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexd
|
|
#, object-pascal-format
|
|
msgid "GroupIndex: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
|
|
#, object-pascal-format
|
|
msgid "Values in use: %s"
|
|
msgstr "GroupIndex-Wert(e): %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinadequatedescription
|
|
msgid "Inadequate Description"
|
|
msgstr "Unzureichende Beschriftung"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
|
|
#, object-pascal-format
|
|
msgid "Insert menu template into root of %s"
|
|
msgstr "Menüvorlage in Wurzel von %s einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
|
|
msgid "Insert selected menu template"
|
|
msgstr "Gewählte Menüvorlage einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorisnotassigned
|
|
msgid "is not assigned"
|
|
msgstr "ist nicht zugewiesen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoritemswithicons
|
|
#, object-pascal-format
|
|
msgid "Items with icon: %s"
|
|
msgstr "Einträge mit Icon: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
|
|
#, object-pascal-format
|
|
msgid "List shortcuts and &accelerators for %s ..."
|
|
msgstr "Tastaturbefehle auflisten für %s ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
|
|
#, object-pascal-format
|
|
msgid "List shortcuts for %s ..."
|
|
msgstr "Tastaturbefehle auflisten für %s ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Menüeditor"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemactions
|
|
msgid "Menu Item actions"
|
|
msgstr "Menüeintrag-Aktionen"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
|
|
#, object-pascal-format
|
|
msgid "Menuitem shortcut conflicts in %s"
|
|
msgstr "Menüeintrag-Tastaturbefehl-Konflikte in %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemdown
|
|
msgid "Mo&ve item down"
|
|
msgstr "Eintrag nach unten"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemleft
|
|
msgid "&Move item left"
|
|
msgstr "Eintrag nach links"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemright
|
|
msgid "Mo&ve item right"
|
|
msgstr "Eintrag nach rechts"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemup
|
|
msgid "&Move item up"
|
|
msgstr "Eintrag nach oben"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr "Gewähltes Element nach unten"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
|
|
msgid "Move selected item to the left"
|
|
msgstr "Gewählten Eintrag nach links verschieben"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
|
|
msgid "Move selected item to the right"
|
|
msgstr "Gewählten Eintrag nach rechts verschieben"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr "Gewähltes Element nach oben"
|
|
|
|
#: lazarusidestrconsts.lismenueditorna
|
|
msgid "n/a"
|
|
msgstr "k.A."
|
|
|
|
#: lazarusidestrconsts.lismenueditornomenuselected
|
|
msgid "(no menu selected)"
|
|
msgstr "(kein Menü ausgewählt)"
|
|
|
|
#: lazarusidestrconsts.lismenueditornone
|
|
msgid "<none>"
|
|
msgstr "<keine>"
|
|
|
|
#: lazarusidestrconsts.lismenueditornonenone
|
|
msgid "<none>,<none>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
|
|
msgid "<no shortcut conflicts>"
|
|
msgstr "<keine Tastaturbefehl-Konflikte>"
|
|
|
|
#: lazarusidestrconsts.lismenueditornousersavedtemplates
|
|
msgid "No user-saved templates"
|
|
msgstr "Keine benutzergespeicherten Vorlagen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorpickaniconfroms
|
|
#, object-pascal-format
|
|
msgid "Pick an icon from %s"
|
|
msgstr "Ein Icon aus %s auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorpopupassignmentss
|
|
#, object-pascal-format
|
|
msgid "Popup assignments: %s"
|
|
msgstr "Popup-Zuweisungen: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorradioitem
|
|
msgid "RadioItem"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorremainingconflictss
|
|
#, object-pascal-format
|
|
msgid "Remaining conflicts: %s"
|
|
msgstr "Verbleibende Konflikte: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorremoveallseparators
|
|
msgid "&Remove all separators"
|
|
msgstr "Alle Trennlinien entfe&rnen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolvedconflictss
|
|
#, object-pascal-format
|
|
msgid "Resolved conflicts: %s"
|
|
msgstr "Aufgelöste Konflikte: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
|
|
msgid "Resolve selected conflict"
|
|
msgstr "Gewählte Konflikte auflösen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
|
|
msgid "&Resolve shortcut conflicts ..."
|
|
msgstr "Tastaturbefehl-Konflikte ausflösen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavedtemplates
|
|
msgid "Saved templates"
|
|
msgstr "gespeicherte Vorlagen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
|
|
msgid "&Save menu as a template ..."
|
|
msgstr "Menü als Vorlage &speichern ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
|
|
msgid "Save menu as template"
|
|
msgstr "Menü als Vorlage speichern"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
|
|
msgid "Save menu as template for future use"
|
|
msgstr "Menü als Vorlage für zukünftige Verwendung speichern"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
|
|
msgid "Save menu shown as a new template"
|
|
msgstr "Angezeigtes Menü als neue Vorlage speichern"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
|
#, object-pascal-format
|
|
msgid "%s conflicts with %s"
|
|
msgstr "%s ist im Konflikt mit %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorseparators
|
|
msgid "Se¶tors"
|
|
msgstr "Trennlinien"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutitemss
|
|
#, object-pascal-format
|
|
msgid "Shortcut items: %s"
|
|
msgstr "Einträge mit Tastaturbefehl: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
|
|
msgid "Shortcut not yet changed"
|
|
msgstr "Tastaturbefehl noch nicht geändert"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts
|
|
msgid "Shortcuts"
|
|
msgstr "Tastaturbefehle"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts2
|
|
msgid "Shortc&uts"
|
|
msgstr "Tastat&urbefehle"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
|
|
msgid "Shortcuts and Accelerator keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts (%d) and Accelerator keys (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
|
|
msgid "Shortcut,Source Property"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedins
|
|
#, object-pascal-format
|
|
msgid "Shortcuts used in %s"
|
|
msgstr "Verwendete Tastaturbefehle in %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts used in %s (%d)"
|
|
msgstr "Verwendete Tastaturbefehle in %s (%d)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsins
|
|
#, object-pascal-format
|
|
msgid "\"%s\" in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"\"%s\" is already in use in %s as a shortcut.\n"
|
|
"Try a different shortcut."
|
|
msgstr ""
|
|
"\"%s\" wird bereits als Tastenkürzel für %s verwendet.\n"
|
|
"Versuchen Sie ein anderes Tastenkürzel."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
|
|
#, object-pascal-format
|
|
msgid "Please expand: \"%s\" is not a sufficient Description"
|
|
msgstr "Bitte erweitern: \"%s\" ist keine ausreichende Beschreibung."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcuts
|
|
#, object-pascal-format
|
|
msgid "%s: Shortcuts"
|
|
msgstr "%s: Tastaturbefehle"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
|
|
#, object-pascal-format
|
|
msgid "%s: Shortcuts and accelerator keys"
|
|
msgstr "%s: Tastenkürzel und Schnellzugriffstasten"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsssonclicks
|
|
#, object-pascal-format
|
|
msgid "%s.%s.%s - OnClick: %s"
|
|
msgstr "%s.%s.%s - OnClick: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorstandardtemplates
|
|
msgid "Standard templates"
|
|
msgstr "Standardvorlagen"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatedescription
|
|
msgid "Template description:"
|
|
msgstr "Vorlagenbeschriftung:"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplates
|
|
msgid "&Templates"
|
|
msgstr "Vorlagen"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatesaved
|
|
msgid "Template saved"
|
|
msgstr "Vorlage gespeichert"
|
|
|
|
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
|
|
msgid ""
|
|
"There are no user-saved menu templates.\n"
|
|
"\n"
|
|
"Only standard default templates are available."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
|
|
#, object-pascal-format
|
|
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
|
|
msgstr "TSCList.GetScanListCompName: ungültiger Index %d für FScanList"
|
|
|
|
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"You have to change the shortcut from %s\n"
|
|
"to avoid a conflict"
|
|
msgstr ""
|
|
"Sie müssen den Tastaturbefehl von %s ändern,\n"
|
|
"um einen Konflikt zu vermeiden"
|
|
|
|
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
|
|
msgid "You must enter text for the Caption"
|
|
msgstr "Sie müssen einen Text für die Beschriftung eingeben"
|
|
|
|
#: lazarusidestrconsts.lismenuencloseinifdef
|
|
msgid "Enclose in $IFDEF ..."
|
|
msgstr "In $IFDEF einschließen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuencloseselection
|
|
msgid "Enclose Selection ..."
|
|
msgstr "Auswahl einschließen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuevaluate
|
|
msgid "E&valuate/Modify ..."
|
|
msgstr "Prüfen/Ändern ..."
|
|
|
|
#: lazarusidestrconsts.lismenuextractproc
|
|
msgid "Extract Procedure ..."
|
|
msgstr "Prozedur extrahieren ..."
|
|
|
|
#: lazarusidestrconsts.lismenufile
|
|
msgid "&File"
|
|
msgstr "&Datei"
|
|
|
|
#: lazarusidestrconsts.lismenufind
|
|
msgctxt "lazarusidestrconsts.lismenufind"
|
|
msgid "Find"
|
|
msgstr "Suchen"
|
|
|
|
#: lazarusidestrconsts.lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr "&Suchen ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
|
msgid "Find Other End of Code Block"
|
|
msgstr "Anderes Ende des Quelltextblocks suchen"
|
|
|
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
|
msgid "Find Start of Code Block"
|
|
msgstr "Zu Quelltextblockanfang gehen"
|
|
|
|
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
|
msgid "Find Declaration at Cursor"
|
|
msgstr "Deklaration unter Cursor suchen"
|
|
|
|
#: lazarusidestrconsts.lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Bezeichnerreferenzen suchen ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindinfiles
|
|
msgid "Find &in Files ..."
|
|
msgstr "&In Dateien suchen ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "&Weitersuchen"
|
|
|
|
#: lazarusidestrconsts.lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "&Rückwärts suchen"
|
|
|
|
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
|
msgid "Find References Of Used Unit"
|
|
msgstr "Finde Referenzen benutzter Units"
|
|
|
|
#: lazarusidestrconsts.lismenugeneraloptions
|
|
msgid "Options ..."
|
|
msgstr "Einstellungen ..."
|
|
|
|
#: lazarusidestrconsts.lismenugotoincludedirective
|
|
msgid "Goto Include Directive"
|
|
msgstr "Zu Include-Anweisung springen"
|
|
|
|
#: lazarusidestrconsts.lismenugotoline
|
|
msgid "Goto Line ..."
|
|
msgstr "Zu Zeile springen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
|
msgid "Guess Misplaced IFDEF/ENDIF"
|
|
msgstr "Offene IFDEF/ENDIF erraten"
|
|
|
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
|
msgid "Guess Unclosed Block"
|
|
msgstr "Offene Quelltextblöcke erraten"
|
|
|
|
#: lazarusidestrconsts.lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "&Hilfe"
|
|
|
|
#: lazarusidestrconsts.lismenuideinternals
|
|
msgid "IDE Internals"
|
|
msgstr "IDE-Interna"
|
|
|
|
#: lazarusidestrconsts.lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Inkrementelle Suche"
|
|
|
|
#: lazarusidestrconsts.lismenuindentselection
|
|
msgid "Indent Selection"
|
|
msgstr "Auswahl einrücken"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
|
msgid "ChangeLog Entry"
|
|
msgstr "Eintrag für Änderungsprotokoll"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcharacter
|
|
msgid "Insert from Character Map ..."
|
|
msgstr "Aus der Zeichentabelle einfügen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
|
msgid "Insert CVS Keyword"
|
|
msgstr "CVS-Schlüsselwort einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertdatetime
|
|
msgid "Current Date and Time"
|
|
msgstr "Aktuelles Datum und Uhrzeit"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertfilename
|
|
msgid "Insert Full Filename ..."
|
|
msgstr "Vollen Dateinamen einfügen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgeneral
|
|
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
|
msgid "Insert General"
|
|
msgstr "Einfügen allgemein"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnotice
|
|
msgid "GPL Notice"
|
|
msgstr "GPL-Hinweis"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
|
msgid "GPL Notice (translated)"
|
|
msgstr "GPL-Hinweis (übersetzt)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
|
msgid "LGPL Notice"
|
|
msgstr "LGPL-Hinweis"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
|
msgid "LGPL Notice (translated)"
|
|
msgstr "LGPL-Hinweis (übersetzt)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnotice
|
|
msgid "MIT Notice"
|
|
msgstr "MIT-Hinweis"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
|
msgid "MIT Notice (translated)"
|
|
msgstr "MIT-Notiz (übersetzt)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL Notice"
|
|
msgstr "Angepaßter LGPL-Hinweis"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
|
msgid "Modified LGPL Notice (translated)"
|
|
msgstr "Angepaßter LGPL-Hinweis (übersetzt)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertusername
|
|
msgid "Current Username"
|
|
msgstr "Aktueller Benutzername"
|
|
|
|
#: lazarusidestrconsts.lismenuinspect
|
|
msgctxt "lazarusidestrconsts.lismenuinspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "&Inspizieren ..."
|
|
|
|
#: lazarusidestrconsts.lismenujumpback
|
|
msgctxt "lazarusidestrconsts.lismenujumpback"
|
|
msgid "Jump Back"
|
|
msgstr "Zurückspringen"
|
|
|
|
#: lazarusidestrconsts.lismenujumpforward
|
|
msgctxt "lazarusidestrconsts.lismenujumpforward"
|
|
msgid "Jump Forward"
|
|
msgstr "Vorwärtsspringen"
|
|
|
|
#: lazarusidestrconsts.lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Springe zu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementation
|
|
msgid "Jump to Implementation"
|
|
msgstr "Zur Implementierung springen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
|
msgid "Jump to Implementation uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoinitialization
|
|
msgid "Jump to Initialization"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerface
|
|
msgid "Jump to Interface"
|
|
msgstr "Springe zum Interface"
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
|
msgid "Jump to Interface uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptonextbookmark
|
|
msgid "Jump to Next Bookmark"
|
|
msgstr "Springe zum nächsten Lesezeichen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonexterror
|
|
msgid "Jump to Next Error"
|
|
msgstr "Zum nächsten Fehler springen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
|
msgid "Jump to Previous Bookmark"
|
|
msgstr "Springe zum vorherigen Lesezeichen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptopreverror
|
|
msgid "Jump to Previous Error"
|
|
msgstr "Zum vorherigen Fehler springen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
|
msgid "Jump to Procedure begin"
|
|
msgstr "Zum Prozedurbeginn springen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
|
msgid "Jump to Procedure header"
|
|
msgstr "Zum Prozedurkopf springen"
|
|
|
|
#: lazarusidestrconsts.lismenulowercaseselection
|
|
msgid "Lowercase Selection"
|
|
msgstr "Auswahl kleinschreiben"
|
|
|
|
#: lazarusidestrconsts.lismenumacrolistview
|
|
msgctxt "lazarusidestrconsts.lismenumacrolistview"
|
|
msgid "Editor Macros"
|
|
msgstr "Editormakros"
|
|
|
|
#: lazarusidestrconsts.lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Ressourcenstring erzeugen ..."
|
|
|
|
#: lazarusidestrconsts.lismenumultipaste
|
|
msgctxt "lazarusidestrconsts.lismenumultipaste"
|
|
msgid "MultiPaste ..."
|
|
msgstr "Mehrfach einfügen ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewcomponent
|
|
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Neue Komponente"
|
|
|
|
#: lazarusidestrconsts.lismenunewcustom
|
|
#, object-pascal-format
|
|
msgid "New %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Neues Formular"
|
|
|
|
#: lazarusidestrconsts.lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Neu ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewpackage
|
|
msgid "New Package ..."
|
|
msgstr "Neues Package ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Neues Projekt ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewprojectfromfile
|
|
msgid "New Project from File ..."
|
|
msgstr "Neues Projekt aus Datei ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewunit
|
|
msgctxt "lazarusidestrconsts.lismenunewunit"
|
|
msgid "New Unit"
|
|
msgstr "Neue Unit"
|
|
|
|
#: lazarusidestrconsts.lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Online-Hilfe"
|
|
|
|
#: lazarusidestrconsts.lismenuopen
|
|
msgid "&Open ..."
|
|
msgstr "Öffnen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
|
msgid "Open Filename at Cursor"
|
|
msgstr "Datei unter Cursor öffnen"
|
|
|
|
#: lazarusidestrconsts.lismenuopenfolder
|
|
msgid "Open Folder ..."
|
|
msgstr "Ordner öffnen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackage
|
|
msgid "Open Loaded Package ..."
|
|
msgstr "Geladenes Package öffnen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
|
msgid "Open Package File (.lpk) ..."
|
|
msgstr "Package-Datei (.lpk) öffnen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
|
msgid "Open Package of Current Unit"
|
|
msgstr "Package der aktuellen Unit öffnen"
|
|
|
|
#: lazarusidestrconsts.lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Projekt öffnen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecent
|
|
msgid "Open &Recent"
|
|
msgstr "Wieder öffnen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentpkg
|
|
msgid "Open Recent Package"
|
|
msgstr "Letzte Packages ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentproject
|
|
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
|
msgid "Open Recent Project"
|
|
msgstr "Letzte Projekte ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenunit
|
|
msgid "Open Unit ..."
|
|
msgstr "Unit öffnen ..."
|
|
|
|
#: lazarusidestrconsts.lismenupackage
|
|
msgid "Pa&ckage"
|
|
msgstr "Pa&ckage"
|
|
|
|
#: lazarusidestrconsts.lismenupackagegraph
|
|
msgid "Package Graph"
|
|
msgstr "Package-Graph"
|
|
|
|
#: lazarusidestrconsts.lismenupackagelinks
|
|
msgid "Package Links ..."
|
|
msgstr "Package-Links ..."
|
|
|
|
#: lazarusidestrconsts.lismenupastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
|
msgid "Paste from clipboard"
|
|
msgstr "Aus Zwischenablage einfügen"
|
|
|
|
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
|
msgid "New package component"
|
|
msgstr "Neue Package-Komponente"
|
|
|
|
#: lazarusidestrconsts.lismenuprocedurelist
|
|
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
|
msgid "Procedure List ..."
|
|
msgstr "Prozedur-Liste ..."
|
|
|
|
#: lazarusidestrconsts.lismenuproject
|
|
msgid "&Project"
|
|
msgstr "&Projekt"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Projektinspektor"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Projekteinstellungen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuprojectrun
|
|
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
|
msgid "&Run"
|
|
msgstr "Sta&rt"
|
|
|
|
#: lazarusidestrconsts.lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Projekt veröffentlichen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuquickcompile
|
|
msgid "Quick Compile"
|
|
msgstr "Schnelles Kompilieren"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
|
msgid "Quick Syntax Check"
|
|
msgstr "Schnelle Syntaxprüfung"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
|
msgid "Quick syntax check OK"
|
|
msgstr "Schnelle Syntaxprüfung OK"
|
|
|
|
#: lazarusidestrconsts.lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Aus Projekt entfernen ..."
|
|
|
|
#: lazarusidestrconsts.lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Bezeichner umbenennen ..."
|
|
|
|
#: lazarusidestrconsts.lismenurenamelowercase
|
|
msgid "Rename Unit Files to LowerCase ..."
|
|
msgstr "Unit-Dateien in Kleinbuchstaben umbenennen..."
|
|
|
|
#: lazarusidestrconsts.lismenureportingbug
|
|
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
|
msgid "Reporting a Bug"
|
|
msgstr "Fehler melden ..."
|
|
|
|
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
|
msgid "Resave forms with enabled i18n"
|
|
msgstr "Formulare mit i18n neu speichern"
|
|
|
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
|
msgid "Rescan FPC Source Directory"
|
|
msgstr "FPC-Quelltextverzeichnis neu einlesen"
|
|
|
|
#: lazarusidestrconsts.lismenuresetdebugger
|
|
msgid "Reset Debugger"
|
|
msgstr "Debugger zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Wiederherstellen"
|
|
|
|
#: lazarusidestrconsts.lismenurevertconfirm
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"Discard all unsaved changes in\n"
|
|
"\"%s\"?\n"
|
|
"\n"
|
|
"This action cannot be undone and will affect all editor tabs with the file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurun
|
|
msgctxt "lazarusidestrconsts.lismenurun"
|
|
msgid "&Run"
|
|
msgstr "Sta&rt"
|
|
|
|
#: lazarusidestrconsts.lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Datei ausführen"
|
|
|
|
#: lazarusidestrconsts.lismenurunparameters
|
|
msgid "Run &Parameters ..."
|
|
msgstr "Start¶meter ..."
|
|
|
|
#: lazarusidestrconsts.lismenuruntocursor
|
|
msgctxt "lazarusidestrconsts.lismenuruntocursor"
|
|
msgid "Run to Cursor"
|
|
msgstr "Start bis Cursor"
|
|
|
|
#: lazarusidestrconsts.lismenurunwithdebugging
|
|
msgid "Run with Debugging"
|
|
msgstr "Start mit Debugger"
|
|
|
|
#: lazarusidestrconsts.lismenurunwithoutdebugging
|
|
msgid "Run without Debugging"
|
|
msgstr "Start ohne Debugger"
|
|
|
|
#: lazarusidestrconsts.lismenusave
|
|
msgctxt "lazarusidestrconsts.lismenusave"
|
|
msgid "&Save"
|
|
msgstr "Speichern"
|
|
|
|
#: lazarusidestrconsts.lismenusaveas
|
|
msgid "Save &As ..."
|
|
msgstr "Speichern unter ..."
|
|
|
|
#: lazarusidestrconsts.lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Projekt speichern"
|
|
|
|
#: lazarusidestrconsts.lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Projekt speichern unter ..."
|
|
|
|
#: lazarusidestrconsts.lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Suchen"
|
|
|
|
#: lazarusidestrconsts.lismenuselect
|
|
msgid "Select"
|
|
msgstr "Auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenuselectall
|
|
msgctxt "lazarusidestrconsts.lismenuselectall"
|
|
msgid "Select All"
|
|
msgstr "Alles auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenuselectcodeblock
|
|
msgid "Select Code Block"
|
|
msgstr "Quelltextblock auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenuselectline
|
|
msgid "Select Line"
|
|
msgstr "Zeile auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenuselectparagraph
|
|
msgid "Select Paragraph"
|
|
msgstr "Absatz auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenuselecttobrace
|
|
msgid "Select to Brace"
|
|
msgstr "Bis zur Klammer"
|
|
|
|
#: lazarusidestrconsts.lismenuselectword
|
|
msgid "Select Word"
|
|
msgstr "Wort auswählen"
|
|
|
|
#: lazarusidestrconsts.lismenusetfreebookmark
|
|
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Freies Lesezeichen setzen"
|
|
|
|
#: lazarusidestrconsts.lismenushowexecutionpoint
|
|
msgid "S&how Execution Point"
|
|
msgstr "Ausführungspunkt anzeigen"
|
|
|
|
#: lazarusidestrconsts.lismenushowsmarthint
|
|
msgid "Context sensitive smart hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusortselection
|
|
msgid "Sort Selection ..."
|
|
msgstr "Auswahl sortieren ..."
|
|
|
|
#: lazarusidestrconsts.lismenusource
|
|
msgid "S&ource"
|
|
msgstr "Quelltext"
|
|
|
|
#: lazarusidestrconsts.lismenuswapcaseselection
|
|
msgid "Swap Case in Selection"
|
|
msgstr "Schreibung in Auswahl umschalten"
|
|
|
|
#: lazarusidestrconsts.lismenutabstospacesselection
|
|
msgid "Tabs to Spaces in Selection"
|
|
msgstr "Tabulatoren in Auswahl in Leerzeichen umwandeln"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateabout
|
|
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
|
msgid "About"
|
|
msgstr "Über"
|
|
|
|
#: lazarusidestrconsts.lismenutogglecomment
|
|
msgid "Toggle Comment in Selection"
|
|
msgstr "Kommentar umschalten"
|
|
|
|
#: lazarusidestrconsts.lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Werkzeuge"
|
|
|
|
#: lazarusidestrconsts.lismenuuncommentselection
|
|
msgid "Uncomment Selection"
|
|
msgstr "Auswahl entkommentieren"
|
|
|
|
#: lazarusidestrconsts.lismenuunindentselection
|
|
msgid "Unindent Selection"
|
|
msgstr "Auswahl ausrücken"
|
|
|
|
#: lazarusidestrconsts.lismenuuppercaseselection
|
|
msgid "Uppercase Selection"
|
|
msgstr "Auswahl großschreiben"
|
|
|
|
#: lazarusidestrconsts.lismenuuseunit
|
|
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
|
msgid "Add Unit to Uses Section ..."
|
|
msgstr "Unit zum uses Abschnitt hinzufügen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuview
|
|
msgid "&View"
|
|
msgstr "&Ansicht"
|
|
|
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
|
msgid "Anchor Editor"
|
|
msgstr "Ankereditor anzeigen"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Code-Browser"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "CodeExplorer ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
|
msgid "Component Palette"
|
|
msgstr "Komponentenpalette"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Komponenten"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugevents
|
|
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
|
msgid "Event Log"
|
|
msgstr "Ereignis-Protokoll"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugoutput
|
|
msgid "Debug Output"
|
|
msgstr "Debuggerausgaben"
|
|
|
|
#: lazarusidestrconsts.lismenuviewforms
|
|
msgid "Forms ..."
|
|
msgstr "Formulare ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewhistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
|
msgid "History"
|
|
msgstr "Historie"
|
|
|
|
#: lazarusidestrconsts.lismenuviewjumphistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Sprungliste anzeigen"
|
|
|
|
#: lazarusidestrconsts.lismenuviewlocalvariables
|
|
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
|
|
msgid "Local Variables"
|
|
msgstr "Lokale Variablen"
|
|
|
|
#: lazarusidestrconsts.lismenuviewmessages
|
|
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
|
msgid "Messages"
|
|
msgstr "Nachrichten"
|
|
|
|
#: lazarusidestrconsts.lismenuviewobjectinspector
|
|
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
|
msgid "Object Inspector"
|
|
msgstr "Objektinspektor"
|
|
|
|
#: lazarusidestrconsts.lismenuviewprojectsource
|
|
msgid "&View Project Source"
|
|
msgstr ".lpr-Datei anzeigen"
|
|
|
|
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
|
|
msgid "Console In/Output"
|
|
msgstr "Terminal-Ein/Ausgabe"
|
|
|
|
#: lazarusidestrconsts.lismenuviewregisters
|
|
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
|
msgid "Registers"
|
|
msgstr "Register"
|
|
|
|
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr "Browser für bedingte Eigenschaften"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Suchergebnisse"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsourceeditor
|
|
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Quelltexteditor"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtaborder
|
|
msgid "Tab Order"
|
|
msgstr "Tabulatorreihenfolge"
|
|
|
|
#: lazarusidestrconsts.lismenuviewthreads
|
|
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
|
msgid "Threads"
|
|
msgstr "Threads"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
|
msgid "Toggle Form/Unit View"
|
|
msgstr "Formular-/Unit-Ansicht umschalten"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
|
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Unit-Abhängigkeiten anzeigen"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
|
msgid "Unit Information ..."
|
|
msgstr "Unit-Informationen anzeigen"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunits
|
|
msgid "Units ..."
|
|
msgstr "Units ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewwatches
|
|
msgctxt "lazarusidestrconsts.lismenuviewwatches"
|
|
msgid "Watches"
|
|
msgstr "Überwachte Ausdrücke"
|
|
|
|
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
|
msgid "What Needs Building"
|
|
msgstr "Noch zu erstellen"
|
|
|
|
#: lazarusidestrconsts.lismenuwindow
|
|
msgid "&Window"
|
|
msgstr "&Fenster"
|
|
|
|
#: lazarusidestrconsts.lismeother
|
|
msgctxt "lazarusidestrconsts.lismeother"
|
|
msgid "Other tabs"
|
|
msgstr "Andere Tabs"
|
|
|
|
#: lazarusidestrconsts.lismessageseditor
|
|
msgid "Messages Editor"
|
|
msgstr "Nachrichten-Editor"
|
|
|
|
#: lazarusidestrconsts.lismessageswindow
|
|
msgid "Messages Window"
|
|
msgstr "Nachrichtenfenster"
|
|
|
|
#: lazarusidestrconsts.lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr "Methodenklasse nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lismissingdirectory
|
|
#, object-pascal-format
|
|
msgid "missing directory \"%s\""
|
|
msgstr "fehlendes Verzeichnis \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr "Fehlende Events"
|
|
|
|
#: lazarusidestrconsts.lismissingexecutable
|
|
#, object-pascal-format
|
|
msgid "missing executable \"%s\""
|
|
msgstr "fehlende ausführbare Datei \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr "Fehlende Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Fehlende Packages"
|
|
|
|
#: lazarusidestrconsts.lismissingunitschoices
|
|
msgid "Your choices are:"
|
|
msgstr "Ihre Auswahl ist:"
|
|
|
|
#: lazarusidestrconsts.lismissingunitscomment
|
|
msgid "Comment Out"
|
|
msgstr "Auskommentieren"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsfordelphi
|
|
msgid "For Delphi only"
|
|
msgstr "Nur für Delphi"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1
|
|
msgid "1) Comment out the selected units."
|
|
msgstr "1) Alle fehlenden Units auskommentieren (übergehen)."
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1b
|
|
msgid "1) Use the units only for Delphi."
|
|
msgstr "1) Units nur bei Delphi einbinden"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo2
|
|
msgid "2) Search for units. Found paths are added to project settings."
|
|
msgstr "2) Unit-Pfad auswählen, der zu den Projekteinstellungen hinzugefügt wird."
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo3
|
|
msgid "3) Leave these units in uses sections as they are."
|
|
msgstr "3) Diese Units unverändert in den uses-Abschnitten lassen."
|
|
|
|
#: lazarusidestrconsts.lismissingunitssearch
|
|
msgid "Search Unit Path"
|
|
msgstr "Unit-Pfade durchsuchen"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsskip
|
|
msgctxt "lazarusidestrconsts.lismissingunitsskip"
|
|
msgid "Skip"
|
|
msgstr "Überspringen"
|
|
|
|
#: lazarusidestrconsts.lismitnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (c) <year> <copyright holders>\n"
|
|
"\n"
|
|
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
|
"\n"
|
|
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
|
"\n"
|
|
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmadditionsandoverrides
|
|
msgid "Additions and Overrides"
|
|
msgstr "Hinzufügungen und Beeinflussungen"
|
|
|
|
#: lazarusidestrconsts.lismmaddscustomoptions
|
|
msgid "Adds custom options:"
|
|
msgstr "Fügt benutzerdefinierte Optionen hinzu:"
|
|
|
|
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
|
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
|
msgstr "Beliebige FPC-Optionen hinzufügen, z.B. -O1 -ghtl -dFlag"
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackages
|
|
msgid "Apply to all packages."
|
|
msgstr "Für alle Packages anwenden"
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
|
msgid "Apply to all packages and projects."
|
|
msgstr "Für alle Packages und Projekte anwenden"
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
|
#, object-pascal-format
|
|
msgid "Apply to all packages matching name \"%s\""
|
|
msgstr "Für alle Packages anwenden, deren Name zu \"%s\" passt"
|
|
|
|
#: lazarusidestrconsts.lismmapplytoproject
|
|
msgid "Apply to project."
|
|
msgstr "Für das Projekt anwenden"
|
|
|
|
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
|
msgid "Create a new group of options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmcustomoption
|
|
msgid "Custom Option"
|
|
msgstr "Benutzerdefinierte Option"
|
|
|
|
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
|
msgid "Delete the selected target or option"
|
|
msgstr "Gewähltes Ziel oder Option löschen"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
|
msgid "Does not add custom options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
|
#, object-pascal-format
|
|
msgid "Does not have IDE Macro %s:=%s"
|
|
msgstr "Besitzt kein IDE-Makro %s:=%s"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
|
msgid "Does not override OutDir (-FU)"
|
|
msgstr "Ausgabeverzeichnis nicht ersetzen (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
|
#, object-pascal-format
|
|
msgid "Exclude all packages matching name \"%s\""
|
|
msgstr "Schließe alle Packages aus, die \"%s\" entsprechen"
|
|
|
|
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
|
#, object-pascal-format
|
|
msgid "expected \":=\" after macro name but found \"%s\""
|
|
msgstr "\":=\" nach Makroname erwartet, aber \"%s\" gefunden"
|
|
|
|
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
|
#, object-pascal-format
|
|
msgid "expected macro name but found \"%s\""
|
|
msgstr "Makroname erwartet, aber \"%s\" gefunden"
|
|
|
|
#: lazarusidestrconsts.lismmfromto
|
|
#, object-pascal-format
|
|
msgid "From %s to %s"
|
|
msgstr "Von %s zu %s"
|
|
|
|
#: lazarusidestrconsts.lismmidemacro
|
|
msgid "IDE Macro"
|
|
msgstr "IDE-Makro"
|
|
|
|
#: lazarusidestrconsts.lismmidemacro2
|
|
#, object-pascal-format
|
|
msgid "IDE Macro %s:=%s"
|
|
msgstr "IDE-Makro %s:=%s"
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterat
|
|
#, object-pascal-format
|
|
msgid "invalid character \"%s\" at %s"
|
|
msgstr "ungültiges Zeichen \"%s\" bei %s"
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
|
#, object-pascal-format
|
|
msgid "invalid character in macro value \"%s\""
|
|
msgstr "ungültiges Zeichen im Makrowert \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmmissingmacroname
|
|
msgid "missing macro name"
|
|
msgstr "fehlender Makroname"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr "Gewähltes Element nach unten"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr "Gewähltes Element nach oben"
|
|
|
|
#: lazarusidestrconsts.lismmnewtarget
|
|
msgid "New Target"
|
|
msgstr "Neues Ziel"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
|
#, object-pascal-format
|
|
msgid "Override OutDir (-FU): %s"
|
|
msgstr "Ausgabeverzeichnis ersetzen (-FU): %s"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
|
msgid "Override output directory (-FU)"
|
|
msgstr "Ausgabeverzeichnis ersetzen (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
|
msgid "Override output directory -FU of target"
|
|
msgstr "Ausgabeverzeichnis -FU des Ziels ersetzen"
|
|
|
|
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
|
msgid "Redo last undo to this grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
|
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsets
|
|
#, object-pascal-format
|
|
msgid "Set \"%s\""
|
|
msgstr "Setze \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
|
msgid "Stored in IDE (environmentoptions.xml)"
|
|
msgstr "Gespeichert in der IDE (environmentoptions.xml)"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
|
msgid "Stored in project (.lpi)"
|
|
msgstr "Gespeichert im Projekt (.lpi)"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
|
msgid "Stored in session of project (.lps)"
|
|
msgstr "Gespeichert in der Projektsitzung (.lps)"
|
|
|
|
#: lazarusidestrconsts.lismmtargets
|
|
msgid "Targets: "
|
|
msgstr "Ziele: "
|
|
|
|
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
|
msgid "Undo last change to this grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmvalues
|
|
#, object-pascal-format
|
|
msgid "Value \"%s\""
|
|
msgstr "Wert \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmwas
|
|
#, object-pascal-format
|
|
msgid "(was \"%s\")"
|
|
msgstr "(war \"%s\")"
|
|
|
|
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
|
|
msgid "WidgetSet change is available only for LCL projects"
|
|
msgstr "Eine WidgetSet-Änderung ist nur bei LCL-Projekten möglich."
|
|
|
|
#: lazarusidestrconsts.lismode
|
|
#, object-pascal-format
|
|
msgid ", Mode: %s"
|
|
msgstr ", Modus: %s"
|
|
|
|
#: lazarusidestrconsts.lismodifiedlgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
"\n"
|
|
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
"<Beschreibung>\n"
|
|
"\n"
|
|
"Copyright (C) <Jahr> <Name des Autors> <Kontakt>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
"\n"
|
|
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lismore
|
|
msgctxt "lazarusidestrconsts.lismore"
|
|
msgid "More"
|
|
msgstr "Weiter"
|
|
|
|
#: lazarusidestrconsts.lismoresub
|
|
msgctxt "lazarusidestrconsts.lismoresub"
|
|
msgid "More"
|
|
msgstr "Weitere"
|
|
|
|
#: lazarusidestrconsts.lismove
|
|
msgid "Move"
|
|
msgstr "Verschieben"
|
|
|
|
#: lazarusidestrconsts.lismovedown
|
|
msgid "Move Down"
|
|
msgstr "Nach unten bewegen"
|
|
|
|
#: lazarusidestrconsts.lismovefiles
|
|
msgid "Move Files"
|
|
msgstr "Dateien verschieben"
|
|
|
|
#: lazarusidestrconsts.lismovefiles2
|
|
msgid "Move files?"
|
|
msgstr "Dateien verschieben?"
|
|
|
|
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
|
#, object-pascal-format
|
|
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr "%s Datei(en) von %s in das Verzeichnis%s%s%svon %s verschieben?"
|
|
|
|
#: lazarusidestrconsts.lismoveonepositiondown
|
|
#, object-pascal-format
|
|
msgid "Move \"%s\" one position down"
|
|
msgstr "Bewege \"%s\" eine Position nach unten"
|
|
|
|
#: lazarusidestrconsts.lismoveonepositionup
|
|
#, object-pascal-format
|
|
msgid "Move \"%s\" one position up"
|
|
msgstr "Bewege \"%s\" eine Position nach oben"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfiles
|
|
msgid "Move or Copy files?"
|
|
msgstr "Dateien verschieben oder kopieren?"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
|
#, object-pascal-format
|
|
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr "%s Datei(en) von %s in das Verzeichnis%s%s%svon %s verschieben oder kopieren?"
|
|
|
|
#: lazarusidestrconsts.lismovepage
|
|
msgid "Move Page"
|
|
msgstr "Seite verschieben"
|
|
|
|
#: lazarusidestrconsts.lismoveselecteddown
|
|
msgid "Move selected item down (Ctrl+Down)"
|
|
msgstr "Gewähltes Element nach unten bewegen (Strg+unten)"
|
|
|
|
#: lazarusidestrconsts.lismoveselectedup
|
|
msgid "Move selected item up (Ctrl+Up)"
|
|
msgstr "Gewähltes Element nach oben bewegen (Strg+hoch)"
|
|
|
|
#: lazarusidestrconsts.lismoveto
|
|
msgid "Move to: "
|
|
msgstr "Verschieben zu: "
|
|
|
|
#: lazarusidestrconsts.lismoveup
|
|
msgid "Move Up"
|
|
msgstr "Nach oben bewegen"
|
|
|
|
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
|
msgid "Moving these units will break their uses sections. See Messages window for details."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpcstyle
|
|
msgid "C style: \" => \\\""
|
|
msgstr "C-Stil: \" => \\\""
|
|
|
|
#: lazarusidestrconsts.lismpescapequotes
|
|
msgid "Escape "es"
|
|
msgstr "Anführungszeichen maskieren"
|
|
|
|
#: lazarusidestrconsts.lismpmultipaste
|
|
msgctxt "lazarusidestrconsts.lismpmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr "Mehrfach einfügen"
|
|
|
|
#: lazarusidestrconsts.lismppascalstyle
|
|
msgid "Pascal style: ' => ''"
|
|
msgstr "Pascal-Stil: ' => ''"
|
|
|
|
#: lazarusidestrconsts.lismppasteoptions
|
|
msgid "Paste &options"
|
|
msgstr "Einfüge&optionen"
|
|
|
|
#: lazarusidestrconsts.lismppreview
|
|
msgid "&Preview"
|
|
msgstr "Vorschau"
|
|
|
|
#: lazarusidestrconsts.lismptextaftereachline
|
|
msgid "Text &after each line"
|
|
msgstr "Text n&ach jeder Zeile"
|
|
|
|
#: lazarusidestrconsts.lismptextbeforeeachline
|
|
msgid "Text &before each line"
|
|
msgstr "Text vor jeder Zeile"
|
|
|
|
#: lazarusidestrconsts.lismptrimclipboardcontents
|
|
msgid "&Trim clipboard contents"
|
|
msgstr "Inhal&te der Zwischenablage beschneiden"
|
|
|
|
#: lazarusidestrconsts.lismsgcolors
|
|
msgid "Message colors"
|
|
msgstr "Nachrichten-Farben"
|
|
|
|
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
|
msgid "Multiple directories are separated with semicolons"
|
|
msgstr "Mehrfache Verzeichnisse werden mit Semikolons getrennt"
|
|
|
|
#: lazarusidestrconsts.lismultiplepack
|
|
msgid ", multiple packages: "
|
|
msgstr ", mehrfache Packages: "
|
|
|
|
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Meldungen in eine Datei (*.txt) schreiben"
|
|
|
|
#: lazarusidestrconsts.lisname
|
|
msgctxt "lazarusidestrconsts.lisname"
|
|
msgid "Name"
|
|
msgstr "Name"
|
|
|
|
#: lazarusidestrconsts.lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr "Namenskonflikt"
|
|
|
|
#: lazarusidestrconsts.lisnameofactivebuildmode
|
|
msgid "Name of active build mode"
|
|
msgstr "Name des aktiven Erstellmodus"
|
|
|
|
#: lazarusidestrconsts.lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Name der neuen Prozedur"
|
|
|
|
#: lazarusidestrconsts.lisnew
|
|
msgctxt "lazarusidestrconsts.lisnew"
|
|
msgid "New"
|
|
msgstr "Neu"
|
|
|
|
#: lazarusidestrconsts.lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Neue Klasse"
|
|
|
|
#: lazarusidestrconsts.lisnewconsoleapplication
|
|
msgid "New console application"
|
|
msgstr "Neue Konsolenanwendung"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
|
#, object-pascal-format
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Erzeugt eine neue Editordatei.%sWählen Sie den Typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Erzeugt eine neue leere Textdatei."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
|
#, object-pascal-format
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Erzeugt neues Projekt.%sWählen Sie einen Typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
#, object-pascal-format
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Erzeugt ein neues Standard-Packages.%sEin Package ist eine Sammlung von Units und Komponenten."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Erzeugt eine neue Unit mit einem Datenmodul."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
|
msgid "Create a new unit with a frame."
|
|
msgstr "Erzeugt eine neue Unit mit einem Frame"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Erzeugt eine neue Unit mit einem LCL-Formular."
|
|
|
|
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
|
msgid "Inherit from a project form or component"
|
|
msgstr "Abgeleitet von einem Formular oder einer Komponente des Projekts"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Keine Einträge gewählt"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Bitte wählen Sie zuerst einen Eintrag."
|
|
|
|
#: lazarusidestrconsts.lisnewencoding
|
|
msgid "New encoding:"
|
|
msgstr "Neue Kodierung:"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname
|
|
#, object-pascal-format
|
|
msgid "Macro %d"
|
|
msgstr "Makro %d"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname2
|
|
msgid "New Macroname"
|
|
msgstr "Neuer Makroname"
|
|
|
|
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
|
|
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
|
|
msgstr "Neue Methodenimplementierungen werden zwischen bestehenden Methoden dieser Klasse eingefügt - entweder alphabetisch, an letzter Stelle oder in der Anmeldungsreihenfolge."
|
|
|
|
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
|
|
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewpage
|
|
msgid "New page"
|
|
msgstr "Neue Seite"
|
|
|
|
#: lazarusidestrconsts.lisnewproject
|
|
msgid "(new project)"
|
|
msgstr "(neues Projekt)"
|
|
|
|
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
|
msgid "New recorded macros. Not to be saved"
|
|
msgstr "Neu aufgezeichnete Makros, noch nicht gespeichert"
|
|
|
|
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
|
msgid "New units are added to uses sections"
|
|
msgstr "Neue Units werden zum Uses-Abschnitt hinzugefügt:"
|
|
|
|
#: lazarusidestrconsts.lisnoautosaveactivedesktop
|
|
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
|
|
msgstr "'Aktiven Desktop automatisch speichern' ist deaktiviert, Sie müssen den aktiven Desktop manuell speichern."
|
|
|
|
#: lazarusidestrconsts.lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Keine Backups"
|
|
|
|
#: lazarusidestrconsts.lisnobuildprofilesselected
|
|
msgid "No profiles are selected to be built."
|
|
msgstr "Es sind keine Profile zum Erstellen ausgewählt."
|
|
|
|
#: lazarusidestrconsts.lisnochange
|
|
msgid "No change"
|
|
msgstr "Keine Änderung"
|
|
|
|
#: lazarusidestrconsts.lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr "Kein Code ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr "Keine abgeleiteten Compilereinstellungen"
|
|
|
|
#: lazarusidestrconsts.lisnofppkgprefix
|
|
msgid "empty Free Pascal compiler prefix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnohints
|
|
msgid "no hints"
|
|
msgstr "keine Hinweise"
|
|
|
|
#: lazarusidestrconsts.lisnoidewindowselected
|
|
msgid "No IDE window selected"
|
|
msgstr "Kein IDE-Fenster ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lisnolfmfile
|
|
msgid "No LFM file"
|
|
msgstr "Keine .lfm-Datei"
|
|
|
|
#: lazarusidestrconsts.lisnomacroselected
|
|
msgid "No macro selected"
|
|
msgstr "Kein Makro ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lisnomessageselected
|
|
msgid "(no message selected)"
|
|
msgstr "(keine Nachricht ausgewählt)"
|
|
|
|
#: lazarusidestrconsts.lisnoname
|
|
msgid "noname"
|
|
msgstr "unbenannt"
|
|
|
|
#: lazarusidestrconsts.lisnoneclicktochooseone
|
|
msgid "none, click to choose one"
|
|
msgstr "keine, klicken Sie, um eine auszuwählen"
|
|
|
|
#: lazarusidestrconsts.lisnoneselected
|
|
msgid "(None selected)"
|
|
msgstr "(nichts ausgewählt)"
|
|
|
|
#: lazarusidestrconsts.lisnonewfilefound
|
|
msgid "No new file found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnonodeselected
|
|
msgid "no node selected"
|
|
msgstr "kein Knoten gewählt"
|
|
|
|
#: lazarusidestrconsts.lisnopascalfile
|
|
msgid "No Pascal file"
|
|
msgstr "Keine Pascal-Datei"
|
|
|
|
#: lazarusidestrconsts.lisnoprogramfilesfound
|
|
#, object-pascal-format
|
|
msgid "No program file \"%s\" found."
|
|
msgstr "Programmdatei \"%s\" nicht gefunden."
|
|
|
|
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "Kein ResourceString-Abschnitt gefunden"
|
|
|
|
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
|
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr "Normalerweise ist der Filter ein regulärer Ausdruck. Bei *Einfacher Syntax* gilt ein Punkt als normales Zeichen, ein * steht für eine beliebige Zeichenkette, ein ? für ein beliebiges Zeichen, und ein Komma und Semikolon als Trenner zwischen Alternativen. Beispiel: Einfache Syntax *.pas;*.pp bedeutet ^(.*\\.pas|.*\\.pp)$"
|
|
|
|
#: lazarusidestrconsts.lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Keine Stringkonstante gefunden"
|
|
|
|
#: lazarusidestrconsts.lisnotadesigntimepackage
|
|
msgid "Not a designtime package"
|
|
msgstr "Kein Entwicklungszeit-Package"
|
|
|
|
#: lazarusidestrconsts.lisnotaninstallpackage
|
|
msgid "Not an install package"
|
|
msgstr "Kein installierbares Package"
|
|
|
|
#: lazarusidestrconsts.lisnotavalidfppkgprefix
|
|
msgid "Free Pascal compiler not found at the given prefix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnote
|
|
msgctxt "lazarusidestrconsts.lisnote"
|
|
msgid "Note"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposbottom
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
|
msgid "Bottom"
|
|
msgstr "Unten"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposleft
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposright
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabpostop
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
|
msgid "Top"
|
|
msgstr "Oben"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "Hinweis: Kann definiertes Template für Free Pascal Quellenverzeichnis nicht finden"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "Hinweis: Konnte das Definitons-Template für Lazarus-Quellen nicht erzeugen"
|
|
|
|
#: lazarusidestrconsts.lisnotemplateselected
|
|
msgid "no template selected"
|
|
msgstr "keine Vorlage ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lisnothingtodo
|
|
msgid "Nothing to do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotinstalled
|
|
msgid "not installed"
|
|
msgstr "nicht installiert"
|
|
|
|
#: lazarusidestrconsts.lisnotinstalledpackages
|
|
msgid "Not installed packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Nicht jetzt"
|
|
|
|
#: lazarusidestrconsts.lisnowloadedscheme
|
|
msgid "Now loaded: "
|
|
msgstr "Aktuell geladen: "
|
|
|
|
#: lazarusidestrconsts.lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr "Erzeuge neues Projekt"
|
|
|
|
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
|
#, object-pascal-format
|
|
msgid "Number of files to convert: %s"
|
|
msgstr "Zahl der umzuwandelnden Dateien: %s"
|
|
|
|
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
|
msgid "Object Inspector becomes visible when components are selected in designer."
|
|
msgstr "Der Objektinspektor wird sichtbar, wenn Komponenten im Designer ausgewählt sind."
|
|
|
|
#: lazarusidestrconsts.lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr "Object Pascal - Voreinst."
|
|
|
|
#: lazarusidestrconsts.lisobjectpath
|
|
msgid "object path"
|
|
msgstr "Objektpfad"
|
|
|
|
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
|
msgid "Switch to Object Inspector Favorites tab"
|
|
msgstr "Zum Favoriten-Reiter des Objektinspektors umschalten"
|
|
|
|
#: lazarusidestrconsts.lisofpackage
|
|
#, object-pascal-format
|
|
msgid " of package %s"
|
|
msgstr " von Package %s"
|
|
|
|
#: lazarusidestrconsts.lisoftheprojectinspector
|
|
msgid " of the Project Inspector"
|
|
msgstr " des Projektinspektors"
|
|
|
|
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
|
msgid "Add to favorite properties"
|
|
msgstr "Zu Favoriteneigenschaften hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
|
#, object-pascal-format
|
|
msgid "Choose a base class for the favorite property \"%s\"."
|
|
msgstr "Wählen Sie eine Basisklasse für die Favoriteneigenschaft \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisoifclassnotfound
|
|
#, object-pascal-format
|
|
msgid "Class \"%s\" not found."
|
|
msgstr "Klasse \"%s\" nicht gefunden."
|
|
|
|
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
|
msgid "Remove from favorite properties"
|
|
msgstr "Aus Favoriteneigenschaften entfernen"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "dynamische automatische Installation"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "statische automatische Installation"
|
|
|
|
#: lazarusidestrconsts.lisoipdescription
|
|
msgid "Description: "
|
|
msgstr "Beschreibung: "
|
|
|
|
#: lazarusidestrconsts.lisoipdescriptiondescription
|
|
#, object-pascal-format
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sBeschreibung: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipfilename
|
|
#, object-pascal-format
|
|
msgid "Filename: %s"
|
|
msgstr "Dateiname: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "dynamisch installiert"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "statisch installiert"
|
|
|
|
#: lazarusidestrconsts.lisoiplicenselicense
|
|
#, object-pascal-format
|
|
msgid "%sLicense: %s"
|
|
msgstr "%sLizenz: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipmissing
|
|
msgid "missing"
|
|
msgstr "fehlt"
|
|
|
|
#: lazarusidestrconsts.lisoipmodified
|
|
msgid "modified"
|
|
msgstr "geändert"
|
|
|
|
#: lazarusidestrconsts.lisoipopenloadedpackage
|
|
msgid "Open Loaded Package"
|
|
msgstr "Geladenes Package öffnen"
|
|
|
|
#: lazarusidestrconsts.lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Package-Name"
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "Bitte wählen Sie ein Package aus"
|
|
|
|
#: lazarusidestrconsts.lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "schreibgeschützt"
|
|
|
|
#: lazarusidestrconsts.lisoipstate
|
|
msgctxt "lazarusidestrconsts.lisoipstate"
|
|
msgid "State"
|
|
msgstr "Status"
|
|
|
|
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
#, object-pascal-format
|
|
msgid "%sThis package is installed but the lpk file was not found"
|
|
msgstr "%sDas Package ist installiert, aber die .lpk-Datei wurde nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisoldclass
|
|
msgid "Old Class"
|
|
msgstr "Alte Klasse"
|
|
|
|
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
|
msgid "On break line (i.e. return or enter key)"
|
|
msgstr "Beim Zeilenumbruch (z.B. Return- oder Enter-Taste)"
|
|
|
|
#: lazarusidestrconsts.lisonlinepackage
|
|
msgid "available in the main repository"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonly32bit
|
|
msgid "only 32bit"
|
|
msgstr "nur 32 Bit"
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
|
|
msgid "Only available on Windows. Run the tool hidden."
|
|
msgstr "Nur unter Windows verfügbar. Startet das Werkzeug verborgen."
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
|
|
msgid "Only available on Windows. Run tool in a new console."
|
|
msgstr "Nur unter Windows verfügbar. Startet das Werkzeug in einer neuen Konsole."
|
|
|
|
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
|
msgid "Only messages fitting this regular expression:"
|
|
msgstr "Nur Meldungen entsprechend diesem regulären Ausdruck:"
|
|
|
|
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
|
msgid "Only messages with these FPC IDs (comma separated):"
|
|
msgstr "Nur Meldungen mit diesen FPC-IDs (kommasepariert):"
|
|
|
|
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
|
|
msgid "Only register the Lazarus package files (.lpk). Do not build."
|
|
msgstr "Nur die Lazarus-Package-Dateien (.lpk) registrieren. Nicht erstellen."
|
|
|
|
#: lazarusidestrconsts.lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr "Suche nur nach ganzen Worten"
|
|
|
|
#: lazarusidestrconsts.lisonpastefromclipboard
|
|
msgid "On paste from clipboard"
|
|
msgstr "Beim Einfügen aus der Zwischenablage"
|
|
|
|
#: lazarusidestrconsts.lisopen
|
|
msgctxt "lazarusidestrconsts.lisopen"
|
|
msgid "Open"
|
|
msgstr "Öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr "Als XML-Datei öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunit
|
|
msgid "Open designer on open unit"
|
|
msgstr "Geöffnete Unit in Designer laden"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
|
msgid "Form is loaded in designer always when source unit is opened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr "Vorhandene Datei öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenfile
|
|
msgctxt "lazarusidestrconsts.lisopenfile"
|
|
msgid "Open File"
|
|
msgstr "Datei öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenfile2
|
|
msgctxt "lazarusidestrconsts.lisopenfile2"
|
|
msgid "Open file"
|
|
msgstr "Datei öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr "Datei beim Cursor öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopeninfileman
|
|
msgid "Open in file manager"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopeninfilemanhint
|
|
msgid "Open destination directory in file manager"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenlfm
|
|
#, object-pascal-format
|
|
msgid "Open %s"
|
|
msgstr "Öffne %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Package öffnen?"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage2
|
|
#, object-pascal-format
|
|
msgid "Open package %s"
|
|
msgstr "Package %s öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage3
|
|
msgid "Open Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr "Package-Datei wählen"
|
|
|
|
#: lazarusidestrconsts.lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Projekt öffnen?"
|
|
|
|
#: lazarusidestrconsts.lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Projekt öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr "Projekt erneut öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Projektdatei öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr "Datei als normalen Quelltext öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenthepackage
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "Open the package %s?"
|
|
msgid ""
|
|
"Open the package \"%s\"?\n"
|
|
"\n"
|
|
"The \"Package\" menu has separate commands for opening packages and a list of recent ones."
|
|
msgstr "Package %s öffnen?"
|
|
|
|
#: lazarusidestrconsts.lisopentheproject
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "Open the project %s?"
|
|
msgid ""
|
|
"Open the project \"%s\"?\n"
|
|
"\n"
|
|
"The \"Project\" menu has separate commands for opening projects and a list of recent ones."
|
|
msgstr "Projekt %s öffnen?"
|
|
|
|
#: lazarusidestrconsts.lisopentooloptions
|
|
msgid "Open Tool Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenunit
|
|
msgid "Open Unit"
|
|
msgstr "Unit öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenurl
|
|
msgid "Open URL"
|
|
msgstr "URL öffnen"
|
|
|
|
#: lazarusidestrconsts.lisopenxml
|
|
msgid "Open XML"
|
|
msgstr "XML öffnen"
|
|
|
|
#: lazarusidestrconsts.lisoptions
|
|
msgctxt "lazarusidestrconsts.lisoptions"
|
|
msgid "Options"
|
|
msgstr "Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lisoptionvalueignored
|
|
msgid "ignored"
|
|
msgstr "ignoriert"
|
|
|
|
#: lazarusidestrconsts.lisos
|
|
#, object-pascal-format
|
|
msgid ", OS: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
|
#, object-pascal-format
|
|
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
|
|
#, object-pascal-format
|
|
msgid "output directory of %s contains Pascal unit source \"%s\""
|
|
msgstr "Das Ausgabeverzeichnis von %s enthält die Pascal-Unit-Quelle \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisoutputfilenameofproject
|
|
msgid "Output filename of project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridelanguage
|
|
msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"."
|
|
msgstr "Sprache überschreiben. Beispielsweise --language=de. Für die möglichen Werte siehe die Dateien im Verzeichnis »languages«."
|
|
|
|
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
|
|
msgid "Override function result string types with the first parameter expression type"
|
|
msgstr "Funktionsergebnis-Stringtypen mit erstem Parameter-Ausdruckstyp überschreiben"
|
|
|
|
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
|
msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml."
|
|
msgstr "Überschreibt den voreingestellten Compiler, z.B. ppc386, ppcx64, ppcppc etc. Die Voreinstellung ist in environmentoptions.xm abgelegt"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
|
msgid "Override the project or IDE build mode."
|
|
msgstr "Überschreibt den Projekt- oder IDE-Erstellmodus"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
|
#, object-pascal-format
|
|
msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s."
|
|
msgstr "Überschreibt die Projekt-CPU, z.B. i386, x86_64, powerpc, powerpc_64 usw. Voreinstellung: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
|
#, object-pascal-format
|
|
msgid "Override the project operating system. For example: win32 linux. Default: %s."
|
|
msgstr "Überschreibt das Betriebssystem des Projekts, z.B. win32, linux. Voreinstellung: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectsubtarg
|
|
msgid "Override the project subtarget."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectwidgetsetegdefault
|
|
#, object-pascal-format
|
|
msgid "Override the project widgetset. For example: %s. Default: %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
|
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
|
msgstr "»Owner« wird bereits vom TReader/TWriter verwendet. Bitte wählen sie einen anderen Namen."
|
|
|
|
#: lazarusidestrconsts.lispackage
|
|
msgid "Package"
|
|
msgstr "Package"
|
|
|
|
#: lazarusidestrconsts.lispackage2
|
|
#, object-pascal-format
|
|
msgid "package %s"
|
|
msgstr "Package %s"
|
|
|
|
#: lazarusidestrconsts.lispackage3
|
|
#, object-pascal-format
|
|
msgid ", package %s"
|
|
msgstr ", Package %s"
|
|
|
|
#: lazarusidestrconsts.lispackageinfo
|
|
msgid "Package info"
|
|
msgstr "Package-Info"
|
|
|
|
#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Name des Packages beginnt mit ..."
|
|
|
|
#: lazarusidestrconsts.lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Name des Packages enthält ..."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
|
msgid "Package needs an output directory."
|
|
msgstr "Package benötigt ein Ausgabeverzeichnis."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Package benötigt eine Installation"
|
|
|
|
#: lazarusidestrconsts.lispackageoption
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageoutputdirectories
|
|
msgid "Package output directories"
|
|
msgstr "Package-Ausgabeverzeichnisse"
|
|
|
|
#: lazarusidestrconsts.lispackagesourcedirectories
|
|
msgid "Package source directories"
|
|
msgstr "Package-Quellverzeichnisse"
|
|
|
|
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
|
#, object-pascal-format
|
|
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
|
msgstr "Packages=%s/%s Units=%s/%s Bezeichner=%s/%s Zeilen=%s Bytes=%s"
|
|
|
|
#: lazarusidestrconsts.lispackageunit
|
|
msgid "package unit"
|
|
msgstr "Package-Unit"
|
|
|
|
#: lazarusidestrconsts.lispage
|
|
msgctxt "lazarusidestrconsts.lispage"
|
|
msgid "Page"
|
|
msgstr "Seite"
|
|
|
|
#: lazarusidestrconsts.lispagename
|
|
msgid "Page name"
|
|
msgstr "Seitenname"
|
|
|
|
#: lazarusidestrconsts.lispagenamealreadyexists
|
|
#, object-pascal-format
|
|
msgid "Page name \"%s\" already exists. Not added."
|
|
msgstr "Seitenname \"%s\" existiert bereits. Nicht hinzugefügt."
|
|
|
|
#: lazarusidestrconsts.lispanic
|
|
msgctxt "lazarusidestrconsts.lispanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparsed
|
|
msgid ", parsed "
|
|
msgstr ", analysiert "
|
|
|
|
#: lazarusidestrconsts.lisparser
|
|
#, object-pascal-format
|
|
msgid "parser \"%s\": %s"
|
|
msgstr "Parser \"%s\": %s"
|
|
|
|
#: lazarusidestrconsts.lisparsers
|
|
msgid "Parsers:"
|
|
msgstr "Parser:"
|
|
|
|
#: lazarusidestrconsts.lispassingquiettwotimeswillp
|
|
msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispasteclipboard
|
|
msgid "paste clipboard"
|
|
msgstr "Zwischenablage einfügen"
|
|
|
|
#: lazarusidestrconsts.lispastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lispastefromclipboard"
|
|
msgid "Paste from clipboard."
|
|
msgstr "Aus Zwischenablage einfügen"
|
|
|
|
#: lazarusidestrconsts.lispastelcolors
|
|
msgid "Pastel Colors"
|
|
msgstr "Pastellfarben"
|
|
|
|
#: lazarusidestrconsts.lispath
|
|
msgid "Path"
|
|
msgstr "Pfad"
|
|
|
|
#: lazarusidestrconsts.lispatheditbrowse
|
|
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
|
msgid "Browse"
|
|
msgstr "Durchsuchen"
|
|
|
|
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
|
msgid "Delete Invalid Paths"
|
|
msgstr "Ungültige Pfade löschen"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathdown
|
|
msgid "Move path down (Ctrl+Down)"
|
|
msgstr "Pfad nach unten bewegen"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathup
|
|
msgid "Move path up (Ctrl+Up)"
|
|
msgstr "Pfad nach oben bewegen"
|
|
|
|
#: lazarusidestrconsts.lispatheditoraddhint
|
|
msgid "Add new path to the list"
|
|
msgstr "Neue Pfade zur Liste hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeletehint
|
|
msgid "Delete the selected path"
|
|
msgstr "Den gewählten Pfad löschen"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
|
msgid "Remove non-existent (gray) paths from the list"
|
|
msgstr "Nicht existierende (graue) Pfade aus der Liste entfernen"
|
|
|
|
#: lazarusidestrconsts.lispatheditorreplacehint
|
|
msgid "Replace the selected path with a new path"
|
|
msgstr "Gewählten Pfad durch neuen Pfad ersetzen"
|
|
|
|
#: lazarusidestrconsts.lispatheditortempladdhint
|
|
msgid "Add template to the list"
|
|
msgstr "Vorlage zur Liste hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Pfad-Vorlagen"
|
|
|
|
#: lazarusidestrconsts.lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Suchpfade:"
|
|
|
|
#: lazarusidestrconsts.lispathisnodirectory
|
|
msgid "is not a directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
|
msgid "path of the instantfpc cache"
|
|
msgstr "Pfad des InstantFPC-Caches"
|
|
|
|
#: lazarusidestrconsts.lispathofthemakeutility
|
|
msgid "Path of the make utility"
|
|
msgstr "Pfad zum Make-Programm"
|
|
|
|
#: lazarusidestrconsts.lispathtoinstance
|
|
msgid "Path to failed Instance:"
|
|
msgstr "Pfad zur fehlgeschlagenen Instanz:"
|
|
|
|
#: lazarusidestrconsts.lispause
|
|
msgctxt "lazarusidestrconsts.lispause"
|
|
msgid "Pause"
|
|
msgstr "Pause"
|
|
|
|
#: lazarusidestrconsts.lispckcleartousethepackagename
|
|
msgid "Clear to use the package name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckdisablei18noflfm
|
|
msgid "Disable I18N of lfm"
|
|
msgstr "i18n für .lfm-Dateien ausschalten"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
|
msgid "Add Files from File System"
|
|
msgstr "Dateien aus dem Dateisystem hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddtoproject
|
|
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Zum Projekt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Änderungen übernehmen"
|
|
|
|
#: lazarusidestrconsts.lispckeditavailableonline
|
|
msgid "(available online)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
|
#, object-pascal-format
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "%sRegister%s-Prozedur dieser Unit aufrufen"
|
|
|
|
#: lazarusidestrconsts.lispckeditcheckavailabilityonline
|
|
msgid "Check availability online"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
|
msgid "Clean up dependencies ..."
|
|
msgstr "Abhängigkeiten aufräumen ..."
|
|
|
|
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
|
msgid "Clear default/preferred filename of dependency"
|
|
msgstr "Standard/Bevorzugter Dateiname dieser Abhängigkeit löschen"
|
|
|
|
#: lazarusidestrconsts.lispckeditcommonoptions
|
|
msgid "Common"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Alles kompilieren?"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Package kompilieren"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
|
msgid "Create fpmake.pp"
|
|
msgstr "fpmake.pp erzeugen"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatemakefile
|
|
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Makedatei erzeugen"
|
|
|
|
#: lazarusidestrconsts.lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr "Abhängigkeitseigenschaften"
|
|
|
|
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
|
msgid "Edit general options"
|
|
msgstr "Allgemeine Einstellungen bearbeiten"
|
|
|
|
#: lazarusidestrconsts.lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Dateieigenschaften"
|
|
|
|
#: lazarusidestrconsts.lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Installieren"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Ungültige Maximalversion"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Ungültige Minimalvesion"
|
|
|
|
#: lazarusidestrconsts.lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Maximalversion:"
|
|
|
|
#: lazarusidestrconsts.lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Minimalversion:"
|
|
|
|
#: lazarusidestrconsts.lispckeditmodified
|
|
#, object-pascal-format
|
|
msgid "Modified: %s"
|
|
msgstr "Geändert: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Abhängigkeit nach unten bewegen"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Abhängigkeit nach oben bewegen"
|
|
|
|
#: lazarusidestrconsts.lispckeditoptionsforpackage
|
|
#, object-pascal-format
|
|
msgid "Options for Package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditpackage
|
|
#, object-pascal-format
|
|
msgid "Package %s"
|
|
msgstr "Package %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" has changed.%sSave package?"
|
|
msgstr "Package \"%s\" wurde geändert. %sPackage speichern?"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
|
#, object-pascal-format
|
|
msgid "package %s not saved"
|
|
msgstr "Package %s nicht gesichert"
|
|
|
|
#: lazarusidestrconsts.lispckeditpage
|
|
#, object-pascal-format
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s, Seite: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Wiederhinzufügen der Abhängigkeit"
|
|
|
|
#: lazarusidestrconsts.lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Wiederhinzufügen der Datei"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadonly
|
|
#, object-pascal-format
|
|
msgid "Read Only: %s"
|
|
msgstr "Schreibgeschützt: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
|
msgid "Recompile All Required"
|
|
msgstr "Alles Benötigte neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileclean
|
|
msgid "Recompile Clean"
|
|
msgstr "Sauber rekompilieren"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Rekompiliere dieses und alle benötigten Packages"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Registrierte Plugins"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Registriere Unit"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Entferne Abhängigkeit"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Abhängigkeit \"%s\"%saus dem Package \"%s\" entfernen?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedfiles
|
|
msgid "Removed Files"
|
|
msgstr "Entfernte Dateien"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Benötigte Packages entfernt"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Datei entfernen"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Datei entfernen?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Datei \"%s\"%saus dem Package \"%s\" entfernen?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Gewählten Eintrag entfernen"
|
|
|
|
#: lazarusidestrconsts.lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Benötigte Packages"
|
|
|
|
#: lazarusidestrconsts.lispckeditsavepackage
|
|
msgid "Save Package"
|
|
msgstr "Package speichern"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
|
msgid "Store file name as default for this dependency"
|
|
msgstr "Den Dateinamen als Standard speichern für diese Abhängigkeit"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
|
msgid "Store file name as preferred for this dependency"
|
|
msgstr "Den Dateiname als Vorgabe für diese Abhängigkeit speichern"
|
|
|
|
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
|
#, object-pascal-format
|
|
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Die maximale Version \"%s\" ist keine gültige Package-Versionsangabe.%s(Ein gutes Beispiel wäre 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
|
#, object-pascal-format
|
|
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Die minimale Version \"%s\" ist keine gültige Package-Versionsangabe.%s(Ein gutes Beispiel wäre 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "Deinstallieren"
|
|
|
|
#: lazarusidestrconsts.lispckeditviewpackagesource
|
|
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
|
msgid "View Package Source"
|
|
msgstr "Package-Quelltext anzeigen"
|
|
|
|
#: lazarusidestrconsts.lispckexplbase
|
|
msgid "Base, cannot be uninstalled"
|
|
msgstr "Basis-Package, kann nicht deinstalliert werden"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstalled
|
|
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
|
msgid "Installed"
|
|
msgstr "Installiert"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Installieren beim nächsten Start"
|
|
|
|
#: lazarusidestrconsts.lispckexplstate
|
|
#, object-pascal-format
|
|
msgid "%sState: "
|
|
msgstr "%sZustand: "
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
|
msgid "Uninstall on next start (unless needed by an installed package)"
|
|
msgstr "Beim nächsten Start entfernen"
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallpackage
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
|
msgid "Uninstall package %s"
|
|
msgstr "Package %s deinstallieren"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "Neue Einstellungen für abhängige Packages und Projekte"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Neue Pfade für abhängige Packages und Projekte"
|
|
|
|
#: lazarusidestrconsts.lispckoptsauthor
|
|
msgid "Author"
|
|
msgstr "Autor"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Bei Bedarf automatisch neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Automatisch kompilieren wenn alles kompiliert wird"
|
|
|
|
#: lazarusidestrconsts.lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Benutzerdefiniert"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
|
msgid "Description / Abstract"
|
|
msgstr "Beschreibung/Zusammenfassung"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntime
|
|
msgid "Designtime"
|
|
msgstr "Entwicklungszeit"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
|
msgid "Designtime and runtime"
|
|
msgstr "Entwicklungs- und Laufzeit"
|
|
|
|
#: lazarusidestrconsts.lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "IDE-Integration"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr "Include"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Ungültiger Package-Typ"
|
|
|
|
#: lazarusidestrconsts.lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Bibliothek"
|
|
|
|
#: lazarusidestrconsts.lispckoptslicense
|
|
msgid "License"
|
|
msgstr "Lizenz"
|
|
|
|
#: lazarusidestrconsts.lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Linker"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr "Haupt"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Manuelle Kompilierung (nie automatisch)"
|
|
|
|
#: lazarusidestrconsts.lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr "Unter"
|
|
|
|
#: lazarusidestrconsts.lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Objekt"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackagetype
|
|
msgid "Package type"
|
|
msgstr "Package-Typ"
|
|
|
|
#: lazarusidestrconsts.lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr "Stellt zur Verfügung"
|
|
|
|
#: lazarusidestrconsts.lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Release"
|
|
|
|
#: lazarusidestrconsts.lispckoptsruntime
|
|
msgid "Runtime"
|
|
msgstr "Laufzeit"
|
|
|
|
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
|
msgstr "Das Package \"%s\" besitzt die Kennung für automatische Installation.%sDas bedeutet, es wird in die IDE installiert. %sInstallationspakete müssen Designzeit-Packages sein."
|
|
|
|
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr "Dieses Package stellt das gleiche wie die folgenden Packages bereit:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
|
msgid "Update / Rebuild"
|
|
msgstr "Aktualisieren/Neukompilieren"
|
|
|
|
#: lazarusidestrconsts.lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Bedienung"
|
|
|
|
#: lazarusidestrconsts.lispckpackage
|
|
msgid "Package:"
|
|
msgstr "Package:"
|
|
|
|
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
|
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
|
msgstr "Suchpfade für FPDoc-XML-Dateien. Mehrere Pfade müssen mit einem Semikolon getrennt werden."
|
|
|
|
#: lazarusidestrconsts.lispckshowunneededdependencies
|
|
msgid "Show unneeded dependencies"
|
|
msgstr "Zeige nicht benötigte Abhängigkeiten"
|
|
|
|
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
|
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
|
msgstr "Wenn das Formular gespeichert wird kann die IDE alle TTranslateString-Eigenschaften in die po-Datei des Packages speichern. Dafür müssen Sie i18n für dieses Package aktivieren, ein po-Ausgabeverzeichnis angeben und diese Einstellung deaktiviert lassen."
|
|
|
|
#: lazarusidestrconsts.lispdabort
|
|
msgctxt "lazarusidestrconsts.lispdabort"
|
|
msgid "Abort"
|
|
msgstr "Alles abbrechen"
|
|
|
|
#: lazarusidestrconsts.lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Fortschritt"
|
|
|
|
#: lazarusidestrconsts.lispecollapsedirectory
|
|
msgid "Collapse directory"
|
|
msgstr "Verzeichnis einklappen"
|
|
|
|
#: lazarusidestrconsts.lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr "Konflikt aufgetreten"
|
|
|
|
#: lazarusidestrconsts.lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr "Virtuelle Unit bearbeiten"
|
|
|
|
#: lazarusidestrconsts.lispeexpanddirectory
|
|
msgid "Expand directory"
|
|
msgstr "Verzeichnis erweitern"
|
|
|
|
#: lazarusidestrconsts.lispefilename
|
|
msgid "Filename:"
|
|
msgstr "Dateiname:"
|
|
|
|
#: lazarusidestrconsts.lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr "Dateischreibweisen korrigieren"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr "Ungültiger Unit-Dateiname"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr "Ungültiger Unit-Name"
|
|
|
|
#: lazarusidestrconsts.lispemissingfilesofpackage
|
|
#, object-pascal-format
|
|
msgid "Missing files of package %s"
|
|
msgstr "Fehlende Dateien von Package %s"
|
|
|
|
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
|
msgid "New file not in include path"
|
|
msgstr "Neue Datei ist nicht im Include-Pfad"
|
|
|
|
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
|
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
|
msgid "No files missing. All files exist."
|
|
msgstr "Keine Dateien fehlen. Alle Dateien existieren."
|
|
|
|
#: lazarusidestrconsts.lisperemovefiles
|
|
msgid "Remove files"
|
|
msgstr "Dateien entfernen"
|
|
|
|
#: lazarusidestrconsts.lisperevertpackage
|
|
msgid "Revert Package"
|
|
msgstr "Package zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.lispesavepackageas
|
|
msgid "Save Package As ..."
|
|
msgstr "Package speichern unter"
|
|
|
|
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
|
msgid "Show directory hierarchy"
|
|
msgstr "Zeige Verzeichnishierarchie"
|
|
|
|
#: lazarusidestrconsts.lispeshowmissingfiles
|
|
msgid "Show Missing Files"
|
|
msgstr "Fehlende Dateien zeigen"
|
|
|
|
#: lazarusidestrconsts.lispeshowpropspanel
|
|
msgid "Show properties panel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesortfiles
|
|
msgid "Sort Files Permanently"
|
|
msgstr "Dateien permanent sortieren"
|
|
|
|
#: lazarusidestrconsts.lispesortfilesalphabetically
|
|
msgid "Sort files alphabetically"
|
|
msgstr "Dateien alphabetisch sortieren"
|
|
|
|
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
|
msgstr "Die Datei \"%s\" ist aktuell nicht im Include-Pfad des Packages.%sSoll \"%s\" zum Include-Pfad hinzugefügt werden?"
|
|
|
|
#: lazarusidestrconsts.lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr "Unit-Name:"
|
|
|
|
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
|
msgid "Use all units in directory"
|
|
msgstr "Nutze alle Units im Verzeichnis"
|
|
|
|
#: lazarusidestrconsts.lispeusenounitsindirectory
|
|
msgid "Use no units in directory"
|
|
msgstr "Nutze keine Units im Verzeichnis"
|
|
|
|
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
|
msgid "Clean up package dependencies"
|
|
msgstr "Package-Abhängigkeiten aufräumen"
|
|
|
|
#: lazarusidestrconsts.lispkgclearselection
|
|
msgid "Clear Selection"
|
|
msgstr "Auswahl löschen"
|
|
|
|
#: lazarusidestrconsts.lispkgdeletedependencies
|
|
msgid "Delete dependencies"
|
|
msgstr "Abhängigkeiten löschen"
|
|
|
|
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
#, object-pascal-format
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Wollen Sie die Änderungen am Packages %s wirklich verwerfen und es neu aus der Datei laden?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "Die neue Unit ist nicht im Unitpfad"
|
|
|
|
#: lazarusidestrconsts.lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Package veröffentlichen"
|
|
|
|
#: lazarusidestrconsts.lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Package zurücknehmen?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
|
msgstr "Die Datei \"%s\"%sbefindet sich derzeit nicht im Unitpfad des Packages.%s \"%s\" In den Unitpfad aufnehmen?"
|
|
|
|
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
|
msgid "More functions for the package"
|
|
msgstr "Weitere Funktionen für das Package"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
|
#, object-pascal-format
|
|
msgid "%sAdding new Dependency for package %s: package %s"
|
|
msgstr "%sFüge neue Abhängigkeit für Package %s hinzu: Package %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
|
#, object-pascal-format
|
|
msgid "%sAdding new Dependency for project %s: package %s"
|
|
msgstr "%sFüge neue Abhängigkeit für Projekt %s hinzu: Package %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddunittousesclause
|
|
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Mehrdeutige Units gefunden"
|
|
|
|
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Automatisch installierte Packages"
|
|
|
|
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
#, object-pascal-format
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sBeide Packages sind verbunden. Das bedeutet, daß entweder das eine Package das andere verwendet oder beide ein drittes."
|
|
|
|
#: lazarusidestrconsts.lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Abhängigkeit nicht erfüllt"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
|
msgid "Circular dependencies found"
|
|
msgstr "Zirkuläre Abhängigkeiten gefunden"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Alte Package-Datei löschen?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
|
#, object-pascal-format
|
|
msgid "Delete old package file \"%s\"?"
|
|
msgstr "Alte Package-Datei \"%s\" löschen?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
|
#, object-pascal-format
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Abhängigkeit ohne Eigentümer: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Fehler beim Lesen des Packages"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Fehler beim Schreiben des Packages"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "Datei bereits im Package"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "Datei ist im Projekt enthalten"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Dateiname unterscheidet sich vom Package-Namen"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Dateiname wird von anderem Package bereits verwendet"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Dateiname ist vom Projekt verwendet"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotfound
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Datei \"%s\" nicht gefunden,"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "Datei nicht gesichert"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
#, object-pascal-format
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr "Die Installation des Packages %s installiert automatisch das Package:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
#, object-pascal-format
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr "Die Installation des Packages %s installiert automatisch die Packages:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Ungültige Dateiendung"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Ungültige Package-Dateiendung"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Ungültiger Package-Dateiname"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Ungültiger Package-Name"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Ungültiger Package-Name"
|
|
|
|
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
|
#, object-pascal-format
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
|
msgstr "Das Laden des Packages %s wird das Package %s%saus der Datei %s ersetzen.%sDas alte Package wurde geändert.%sAltes Package %s speichern?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackage
|
|
#, object-pascal-format
|
|
msgid "Package: %s"
|
|
msgstr "Package: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Package-Konflikte"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
|
msgid "Package is not a designtime package"
|
|
msgstr "Das ist kein Entwicklungszeit-Package"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Package wird benötigt"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Package-Name ist bereits belegt"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Packages müssen die Endung .lpk besitzen"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
|
msgid "Please compile the package first."
|
|
msgstr "Bitte kompilieren Sie zuerst das Package."
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Bitte speichern Sie die Datei vor dem Einfügen in ein Package."
|
|
|
|
#: lazarusidestrconsts.lispkgmangproject
|
|
#, object-pascal-format
|
|
msgid "Project: %s"
|
|
msgstr "Projekt: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Lazarus neu kompilieren?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr "Datei in Kleinbuchstaben umbenennen?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
|
#, object-pascal-format
|
|
msgid "Replace existing file \"%s\"?"
|
|
msgstr "Ersetzen der vorhandenen Datei \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Ersetze Datei"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
|
msgid "One or more required packages were not found. See package graph for details."
|
|
msgstr "Ein oder mehrere benötigte Packages wurden nicht gefunden. Siehe Package-Graph für Details."
|
|
|
|
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"The package %s is already open in the IDE.\n"
|
|
"You cannot save a package with the same name."
|
|
msgstr ""
|
|
"Das Package %s ist bereits in der IDE geöffnet.\n"
|
|
"Sie können kein Package mit dem selben Namen speichern."
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage
|
|
msgid "Save package?"
|
|
msgstr "Package speichern?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
|
#, object-pascal-format
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Package %s (*.lpk) speichern?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
|
#, object-pascal-format
|
|
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
|
msgstr "Soll die Datei in Kleinbuchstaben nach%s\"%s\"umbenannt werden?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr "Dieses Package übergehen"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
|
msgid "The file \"%s\"%sis already in the package %s."
|
|
msgstr "Die Datei \"%s\"%s befindet sich bereits im Package %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is not a Lazarus package."
|
|
msgstr "Die Datei \"%s\" ist kein Lazarus-Package."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
#, object-pascal-format
|
|
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
|
msgstr "Der Dateiname \"%s\" stimmte nicht dem Package-Namen \"%s\" in der Datei überein.%sSoll der Name des Packages auf \"%s\" geändert werden?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
|
#, object-pascal-format
|
|
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "Der Dateiname \"%s\" ist Teil des aktuellen Projekts.%sProjekte und Packages sollten keine gemeinsamen Dateien haben."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
|
#, object-pascal-format
|
|
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
|
msgstr "Der Dateiname \"%s\" wird von%sdem Package \"%s\"%sin der Datei \"%s\" genutzt."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr "Das folgende Package konnte nicht geladen werden:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr "Die folgenden Packages konnten nicht geladen werden:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
#, object-pascal-format
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
|
msgstr "%sDie folgenden Units werden zum Uses-Abschnitt von%s%s zugefügt:%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
#, object-pascal-format
|
|
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
|
msgstr "Der Package-Dateiname \"%s\" in%s\"%s\" ist kein gültiger Lazarus-Package-Name."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
#, object-pascal-format
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
|
msgstr "Das Package %s ist ein Nur-Laufzeit-Package.%sLaufzeit-Packages können nicht in die IDE installiert werden."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
|
msgstr "Das Package \"%s\" wird automatisch kompiliert und sein Ausgabeverzeichnis ist \"%s\", was dem vorgegebenen Unit-Suchpfad des Compilers entspricht. Das Package benutzt andere Packages, welche ebenfalls den vorgegebenen Unit-Suchpfad des Compilers verwenden. Dadurch entsteht ein Zirkularbezug.%sSie beseitigen dieses Problem, indem Sie den Pfad aus Ihrer Compilerkonfiguration (z.B. fpc.cfg) entfernen%soder indem Sie das automatische Update dieses Packages deaktivieren oder durch Beseitigen der Abhängigkeiten."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Das Package \"%s\" ist für die Installation vorgemerkt, kann aber nicht gefunden werden.%sSoll die Abhängigkeit von der Installationsliste der Packages entfernt werden?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
#, object-pascal-format
|
|
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
|
|
msgstr "Das Package %s wird von %s benötigt, das für Installation vermerkt ist.%Siehe Package-Graph."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
#, object-pascal-format
|
|
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "Der Packagename \"%s\" ist kein gültiger Packagename%sBitte wählen Sie einen anderen (z.B. package1.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
|
#, object-pascal-format
|
|
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
|
msgstr "Der Packagename \"%s\" der%sDatei \"%s\" ist ungültig."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Das Package \"%s\" war markiert.%sDerzeit unterstützt Lazarus nur statisch gelinkte Packages. Eine echte Deinstallation verlangt das Kompilieren und den Neustart von Lazarus.%sWollen Sie Lazarus jetzt neu kompilieren?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Das Package \"%s\" war für die Installation vorgemerkt.%sDerzeit unterstützt Lazarus nur statisch gelinkte Packages. Die echte Installation verlangt das Kompilieren und den Neustart von Lazarus.%sWollen Sie Lazarus jetzt neu kompilieren?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
#, object-pascal-format
|
|
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Das Projekt benötigt das Package \"%s\".%sEs wurde aber nicht gefunden. Siehe Projekt -> Projektinspektor."
|
|
|
|
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
|
#, object-pascal-format
|
|
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
|
msgstr "Es gibt zwei Units mit dem selben Namen:%s1. \"%s\" von %s%s2. \"%s\" von %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
|
msgid "There is a circular dependency in the packages. See package graph."
|
|
msgstr "Es gibt eine zirkuläre Abhängigkeit in den Packages. Siehe Package-Graph."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
#, object-pascal-format
|
|
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
|
msgstr "Es gibt eine FPC-Unit mit gleichem Namen wie ein Package:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
|
#, object-pascal-format
|
|
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
|
msgstr "Es gibt eine FPC-Unit mit dem selben Namen wie:%s\"%s\" aus %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
|
#, object-pascal-format
|
|
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
|
msgstr "Es gibt bereits ein Package mit dem Namen \"%s\".%sPackage-Konflikt: \"%s\"%sDatei: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
|
#, object-pascal-format
|
|
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgstr "Es ist bereits ein Package \"%s\" geladen%saus der Datei \"%s\".%sSiehe Package -> Package-Graph.%sErsetzen ist nicht möglich."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Das benötigte Package enthält ein ungesichertes Package. Siehe Package-Graph."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
#, object-pascal-format
|
|
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
|
msgstr "Es gibt bereits eine Unit mit dem gleichen Namen wie ein Package:%s1. \"%s\" aus %s%s2. \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr "Das ist ein virtuelles Packages. Es besitzt, solange es noch nicht gespeichert wurde, keinen Quelltext. Bitte speichern Sie es zuerst."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
#, object-pascal-format
|
|
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgstr "Kann kein Zielverzeichnis für Lazarus erzeugen:%s\"%s\".%sDieses Verzeichnis wird für die gerade geänderte Lazarus-IDE und ihre benutzerdefinierten Packages benötigt."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
|
msgstr "Kann Package \"%s\"%snicht in die Datei \"%s\" schreiben.%sFehler: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Package entfernen?"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
|
#, object-pascal-format
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Package %s entfernen?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Nichtgespeichertes Package"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Verwende Unit"
|
|
|
|
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
|
#, object-pascal-format
|
|
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
|
msgstr "Warnung: Die Datei \"%s\"%sgehört zum aktuellen Projekt."
|
|
|
|
#: lazarusidestrconsts.lispkgmgrkeep
|
|
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
|
msgid "keep"
|
|
msgstr "beibehalten"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrnew
|
|
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
|
msgid "new"
|
|
msgstr "neu"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrremove
|
|
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
|
msgid "remove"
|
|
msgstr "entfernen"
|
|
|
|
#: lazarusidestrconsts.lispkgselectapackage
|
|
msgid "Select a package"
|
|
msgstr "Wählen Sie ein Package"
|
|
|
|
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
|
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
|
|
msgstr "Die folgenden Abhängigkeiten werden nicht benötigt wegen der automatischen Transitivität zwischen den Package-Abhängigkeiten."
|
|
|
|
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
|
#, object-pascal-format
|
|
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr "Die Datei gibt es ist in keinem der geladenen Packages."
|
|
|
|
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to read package file \"%s\".%sError: %s"
|
|
msgstr "Kann Package-Datei \"%s\" nicht lesen.%sFehler: %s"
|
|
|
|
#: lazarusidestrconsts.lisplay
|
|
msgid "Play"
|
|
msgstr "Ausführen"
|
|
|
|
#: lazarusidestrconsts.lispldglobal
|
|
msgctxt "lazarusidestrconsts.lispldglobal"
|
|
msgid "Global"
|
|
msgstr "Allgemein"
|
|
|
|
#: lazarusidestrconsts.lispldonline
|
|
msgid "Online"
|
|
msgstr "Online"
|
|
|
|
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
|
|
msgid "Online packages cannot be deleted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr "Package-Links"
|
|
|
|
#: lazarusidestrconsts.lispldshowgloballinksin
|
|
msgid "Show global links in "
|
|
msgstr "Zeige globale Links in "
|
|
|
|
#: lazarusidestrconsts.lispldshowonlinelinks
|
|
msgid "Show online links"
|
|
msgstr "Zeige Online-Links"
|
|
|
|
#: lazarusidestrconsts.lispldshowuserlinksin
|
|
msgid "Show user links in "
|
|
msgstr "Zeige Benutzer-Links in "
|
|
|
|
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
|
|
msgid "Some packages cannot be deleted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplduser
|
|
msgid "User"
|
|
msgstr "Benutzer"
|
|
|
|
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
|
msgid "Please fix the error shown in the message window which is normally below the source editor."
|
|
msgstr "Bitte berichtigen Sie den Fehler, der im Nachrichtenfenster angezeigt wird. Dieses befindet sich normalerweise unterhalb des Quelltexteditors."
|
|
|
|
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "Btte öffnen Sie eine Unit vor dem Starten."
|
|
|
|
#: lazarusidestrconsts.lispleaseplacetheeditorcaretonanidentifierifthisisane
|
|
msgid "Please place the editor caret on an identifier. If this is a new unit, please save the file first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr "Bitte wählen Sie den Quelltext, um eine neue Prozedur/Methode zu extrahieren."
|
|
|
|
#: lazarusidestrconsts.lisplistall
|
|
msgctxt "lazarusidestrconsts.lisplistall"
|
|
msgid "<All>"
|
|
msgstr "<Alle>"
|
|
|
|
#: lazarusidestrconsts.lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr "Schriftart ändern"
|
|
|
|
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr "Methodenname in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr "Filtern, wenn ein beliebiger Bereich der Methode paßt"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr "Filtern, wenn der Methodenstart paßt"
|
|
|
|
#: lazarusidestrconsts.lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Zur Auswahl springen"
|
|
|
|
#: lazarusidestrconsts.lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<Keine>"
|
|
|
|
#: lazarusidestrconsts.lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Objekte"
|
|
|
|
#: lazarusidestrconsts.lisplistprocedurelist
|
|
msgid "Procedure List"
|
|
msgstr "Prozedur-Liste"
|
|
|
|
#: lazarusidestrconsts.lisplisttype
|
|
msgctxt "lazarusidestrconsts.lisplisttype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr ".po-Datei-Verzeichnis auswählen"
|
|
|
|
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Keine Sitzungs-Informationen speichern"
|
|
|
|
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
|
msgid "Save in .lps file in IDE config directory"
|
|
msgstr "Im IDE-Konfigurationsverzeichnis speichern"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "In .lpi-Datei speichern"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr ".lps-Datei im Projektverzeichnis speichern"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Sitzungsinformationen speichern in"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
|
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
|
msgstr ".lpi ist die Hauptprojektdatei, .lps ist eine separate Datei, ausschließlich für Sitzungsdaten."
|
|
|
|
#: lazarusidestrconsts.lisposition
|
|
msgid "Position"
|
|
msgstr "Position"
|
|
|
|
#: lazarusidestrconsts.lispositionoutsideofsource
|
|
#, object-pascal-format
|
|
msgid "%s (position outside of source)"
|
|
msgstr "%s (Position außerhalb des Quelltexts)"
|
|
|
|
#: lazarusidestrconsts.lisppuinwrongdirectory
|
|
#, object-pascal-format
|
|
msgid "ppu in wrong directory=%s."
|
|
msgstr "ppu im falschen Verzeichnis=%s."
|
|
|
|
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
|
#, object-pascal-format
|
|
msgid "%s.ppu not found. Check your fpc.cfg."
|
|
msgstr "%s.ppu nicht gefunden. Prüfen Sie ihre fpc.cfg."
|
|
|
|
#: lazarusidestrconsts.lisprecedingword
|
|
msgid "Preceding word"
|
|
msgstr "Vorheriges Wort"
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
#, object-pascal-format
|
|
msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"."
|
|
msgstr "primäres Konfigurationsverzeichnis in dem Lazarus seine Konfigurationsdateien speichert. Voreinstellung ist \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigpath
|
|
msgid "Primary config path"
|
|
msgstr "Primärer Konfigurationspfad"
|
|
|
|
#: lazarusidestrconsts.lisprior
|
|
#, object-pascal-format
|
|
msgid "prior %s"
|
|
msgstr "vor %s"
|
|
|
|
#: lazarusidestrconsts.lispriority
|
|
msgctxt "lazarusidestrconsts.lispriority"
|
|
msgid "Priority"
|
|
msgstr "Priorität"
|
|
|
|
#: lazarusidestrconsts.lisprivate
|
|
msgid "Private"
|
|
msgstr "Private"
|
|
|
|
#: lazarusidestrconsts.lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Private Methode"
|
|
|
|
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
#, object-pascal-format
|
|
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
|
msgstr "Möglicherweise müssen sie einige Packages installieren, um fortfahren zu können.%sWarnung:%sDas Projekt bezieht sich auf Packages, die Units mit Register-Prozeduren enthalten. Die Register-Prozedur dient normalerweise dazu, Komponenten in der IDE zu installieren. Aber die folgenden Units gehören zu Packages, die noch nicht in der IDE installiert sind. Wenn Sie versuchen, ein Form in der IDE zu öffnen, das solche Komponenten einbindet, werden Sie Fehlermeldungen wegen nicht gefundener Komponenten erhalten und der Ladeprozeß des Forms wird mit möglicherweise unschönen Ergebnissen enden.%sDas hat keinen Einfluß auf das Öffnen des Projekts oder beliebiger zugehörigen Quellen. Es bedeutet nur, daß es keine gute Idee ist, das Form für das Design zu öffnen bevor die bemängelten Packages installiert wurden."
|
|
|
|
#: lazarusidestrconsts.lisprocedure
|
|
msgctxt "lazarusidestrconsts.lisprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Prozedur"
|
|
|
|
#: lazarusidestrconsts.lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr "Prozedur mit Schnittstelle"
|
|
|
|
#: lazarusidestrconsts.lisprogram
|
|
msgctxt "lazarusidestrconsts.lisprogram"
|
|
msgid "Program"
|
|
msgstr "Programm"
|
|
|
|
#: lazarusidestrconsts.lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Programm ermittelt"
|
|
|
|
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
|
msgid "A Free Pascal command line program with some useful settings added."
|
|
msgstr "Ein Free-Pascal-Kommandozeilenprogramm mit einigen hilfreichen Einstellungen."
|
|
|
|
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Der Programmquelltext muß eine Pascal-Endung wie .pas, .pp oder .lpr besitzen"
|
|
|
|
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Abhängigkeit ist bereits vorhanden"
|
|
|
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
|
msgid "Add Editor Files"
|
|
msgstr "Dateien hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Ungültige Min-/Max-Version"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Ungültige Version"
|
|
|
|
#: lazarusidestrconsts.lisprojaddlocalpkg
|
|
#, object-pascal-format
|
|
msgid "Local (%s)"
|
|
msgstr "Lokal (%s)"
|
|
|
|
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Höchste Versionsnummer (optional):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Niedrigste Versionsnummer (optional):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
|
|
msgid "New FPMake Requirement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Neue Anforderung"
|
|
|
|
#: lazarusidestrconsts.lisprojaddonlinepkg
|
|
#, object-pascal-format
|
|
msgid "Online (%s)"
|
|
msgstr "Online (%s)"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Package-Name:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Package nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagetype
|
|
msgid "Package Type:"
|
|
msgstr "Packagetyp:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
|
#, object-pascal-format
|
|
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
|
msgstr "Die Abhängigkeit \"%s\" wurde nicht gefunden.%sBitte wählen Sie ein vorhandenes Package."
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Die maximale Versionsangabe \"%s\" ist ungültig.%sDas Format lautet Major.Minor.Release.Build%sBeispielsweise: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Die maximal benötigte Version ist kleiner als die minimale."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Die Minimalversionsangabe \"%s\" ist ungültig.%sBitte verwenden Sie das Format Major.Minor.Release.Build%sBeispielsweise: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
|
#, object-pascal-format
|
|
msgid "The project has already a dependency for the package \"%s\"."
|
|
msgstr "Das Projekt besitzt bereits eine Abhängigkeit auf das Package \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
|
msgstr "Der Unit-Name \"%s\" ist bereits im Projekt%s mit der Datei: \"%s\" enthalten."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
|
msgstr "Der Unit-Name \"%s\" ist bereits der Auswahl%s mit der Datei: \"%s\" enthalten."
|
|
|
|
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Unit-Name ist bereits vorhanden"
|
|
|
|
#: lazarusidestrconsts.lisproject
|
|
#, object-pascal-format
|
|
msgid "Project %s"
|
|
msgstr "Projekt %s"
|
|
|
|
#: lazarusidestrconsts.lisproject2
|
|
msgid "Project: "
|
|
msgstr "Projekt: "
|
|
|
|
#: lazarusidestrconsts.lisproject3
|
|
msgid "project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Projekt verändert"
|
|
|
|
#: lazarusidestrconsts.lisprojectchangedondisk
|
|
msgid "Project changed on disk"
|
|
msgstr "Projekt auf Datenträger geändert"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectory
|
|
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Projektverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Projektdateiname"
|
|
|
|
#: lazarusidestrconsts.lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Projekt-Include-Pfad"
|
|
|
|
#: lazarusidestrconsts.lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "Projekteinstellungsdatei gefunden"
|
|
|
|
#: lazarusidestrconsts.lisprojectinspectorshowprops
|
|
msgid "Show properties pane in Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Projekt ist lauffähig"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnablehint
|
|
msgid "Generates a binary executable which can be run."
|
|
msgstr "Erzeugt eine binäre ausführbare Datei, die gestartet werden kann."
|
|
|
|
#: lazarusidestrconsts.lisprojectmacro
|
|
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
|
msgid "Project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr "Projekt-Makroeigenschaften"
|
|
|
|
#: lazarusidestrconsts.lisprojectnamespaces
|
|
msgid "Project Namespaces"
|
|
msgstr "Projekt-Namensräume"
|
|
|
|
#: lazarusidestrconsts.lisprojectoption
|
|
msgid "Project Option"
|
|
msgstr "Projekteinstellung"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutdir
|
|
msgid "Project Output directory (e.g. the ppu directory)"
|
|
msgstr "Projekt-Ausgabeverzeichnis (z.B. das ppu-Verzeichnis)"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutputdirectory
|
|
msgid "Project output directory"
|
|
msgstr "Projekt-Ausgabeverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisprojectpathhint
|
|
msgid "Directory where project's main file must be"
|
|
msgstr "Verzeichnis, in dem sich die Projekt-Hauptdatei befinden muß"
|
|
|
|
#: lazarusidestrconsts.lisprojectsession
|
|
msgid "Project Session"
|
|
msgstr "Projektsitzung"
|
|
|
|
#: lazarusidestrconsts.lisprojectsessionchanged
|
|
msgid "Project session changed"
|
|
msgstr "Projektsitzung geändert"
|
|
|
|
#: lazarusidestrconsts.lisprojectsourcedirectories
|
|
msgid "Project source directories"
|
|
msgstr "Projekt-Quellverzeichnisse"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s At address %1:x"
|
|
msgstr "%0:s%0:s Bei Adresse %1:x"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
|
#, object-pascal-format
|
|
msgid "Project %s raised exception class '%s'."
|
|
msgstr "Projekt %s hat Exception-Klasse »%s« ausgelöst."
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
|
#, object-pascal-format
|
|
msgid "Project %s raised exception class '%s' with message:%s%s"
|
|
msgstr "Projekt %s hat Exception-Klasse »%s« ausgelöst mit der Meldung:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
|
msgstr "%0:s%0:s In Datei '%1:s' bei Adresse %2:x"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
|
msgstr "%0:s%0:s In Datei '%1:s' in Zeile %2:d"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
|
msgstr "%0:s%0:s In Datei '%1:s' in Zeile %2:d:%0:s%3:s"
|
|
|
|
#: lazarusidestrconsts.lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Projekt-Quellpfad"
|
|
|
|
#: lazarusidestrconsts.lisprojectunit
|
|
msgid "project unit"
|
|
msgstr "Projekt-Unit"
|
|
|
|
#: lazarusidestrconsts.lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Projekt-Unitpfad"
|
|
|
|
#: lazarusidestrconsts.lisprojectver
|
|
msgid "Project version"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr "Projektassistent"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Bestätigen Sie das Löschen der Abhängigkeit"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr "Löschen der Datei bestätigen"
|
|
|
|
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
|
#, object-pascal-format
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Löschen der Abhängigkeit für %s?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspprojectinspector
|
|
#, object-pascal-format
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Projektinspektor - %s"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Benötigte Packages entfernt"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
|
#, object-pascal-format
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Entfernen der Datei %s aus dem Projekt?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
|
#, object-pascal-format
|
|
msgid "Remove %s items from project?"
|
|
msgstr "%s Elemente aus dem Projekt entfernen?"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Immer einen Compilerlauf durchführen (selbst dann, wenn nichts geändert wurde)"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
|
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptserror
|
|
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
|
msgid "Error"
|
|
msgstr "Fehler"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
|
#, object-pascal-format
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Kann die Liste der automatischen anzulegenden Forms im Programmquelltext nicht ändern.%sBitte beheben Sie zuerst die Fehler."
|
|
|
|
#: lazarusidestrconsts.lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Benutzer nach Entscheidung fragen"
|
|
|
|
#: lazarusidestrconsts.lisproperties
|
|
msgid "Properties (replace or remove)"
|
|
msgstr "Eigenschaften (ersetzen oder entfernen)"
|
|
|
|
#: lazarusidestrconsts.lisproperty
|
|
#, object-pascal-format
|
|
msgid "%s property"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprotected
|
|
msgid "Protected"
|
|
msgstr "Protected"
|
|
|
|
#: lazarusidestrconsts.lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr "Protected-Methode"
|
|
|
|
#: lazarusidestrconsts.lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr "Public-Methode (öffentlich)"
|
|
|
|
#: lazarusidestrconsts.lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr "Veröffentlichte Methode"
|
|
|
|
#: lazarusidestrconsts.lispublishedto
|
|
#, object-pascal-format
|
|
msgid "Published to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublishmodulenote
|
|
msgid "Files belonging to project / package will be included automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Veröffentliche Projektverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lispublishproject
|
|
msgid "Publish Project"
|
|
msgstr "Projekt veröffentlichen"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
|
msgid "Save .lrs files in the output directory"
|
|
msgstr ".lrs-Datei in das Ausgabeverzeichnis speichern"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
|
msgid "The resource will be available for FPC."
|
|
msgstr "Die Ressource wird für FPC verfügbar sein."
|
|
|
|
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Eine Pascal-Unit muß die Erweiterung ».pp« oder ».pas« haben"
|
|
|
|
#: lazarusidestrconsts.lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr "Virtuelle Unit bearbeiten"
|
|
|
|
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr "Es gibt bereits eine Unit mit dem Namen. %sDatei: %s"
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
|
msgid "The unitname is not a valid Pascal identifier."
|
|
msgstr "Der Unit-Name ist kein gültiger Pascal-Bezeichner."
|
|
|
|
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr "Unit-Name und Dateiname passen nicht zusammen.%sBeispiel: unit1.pas und Unit1"
|
|
|
|
#: lazarusidestrconsts.lispwconvertproject
|
|
msgid "Convert &Delphi Project"
|
|
msgstr "&Delphi-Projekt umwandeln"
|
|
|
|
#: lazarusidestrconsts.lispwnewproject
|
|
msgid "&New Project"
|
|
msgstr "&Neues Projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenproject
|
|
msgid "&Open Project"
|
|
msgstr "Projekt öffnen"
|
|
|
|
#: lazarusidestrconsts.lispwopenrecentproject
|
|
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
|
msgid "Open &Recent Project"
|
|
msgstr "Wieder öffnen"
|
|
|
|
#: lazarusidestrconsts.lispwviewexampleprojects
|
|
msgid "View &Example Projects"
|
|
msgstr "Beispielprojekte anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
|
|
msgid "Quick check Fppkg configuration at start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixerror
|
|
msgid "QuickFix error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixes
|
|
msgid "Quick fixes"
|
|
msgstr "Schnelle Fixes"
|
|
|
|
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
|
msgid "Search identifier"
|
|
msgstr "Suche Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lisquit
|
|
msgctxt "lazarusidestrconsts.lisquit"
|
|
msgid "Quit"
|
|
msgstr "Schliessen"
|
|
|
|
#: lazarusidestrconsts.lisquitlazarus
|
|
msgid "&Quit Lazarus"
|
|
msgstr "Lazarus beenden"
|
|
|
|
#: lazarusidestrconsts.lisreallydelete
|
|
msgid "Really delete?"
|
|
msgstr "Wirklich löschen?"
|
|
|
|
#: lazarusidestrconsts.lisrecenttabs
|
|
msgid "Recent tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecord
|
|
msgctxt "lazarusidestrconsts.lisrecord"
|
|
msgid "Record"
|
|
msgstr "Record"
|
|
|
|
#: lazarusidestrconsts.lisrecordedmacros
|
|
msgid "Recorded"
|
|
msgstr "Aufgezeichnet"
|
|
|
|
#: lazarusidestrconsts.lisredo
|
|
msgctxt "lazarusidestrconsts.lisredo"
|
|
msgid "Redo"
|
|
msgstr "Wiederholen"
|
|
|
|
#: lazarusidestrconsts.lisregularexpression
|
|
msgid "Regular expression"
|
|
msgstr "Regulärer Ausdruck"
|
|
|
|
#: lazarusidestrconsts.lisrelative
|
|
msgid "Relative"
|
|
msgstr "Relativ"
|
|
|
|
#: lazarusidestrconsts.lisremove
|
|
msgctxt "lazarusidestrconsts.lisremove"
|
|
msgid "Remove"
|
|
msgstr "Entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremove2
|
|
msgid "Remove?"
|
|
msgstr "Entfernen?"
|
|
|
|
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Entfernen aller ungültigen Eigenschaften"
|
|
|
|
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
|
msgid "Remove all message type filters"
|
|
msgstr "Alle Nachrichtentyp-Filter entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremoveallunits
|
|
msgid "Remove all units"
|
|
msgstr "Alle Units entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
|
msgid "Remove Compiler Option Hide Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove %s dependencies from package \"%s\"?"
|
|
msgstr "%s Abhängigkeiten aus dem Package \"%s\" entfernen?"
|
|
|
|
#: lazarusidestrconsts.lisremovedpropertys
|
|
#, object-pascal-format
|
|
msgid "Removed property \"%s\"."
|
|
msgstr "Eigenschaft \"%s\" entfernt."
|
|
|
|
#: lazarusidestrconsts.lisremovefilesfrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove %s files from package \"%s\"?"
|
|
msgstr "%s Dateien aus dem Package \"%s\" entfernen?"
|
|
|
|
#: lazarusidestrconsts.lisremovefromproject
|
|
msgid "Remove from Project"
|
|
msgstr "Vom Projekt entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremovefromsearchpath
|
|
msgid "Remove from search path"
|
|
msgstr "Aus dem Suchpfad entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremoveincludepath
|
|
msgid "Remove include path?"
|
|
msgstr "Include-Pfad entfernen?"
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable3
|
|
#, object-pascal-format
|
|
msgid "Remove local variable \"%s\""
|
|
msgstr "Lokale Variable \"%s\" entfernen?"
|
|
|
|
#: lazarusidestrconsts.lisremovemessagetypefilter
|
|
msgid "Remove Message Type Filter"
|
|
msgstr "Meldungstyp-Filter entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremovenonexistingfiles
|
|
msgid "Remove nonexistent files"
|
|
msgstr "Nicht existierende Dateien entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremoveselectedunits
|
|
msgid "Remove selected units"
|
|
msgstr "Gewählte Units entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremovethem
|
|
msgid "Remove them"
|
|
msgstr "Entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
|
msgid "Remove the paths from \"Other sources\""
|
|
msgstr "Pfade von \"Other sources\" entfernen"
|
|
|
|
#: lazarusidestrconsts.lisremoveunitpath
|
|
msgid "Remove unit path?"
|
|
msgstr "Unit-Pfad entfernen?"
|
|
|
|
#: lazarusidestrconsts.lisremoveuses
|
|
#, object-pascal-format
|
|
msgid "Remove uses \"%s\""
|
|
msgstr "\"%s\" aus uses-Abschnitt entfernen"
|
|
|
|
#: lazarusidestrconsts.lisrename
|
|
msgctxt "lazarusidestrconsts.lisrename"
|
|
msgid "Rename"
|
|
msgstr "Umbenennen"
|
|
|
|
#: lazarusidestrconsts.lisrename2
|
|
msgid "Rename ..."
|
|
msgstr "Umbenennen ..."
|
|
|
|
#: lazarusidestrconsts.lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Datei umbenennen?"
|
|
|
|
#: lazarusidestrconsts.lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Umbenennen der Datei ist fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lisrenameshowresult
|
|
msgid "Show list of renamed Identifiers"
|
|
msgstr "Zeige Liste der umbenannten Bezeichner"
|
|
|
|
#: lazarusidestrconsts.lisrenameto
|
|
#, object-pascal-format
|
|
msgid "Rename to %s"
|
|
msgstr "Zu %s umbenennen"
|
|
|
|
#: lazarusidestrconsts.lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr "In Kleinbuchstaben umbenennen"
|
|
|
|
#: lazarusidestrconsts.lisrenamingaborted
|
|
msgid "Renaming aborted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenamingconflict
|
|
msgid "Renaming conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreopenproject
|
|
msgid "Reopen project"
|
|
msgstr "Projekt erneut öffnen"
|
|
|
|
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr "Mit anderer Kodierung erneut lesen"
|
|
|
|
#: lazarusidestrconsts.lisrepeat
|
|
msgctxt "lazarusidestrconsts.lisrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Repeat"
|
|
|
|
#: lazarusidestrconsts.lisreplace
|
|
msgctxt "lazarusidestrconsts.lisreplace"
|
|
msgid "Replace"
|
|
msgstr "Ersetzen"
|
|
|
|
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
|
#, object-pascal-format
|
|
msgid "Replaced property \"%s\" with \"%s\"."
|
|
msgstr "Eigenschaft \"%s\" durch \"%s\" ersetzt."
|
|
|
|
#: lazarusidestrconsts.lisreplacedtypeswiths
|
|
#, object-pascal-format
|
|
msgid "Replaced type \"%s\" with \"%s\"."
|
|
msgstr "Typ \"%s\" durch \"%s\" ersetzt."
|
|
|
|
#: lazarusidestrconsts.lisreplacement
|
|
msgid "Replacement"
|
|
msgstr "Ersetzung"
|
|
|
|
#: lazarusidestrconsts.lisreplacementfuncs
|
|
msgid "Replacement functions"
|
|
msgstr "Ersatzfunktionen"
|
|
|
|
#: lazarusidestrconsts.lisreplacements
|
|
msgid "Replacements"
|
|
msgstr "Ersetzungen"
|
|
|
|
#: lazarusidestrconsts.lisreplaceremoveunknown
|
|
msgid "Fix unknown properties and types"
|
|
msgstr "Unbekannte Typen und Eigenschaften ersetzen"
|
|
|
|
#: lazarusidestrconsts.lisreplacewholeidentifier
|
|
msgid "Replace whole identifier"
|
|
msgstr "Ganzen Bezeichner ersetzen"
|
|
|
|
#: lazarusidestrconsts.lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr "Das Ersetzen der Auswahl ist gescheitert."
|
|
|
|
#: lazarusidestrconsts.lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/de"
|
|
|
|
#: lazarusidestrconsts.lisrescan
|
|
msgid "Rescan"
|
|
msgstr "Neuscan"
|
|
|
|
#: lazarusidestrconsts.lisreset
|
|
msgctxt "lazarusidestrconsts.lisreset"
|
|
msgid "Reset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
|
msgid "Reset all file filters to defaults?"
|
|
msgstr "Alle Dateifilter auf Vorgabe zurücksetzen?"
|
|
|
|
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
|
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
|
msgid "Resource name must be unique."
|
|
msgstr "Ressourcenname muss eindeutig sein."
|
|
|
|
#: lazarusidestrconsts.lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Ressourcen-Schreibfehler"
|
|
|
|
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
|
msgid "Resource type of project"
|
|
msgstr "Ressourcentyp des Projekts:"
|
|
|
|
#: lazarusidestrconsts.lisrestart
|
|
msgctxt "lazarusidestrconsts.lisrestart"
|
|
msgid "Restart"
|
|
msgstr "Neustart"
|
|
|
|
#: lazarusidestrconsts.lisresult2
|
|
msgid "Result:"
|
|
msgstr "Ergebnis:"
|
|
|
|
#: lazarusidestrconsts.lisreturnparameterindexedword
|
|
msgid ""
|
|
"Return parameter-indexed word from the current line preceding cursor position.\n"
|
|
"\n"
|
|
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
|
|
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
|
|
"is always the current macro.\n"
|
|
"\n"
|
|
"Example line:\n"
|
|
"i 0 count-1 forb|\n"
|
|
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
|
"\n"
|
|
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
|
msgid ""
|
|
"Return the list of all values of case variable in front of variable.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithoutExtraIndent // the case list will be generated without extra indentation"
|
|
msgstr ""
|
|
"gibt die Liste aller Werte der Case-Variable vor der Variable zurück\n"
|
|
"\n"
|
|
"Optionale Parameter (kommasepariert):\n"
|
|
"WithoutExtraIndent // the case list will be generated without extra indentation"
|
|
|
|
#: lazarusidestrconsts.lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Rücknahme fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lisrevision
|
|
msgid "Revision: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisright
|
|
msgctxt "lazarusidestrconsts.lisright"
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: lazarusidestrconsts.lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Rechte Verankerung"
|
|
|
|
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr "Rechter Randabstand. Der Wert wird zum Grund-Randabstand addiert und für den Platz rechts vom Element verwendet."
|
|
|
|
#: lazarusidestrconsts.lisrightgutter
|
|
msgctxt "lazarusidestrconsts.lisrightgutter"
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Das ist das Geschwistercontrol, an das die rechte Seite verankert wurde. Für den Parent leerlassen."
|
|
|
|
#: lazarusidestrconsts.lisrightsides
|
|
msgid "Right sides"
|
|
msgstr "Rechte Seiten"
|
|
|
|
#: lazarusidestrconsts.lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr "Rechter Abstand gleich"
|
|
|
|
#: lazarusidestrconsts.lisrun
|
|
msgctxt "lazarusidestrconsts.lisrun"
|
|
msgid "Run"
|
|
msgstr "Start"
|
|
|
|
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
|
msgid "\"Run and Design time\" packages have no limitations."
|
|
msgstr "\"Lauf- und Entwicklungszeit\"-Packages haben keine Begrenzungen."
|
|
|
|
#: lazarusidestrconsts.lisrunning
|
|
#, object-pascal-format
|
|
msgid "%s (running ...)"
|
|
msgstr "%s (wird ausgeführt ...)"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "Datei ist nicht ausführbar"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
|
#, object-pascal-format
|
|
msgid "The host application \"%s\" is not executable."
|
|
msgstr "Die Hostapplikation \"%s\" ist nicht ausführbar"
|
|
|
|
#: lazarusidestrconsts.lisrunstage
|
|
msgctxt "lazarusidestrconsts.lisrunstage"
|
|
msgid "Run"
|
|
msgstr "Start"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
|
msgid "Runtime only, cannot be installed in IDE"
|
|
msgstr "Nur für Laufzeit, kann nicht in der IDE installiert werden"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
|
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
|
msgstr "\"Nur-Laufzeit\"-Packages können nur von Projekten verwendet werden. Sie können nicht in die IDE installiert werden, nicht einmal indirekt."
|
|
|
|
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
|
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
|
|
msgstr "\"Laufzeit\"-Packages können von Projekten verwendet werden. Sie können nicht in die IDE installiert werden, es sei denn, ein Entwicklungszeit-Package benötigt sie."
|
|
|
|
#: lazarusidestrconsts.lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Gehezu fehlgeschlagen"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract Methods - not yet overridden"
|
|
msgstr "Abstrakte Methoden - noch nicht überschrieben"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsof
|
|
#, object-pascal-format
|
|
msgid "Abstract methods of %s"
|
|
msgstr "Abstrakte Methoden von %s"
|
|
|
|
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr "Cursor befindet sich nicht in einer Klassendeklaration"
|
|
|
|
#: lazarusidestrconsts.lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr "IDE ist beschänftigt"
|
|
|
|
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
|
#, object-pascal-format
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr "%s ist eine abstrakte Klasse und hat %s abstrakte Methoden."
|
|
|
|
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr "Keine abstrakten Methoden gefunden"
|
|
|
|
#: lazarusidestrconsts.lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr "Alle Auswahlen überschreiben"
|
|
|
|
#: lazarusidestrconsts.lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr "Erste Auswahl überschreiben"
|
|
|
|
#: lazarusidestrconsts.lissamselectnone
|
|
msgid "Select none"
|
|
msgstr "Keine auswählen"
|
|
|
|
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
#, object-pascal-format
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr "Es müssen %s abstrakte Methoden überschrieben werden.%sWählen Sie die Methoden, für die Rümpfe erzeugt werden sollen:"
|
|
|
|
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr "Es sind keine abstrakten Methoden für das Überschreiben übrig."
|
|
|
|
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr "Diese Methode kann nicht überschrieben werden, da sie in der aktuellen Klasse definiert ist."
|
|
|
|
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr "Kann die abstrakten Methoden der aktuellen Klasse nicht anzeigen, weil"
|
|
|
|
#: lazarusidestrconsts.lissave
|
|
msgctxt "lazarusidestrconsts.lissave"
|
|
msgid "Save"
|
|
msgstr "Speichern ..."
|
|
|
|
#: lazarusidestrconsts.lissaveall
|
|
msgctxt "lazarusidestrconsts.lissaveall"
|
|
msgid "Save All"
|
|
msgstr "Alles speichern"
|
|
|
|
#: lazarusidestrconsts.lissaveallchecked
|
|
msgid "Save All Checked"
|
|
msgstr "Alle ausgewählten speichern"
|
|
|
|
#: lazarusidestrconsts.lissaveallmodified
|
|
msgid "Save all modified files"
|
|
msgstr "Alles speichern"
|
|
|
|
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
|
msgid "Save All/Original Messages to File ..."
|
|
msgstr "Alle/Originale Nachrichten in Datei speichern ..."
|
|
|
|
#: lazarusidestrconsts.lissaveandexitdialog
|
|
msgid "Only Save"
|
|
msgstr "Nur Speichern"
|
|
|
|
#: lazarusidestrconsts.lissaveandrebuildide
|
|
msgid "Rebuild IDE"
|
|
msgstr "IDE rekompilieren"
|
|
|
|
#: lazarusidestrconsts.lissavechangedfiles
|
|
msgid "Save changed files?"
|
|
msgstr "Geänderte Dateien speichern?"
|
|
|
|
#: lazarusidestrconsts.lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Änderungen speichern?"
|
|
|
|
#: lazarusidestrconsts.lissavechangestoproject
|
|
#, object-pascal-format
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Änderungen in Projekt %s speichern?"
|
|
|
|
#: lazarusidestrconsts.lissavecurrenteditorfile
|
|
msgid "Save current editor file"
|
|
msgstr "Aktuelle Datei im Editor speichern"
|
|
|
|
#: lazarusidestrconsts.lissavedwithidesettings
|
|
msgid "Saved with IDE settings"
|
|
msgstr "Gespeichert mit IDE-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lissavedwithprojectsession
|
|
msgid "Saved with project session"
|
|
msgstr "Gespeichert mit Projektsitzung"
|
|
|
|
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
|
#, object-pascal-format
|
|
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
|
msgstr "Speichern der Datei \"%s\"%svor dem Schließen des Formulars \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lissavemacroas
|
|
msgid "Save macro as"
|
|
msgstr "Makro speichern unter"
|
|
|
|
#: lazarusidestrconsts.lissavemessages
|
|
msgid "Save messages"
|
|
msgstr "Nachrichten speichern"
|
|
|
|
#: lazarusidestrconsts.lissaveproject
|
|
#, object-pascal-format
|
|
msgid "Save project %s (*%s)"
|
|
msgstr "Projekt %s speichern (*%s)"
|
|
|
|
#: lazarusidestrconsts.lissavesessionchangestoproject
|
|
#, object-pascal-format
|
|
msgid "Save session changes to project %s?"
|
|
msgstr "Sitzungsänderungen in Projekt %s speichern?"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstate
|
|
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
|
|
msgid "Save fold info"
|
|
msgstr "Faltungsinformationen speichern"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
|
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
|
msgstr "Der Code-Editor unterstützt das Falten (zeitweiliges Verbergen) von Codeblöcken."
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistory
|
|
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
|
|
msgid "Save jump history"
|
|
msgstr "Sprunghistorie speichern"
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
|
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
|
msgstr "Strg-Klick auf einen Bezeichner im Code-Editor wird in der Sprungliste gesichert."
|
|
|
|
#: lazarusidestrconsts.lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Einstellungen sichern"
|
|
|
|
#: lazarusidestrconsts.lissaveshownmessagestofile
|
|
msgid "Save Shown Messages to File ..."
|
|
msgstr "Angezeigte Nachrichten in Datei speichern ..."
|
|
|
|
#: lazarusidestrconsts.lissavespace
|
|
msgid "Save "
|
|
msgstr "Speichere "
|
|
|
|
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
|
#, object-pascal-format
|
|
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
|
msgstr "Speichern der Datei \"%s\" als \"%s\" führt zu Zeichenverlust in Zeile %s, Spalte %s."
|
|
|
|
#: lazarusidestrconsts.lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr "Skalierungsfaktor:"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdir
|
|
msgid "Scan files in parent directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
|
msgid "Search for source files in sibling directories (parent directory and its children)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanning
|
|
msgid "Scanning"
|
|
msgstr "Scanne"
|
|
|
|
#: lazarusidestrconsts.lisscanning2
|
|
#, object-pascal-format
|
|
msgid "%s. Scanning ..."
|
|
msgstr "%s. Scanne ..."
|
|
|
|
#: lazarusidestrconsts.lisscanparentdir
|
|
msgid "Scanning parent directory"
|
|
msgstr "Scanne Vorgänger-Verzeichnis"
|
|
|
|
#: lazarusidestrconsts.lissearchpaths2
|
|
msgid "Search paths"
|
|
msgstr "Suchpfade"
|
|
|
|
#: lazarusidestrconsts.lissearchunit
|
|
#, object-pascal-format
|
|
msgid "Search Unit \"%s\""
|
|
msgstr "Suche Unit \"%s\""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
|
#, object-pascal-format
|
|
msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"."
|
|
msgstr "sekundäres Konfigurationsverzeichnis in dem Lazarus nach Vorlagendateien sucht. Voreinstellung ist \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigpath
|
|
msgid "Secondary config path"
|
|
msgstr "Sekundärer Konfigurationspfad"
|
|
|
|
#: lazarusidestrconsts.lissecondtest
|
|
msgid "&Second test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Siehe Meldungen"
|
|
|
|
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
|
#, object-pascal-format
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr "%sSiehe Projekt -> Projektinspektor"
|
|
|
|
#: lazarusidestrconsts.lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr "Hilfeeintrag auswählen"
|
|
|
|
#: lazarusidestrconsts.lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Eintrag wählen"
|
|
|
|
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
|
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
|
msgstr "Ein anderes LCL-Widgetset auswählen (Makro LCLWidgetType)"
|
|
|
|
#: lazarusidestrconsts.lisselectbuildmode
|
|
msgid "Select build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectdfmfiles
|
|
#, fuzzy
|
|
#| msgid "Select Delphi form files (*.dfm)"
|
|
msgid "Select Delphi form files (*.dfm|*.fmx)"
|
|
msgstr "Delphi-Formulardatei (*.dfm) auswählen"
|
|
|
|
#: lazarusidestrconsts.lisselected
|
|
msgctxt "lazarusidestrconsts.lisselected"
|
|
msgid "Selected"
|
|
msgstr "Ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lisselectedaddition
|
|
msgid "Selected addition:"
|
|
msgstr "Gewählte Hinzufügung:"
|
|
|
|
#: lazarusidestrconsts.lisselectedandchildcontrols
|
|
msgid "Selected and child controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedbottomneighbour
|
|
msgid "(selected bottom neighbour)"
|
|
msgstr "(unteren Nachbarn auswählen)"
|
|
|
|
#: lazarusidestrconsts.lisselectedcommandsmapping
|
|
msgid "Selected Command's Mapping"
|
|
msgstr "Gewählte Tastenkombination"
|
|
|
|
#: lazarusidestrconsts.lisselectedforinstallation
|
|
msgid "selected for installation"
|
|
msgstr "zur Installation ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lisselectedforuninstallation
|
|
msgid "selected for uninstallation"
|
|
msgstr "zur Deinstallation ausgewählt"
|
|
|
|
#: lazarusidestrconsts.lisselectedleftneighbour
|
|
msgid "(selected left neighbour)"
|
|
msgstr "(linken Nachbarn auswählen)"
|
|
|
|
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
|
msgid "Selected message in messages window:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedmodeswerecompiled
|
|
#, object-pascal-format
|
|
msgid "Selected %d modes were successfully compiled."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedrightneighbour
|
|
msgid "(selected right neighbour)"
|
|
msgstr "(rechten Nachbarn auswählen)"
|
|
|
|
#: lazarusidestrconsts.lisselectedtopneighbour
|
|
msgid "(selected top neighbour)"
|
|
msgstr "(oberen Nachbarn auswählen)"
|
|
|
|
#: lazarusidestrconsts.lisselectfile
|
|
msgid "Select the file"
|
|
msgstr "Die Datei auswählen"
|
|
|
|
#: lazarusidestrconsts.lisselectfpcpath
|
|
msgid "Select the path where FPC is installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
|
msgid "Select FPC source directory"
|
|
msgstr "FPC-Quell-Verzeichnis auswählen"
|
|
|
|
#: lazarusidestrconsts.lisselectframe
|
|
msgid "Select Frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Auswahl überschreitet Stringkonstante"
|
|
|
|
#: lazarusidestrconsts.lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Auswahlwerkzeug"
|
|
|
|
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
|
msgid "Select Lazarus source directory"
|
|
msgstr "Lazarus-Quell-Verzeichnis auswählen"
|
|
|
|
#: lazarusidestrconsts.lisselectpathto
|
|
#, object-pascal-format
|
|
msgid "Select path to %s"
|
|
msgstr "Wähle Pfad zu %s"
|
|
|
|
#: lazarusidestrconsts.lisselecttargetdirectory
|
|
msgid "Select target directory"
|
|
msgstr "Zielverzeichnis auswählen"
|
|
|
|
#: lazarusidestrconsts.lissetallcolors
|
|
msgid "Set all colors:"
|
|
msgstr "Alle Farben setzen"
|
|
|
|
#: lazarusidestrconsts.lissetdefault
|
|
msgid "Set default"
|
|
msgstr "Voreinstellungen setzen"
|
|
|
|
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
|
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
msgstr "Zum Übersetzen der Compilermeldungen in eine andere Sprache (d.h. nicht Englisch). Zum Beispiel Deutsch: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
|
|
#: lazarusidestrconsts.lissetupdefaultindentation
|
|
msgid "(Set up default indentation)"
|
|
msgstr "(Standard-Einrückung festlegen)"
|
|
|
|
#: lazarusidestrconsts.lisshort
|
|
msgid "Short:"
|
|
msgstr "Kurz:"
|
|
|
|
#: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar
|
|
msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshortnopath
|
|
msgid "Short, no path"
|
|
msgstr "Kurz, kein Pfad"
|
|
|
|
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
|
#, object-pascal-format
|
|
msgid "Should the component \"%s\" be auto created when the application starts?"
|
|
msgstr "Soll die Komponente \"%s\" automatisch erzeugt werden wenn die Anwendung startet?"
|
|
|
|
#: lazarusidestrconsts.lisshow
|
|
msgid "Show"
|
|
msgstr "Anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowabstractmethodsof
|
|
#, object-pascal-format
|
|
msgid "Show abstract methods of \"%s\""
|
|
msgstr "Zeige abstrakte Methoden von \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
|
msgid "Show component tree"
|
|
msgstr "Komponenten-Baum anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowconsole
|
|
msgid "Show console"
|
|
msgstr "Konsole anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowdeclarationhints
|
|
msgid "Show declaration hints"
|
|
msgstr "Deklarations-Hinweise anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
|
msgid "Show differences between modes ..."
|
|
msgstr "Zeige Unterschiede zwischen den Modi..."
|
|
|
|
#: lazarusidestrconsts.lisshowemptyunitspackages
|
|
msgid "Show empty units/packages"
|
|
msgstr "Leere Units/Packages anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
|
msgid "Show FPC message \"lines compiled\""
|
|
msgstr "Zeige FPC-Nachricht \"Zeilen kompiliert\""
|
|
|
|
#: lazarusidestrconsts.lisshowglyphsfor
|
|
msgid "Show Glyphs for"
|
|
msgstr "Zeige Bildzeichen für"
|
|
|
|
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
|
msgid "Show gutter"
|
|
msgstr "Trennlinie anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowhelp
|
|
msgid "Show help"
|
|
msgstr "Zeige Hilfe"
|
|
|
|
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
|
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
|
msgid "Show hints"
|
|
msgstr "Hinweise im Objektinspektor anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr "Bezeichner anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
|
msgid "Show information box"
|
|
msgstr "Infobox anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowmessagetypeid
|
|
msgid "Show Message Type ID"
|
|
msgstr "Zeige Nachrichtentyp-ID"
|
|
|
|
#: lazarusidestrconsts.lisshowmultiplelines
|
|
msgid "Show multiple lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowonlymodified
|
|
msgid "Show only modified"
|
|
msgstr "Nur geänderte anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
|
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
|
msgstr "Zeigt nur einen Schalter in der Taskbar für die ganze IDE anstatt einen pro Fenster. Einige Linux-Fenstermanager wie Cinnamon unterstützen das nicht und zeigen immer einen Schalter pro Fenster."
|
|
|
|
#: lazarusidestrconsts.lisshowoutput
|
|
msgid "Show output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoverviewgutter
|
|
msgid "Show overview gutter"
|
|
msgstr "Übersichtssteg anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Packages anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
|
msgid "Show position of source editor"
|
|
msgstr "Zeige Position des Quelltexteditors"
|
|
|
|
#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
|
|
msgid "Show property filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
|
msgid "Show recently used identifiers at top"
|
|
msgstr "Zeige kürzlich benutzte Bezeichner oben an"
|
|
|
|
#: lazarusidestrconsts.lisshowrelativepaths
|
|
msgid "Show relative paths"
|
|
msgstr "Zeige relative Pfade"
|
|
|
|
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
|
msgid "Shows all controls in tree hierarchy."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
|
msgid "A box at the bottom shows description for the selected property."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
|
msgid "Show setup dialog for most important settings."
|
|
msgstr "Zeige Einrichtungsdialog für die wichtigsten Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr "Sonderzeichen anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
|
msgid "Show statusbar"
|
|
msgstr "Statusleiste anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowunits
|
|
msgid "Show units"
|
|
msgstr "Units anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitialization
|
|
msgid "Show units with initialization/finalization sections"
|
|
msgstr "Zeige Units mit initialization/finalization Abschnitten"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
|
msgid "These units may initialize global data used by the program/application. Remove with care."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunusedunits
|
|
msgid "Show unused units ..."
|
|
msgstr "Ungenutzte Units ..."
|
|
|
|
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
|
msgid "Show value hints while debugging"
|
|
msgstr "Werte-Hinweise während des Debuggens anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisshowversionandexit
|
|
msgid "Show version and exit."
|
|
msgstr "Version anzeigen und Ende"
|
|
|
|
#: lazarusidestrconsts.lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr "Zum Kleinsten schrumpfen"
|
|
|
|
#: lazarusidestrconsts.lissibling
|
|
msgid "Sibling"
|
|
msgstr "Geschwister"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogram
|
|
msgid "Simple Program"
|
|
msgstr "Einfaches Programm"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
|
msgid "A most simple Free Pascal command line program."
|
|
msgstr "Ein einfachstes Free-Pascal-Kommandozeilenprogramm."
|
|
|
|
#: lazarusidestrconsts.lissimplesyntax
|
|
msgid "Simple syntax"
|
|
msgstr "Einfache Syntax"
|
|
|
|
#: lazarusidestrconsts.lisskiperrors
|
|
msgid "Skip errors"
|
|
msgstr "Fehler überspringen"
|
|
|
|
#: lazarusidestrconsts.lisskipfile
|
|
msgid "Skip file"
|
|
msgstr "Datei überspringen"
|
|
|
|
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr "Datei übergehen und das Laden fortsetzen"
|
|
|
|
#: lazarusidestrconsts.lisskiploadinglastproject
|
|
msgid "Skip loading last project."
|
|
msgstr "Das Laden des letzten Projekts übergehen"
|
|
|
|
#: lazarusidestrconsts.lisskipstartupchecks
|
|
msgid "Skip selected checks at startup. Valid options are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
|
msgid "Slower but more accurate."
|
|
msgstr "Langsamer dafür genauer."
|
|
|
|
#: lazarusidestrconsts.lissmallerratherthanfaster
|
|
msgid "Smaller rather than faster"
|
|
msgstr "Lieber kleiner als schneller"
|
|
|
|
#: lazarusidestrconsts.lissmatches
|
|
msgid "Matches"
|
|
msgstr "Treffer"
|
|
|
|
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Entschuldigung, dieser Typ ist (noch) nicht implementiert"
|
|
|
|
#: lazarusidestrconsts.lissorthistorylimit
|
|
msgid "History items limit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissorting
|
|
msgid "Sorting"
|
|
msgstr "Sortierung"
|
|
|
|
#: lazarusidestrconsts.lissortorderalphabetic
|
|
msgid "Alphabetic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortorderdefinition
|
|
msgid "Definition (Scoped)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortorderscopedalphabetic
|
|
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
|
|
msgid "Alphabetic (Scoped)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortordertitle
|
|
msgid "Order by"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Aufsteigend"
|
|
|
|
#: lazarusidestrconsts.lissortselcasesensitive
|
|
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr "&Klein/groß beachten"
|
|
|
|
#: lazarusidestrconsts.lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Absteigend"
|
|
|
|
#: lazarusidestrconsts.lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Domain"
|
|
|
|
#: lazarusidestrconsts.lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Leerzeichen übergehen"
|
|
|
|
#: lazarusidestrconsts.lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Zeilen"
|
|
|
|
#: lazarusidestrconsts.lissortseloptions
|
|
msgctxt "lazarusidestrconsts.lissortseloptions"
|
|
msgid "Options"
|
|
msgstr "Einstellungen"
|
|
|
|
#: lazarusidestrconsts.lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Absätze"
|
|
|
|
#: lazarusidestrconsts.lissortselpreview
|
|
msgctxt "lazarusidestrconsts.lissortselpreview"
|
|
msgid "Preview"
|
|
msgstr "Vorschau"
|
|
|
|
#: lazarusidestrconsts.lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Annehmen"
|
|
|
|
#: lazarusidestrconsts.lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Auswahl sortieren"
|
|
|
|
#: lazarusidestrconsts.lissortselwords
|
|
msgctxt "lazarusidestrconsts.lissortselwords"
|
|
msgid "Words"
|
|
msgstr "Worte"
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationaresame
|
|
#, object-pascal-format
|
|
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
|
#, object-pascal-format
|
|
msgid "Source directory \"%s\" does not exist."
|
|
msgstr "Das Quellverzeichnis \"%s\" ist nicht vorhanden."
|
|
|
|
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
|
msgid "Source Editor Window Manager"
|
|
msgstr "Quelltexteditor-Fenstermanager"
|
|
|
|
#: lazarusidestrconsts.lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Quelltext geändert"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
|
#, object-pascal-format
|
|
msgid "Source of page \"%s\" has changed. Save?"
|
|
msgstr "Der Quelltext der Seite \"%s\" wurde ändert. Speichern?"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
|
#, object-pascal-format
|
|
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Quelltext-Pfade"
|
|
|
|
#: lazarusidestrconsts.lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Gleichmäßig aufteilen"
|
|
|
|
#: lazarusidestrconsts.lissrcos
|
|
msgid "Src OS"
|
|
msgstr "Quell-OS"
|
|
|
|
#: lazarusidestrconsts.lisssearching
|
|
msgid "Searching"
|
|
msgstr "Suche"
|
|
|
|
#: lazarusidestrconsts.lisssearchtext
|
|
msgid "Search text"
|
|
msgstr "Suchtext"
|
|
|
|
#: lazarusidestrconsts.lisstartconversion
|
|
msgid "Start Conversion"
|
|
msgstr "Konvertierung beginnen"
|
|
|
|
#: lazarusidestrconsts.lisstartide
|
|
msgid "Start IDE"
|
|
msgstr "IDE starten"
|
|
|
|
#: lazarusidestrconsts.lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr "Mit einem neuen Projekt beginnen"
|
|
|
|
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
|
msgid "Statusbar shows the property's name and the class where it is published."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstop
|
|
msgctxt "lazarusidestrconsts.lisstop"
|
|
msgid "Stop"
|
|
msgstr "Halt"
|
|
|
|
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Das Debugging abbrechen und das Projekt neu erzeugen?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Debuggen abbrechen?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Debugging beenden?"
|
|
|
|
#: lazarusidestrconsts.lisstoponexception
|
|
msgid "Stop on exception"
|
|
msgstr "Bei Ausnahmen anhalten"
|
|
|
|
#: lazarusidestrconsts.lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Debuggen abbrechen?"
|
|
|
|
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
|
msgid "Store path delimiters \\ and / as"
|
|
msgstr "Speichere Pfadtrenner \\ und /"
|
|
|
|
#: lazarusidestrconsts.lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Streaming-Fehler"
|
|
|
|
#: lazarusidestrconsts.lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr "Unterprozedur"
|
|
|
|
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr "Unterprozedur derselben Stufe"
|
|
|
|
#: lazarusidestrconsts.lissubtarget
|
|
msgid "Subtarget"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccess
|
|
msgid "Success"
|
|
msgstr "Erfolg"
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexported
|
|
#, object-pascal-format
|
|
msgid "Successfully exported to \"%s\"."
|
|
msgstr "Erfolgreich exportiert nach \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
|
#, object-pascal-format
|
|
msgid "Successfully exported %d BuildModes to \"%s\"."
|
|
msgstr "%d Erstellmodi erfolgreich exportiert nach \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
|
#, object-pascal-format
|
|
msgid "Successfully exported compiler options to \"%s\"."
|
|
msgstr "Compilereinstellungen erfolgreich exportiert nach \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimported
|
|
#, object-pascal-format
|
|
msgid "Successfully imported from \"%s\"."
|
|
msgstr "Erfolgreich importiert aus \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
|
#, object-pascal-format
|
|
msgid "Successfully imported %d BuildModes from \"%s\"."
|
|
msgstr "%d Erstellmodi erfolgreich importiert aus \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
|
#, object-pascal-format
|
|
msgid "Successfully imported compiler options from \"%s\"."
|
|
msgstr "Compilereinstellungen erfolgreich importiert aus \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
|
msgid "Suggest default name of new file in lowercase"
|
|
msgstr "Neuen Dateinamen in Kleinbuchstaben vorschlagen"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousincludepath
|
|
msgid "Suspicious include path"
|
|
msgstr "Verdächtiger Include-Pfad"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousunitpath
|
|
msgid "Suspicious unit path"
|
|
msgstr "Verdächtiger Unit-Pfad"
|
|
|
|
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Ungültiger Variablenname"
|
|
|
|
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is not a valid identifier."
|
|
msgstr "\"%s\" ist als Bezeichner ungültig."
|
|
|
|
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Systemvariablen überschreiben"
|
|
|
|
#: lazarusidestrconsts.lisswitchfiltersettings
|
|
msgid "Switch Filter Settings"
|
|
msgstr "Filtereinstellungen umschalten"
|
|
|
|
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
|
msgid "Switch to Favorites tab after asking for component name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr "Syntax-Modus"
|
|
|
|
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
|
msgid "system.ppu not found. Check your fpc.cfg."
|
|
msgstr "system.ppu nicht gefunden. Prüfen Sie ihre fpc.cfg."
|
|
|
|
#: lazarusidestrconsts.listab
|
|
msgid "Tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts.listaborderconfirmsort
|
|
#, object-pascal-format
|
|
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
|
msgstr "Tab-Reihenfolge aller untergeordneten Elemente von\"%s\" nach ihren Positionen sortieren?"
|
|
|
|
#: lazarusidestrconsts.listaborderdownhint
|
|
msgid "Move the selected control down in tab order"
|
|
msgstr "Bewegt das gewählte Steuerelement in der Tabulatorreihenfolge nach unten"
|
|
|
|
#: lazarusidestrconsts.listaborderof
|
|
#, object-pascal-format
|
|
msgid "Tab Order of %s"
|
|
msgstr "Tabulatorreihenfolge von %s"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursionhint
|
|
msgid "Calculate tab order recursively for child controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderrecursively
|
|
msgid "recursively"
|
|
msgstr "rekursiv"
|
|
|
|
#: lazarusidestrconsts.listabordersorthint
|
|
msgid "Calculate tab order for controls by their X- and Y- positions"
|
|
msgstr "Tab-Reihenfolge aller untergeordneten Elemente nach ihren Positionen sortieren?"
|
|
|
|
#: lazarusidestrconsts.listaborderuphint
|
|
msgid "Move the selected control up in tab order"
|
|
msgstr "Bewegt das gewählte Steuerelement in der Tabulatorreihenfolge nach oben"
|
|
|
|
#: lazarusidestrconsts.listabsfor
|
|
#, object-pascal-format
|
|
msgid "Tabs for %s"
|
|
msgstr "Tabs für %s"
|
|
|
|
#: lazarusidestrconsts.listarget
|
|
msgid "Target:"
|
|
msgstr "Ziel:"
|
|
|
|
#: lazarusidestrconsts.listarget2
|
|
#, object-pascal-format
|
|
msgid ", Target: %s"
|
|
msgstr ", Ziel: %s"
|
|
|
|
#: lazarusidestrconsts.listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Zielprozessor"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
|
msgid "Target file name: (-o, empty = use unit output directory)"
|
|
msgstr "Ziel-Dateiname: (-o, leer = verwende Unit-Ausgabeverzeichnis)"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameo
|
|
msgid "Target file name (-o):"
|
|
msgstr "Ziel-Dateiname (-o):"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Zieldateiname des Projekts"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr "Zieldateiname + Parameter"
|
|
|
|
#: lazarusidestrconsts.listargetisreadonly
|
|
msgid "Target is read only"
|
|
msgstr "Ziel ist schreibgeschützt"
|
|
|
|
#: lazarusidestrconsts.listargetos
|
|
msgctxt "lazarusidestrconsts.listargetos"
|
|
msgid "Target OS"
|
|
msgstr "Zielbetriebssystem"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcell
|
|
msgid "Editable Cell"
|
|
msgstr "Bearbeitbare Zelle"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
|
#, object-pascal-format
|
|
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplatefile
|
|
msgid "Template file"
|
|
msgstr "Vorlagendatei"
|
|
|
|
#: lazarusidestrconsts.listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Testverzeichnis"
|
|
|
|
#: lazarusidestrconsts.listesturl
|
|
msgid "Test URL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
|
#, object-pascal-format
|
|
msgid "The Application Bundle was created for \"%s\""
|
|
msgstr "Das Application-Bundle wurde erzeugt für \"%s\""
|
|
|
|
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
#, object-pascal-format
|
|
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgstr "Die Klasse \"%s\" ist ein TControl und kann nicht auf ein Nicht-Control kopiert werden.%sKann nicht einfügen."
|
|
|
|
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
|
msgstr "Die Compiler-Datei \"%s\" sieht nicht korrekt aus:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
#, object-pascal-format
|
|
msgid "The component %s can not be deleted because it is not owned by %s."
|
|
msgstr "Die Komponente %s kann nicht gelöscht werden, da sie nicht %s gehört."
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
|
msgstr "Der Komponenteneditor der Klasse \"%s\" hat einen Fehler erzeugt:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
|
msgstr "Der Komponenteneditor der Klasse \"%s\"%s, aufgerufen mit dem Verb #%s \"%s\"%shat den folgenden Fehler erzeugt:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
#, object-pascal-format
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr "Die Komponente %s ist von %s abgeleitet.%sEine abgeleitete Komponente wird in ihrem Vorfahr gelöscht."
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
|
#, object-pascal-format
|
|
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
|
msgstr "Die Komponente %s ist von %s abgeleitet.%sUm eine abgeleitete Komponente umzubenennen wird der Vorfahr geöffnet und sie hier umbenannt."
|
|
|
|
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
|
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
|
msgstr "Alle Komponenten auf dem Formular/Datenmodul müssen einen eindeutigen Namen besitzen. Er ist wie jeder Pascal-Bezeichner schreibweisenunabhängig."
|
|
|
|
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
|
msgid "The configuration will be downgraded/converted."
|
|
msgstr "Die Konfiguration wird zurückgesetzt/umgewandelt."
|
|
|
|
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
|
#, object-pascal-format
|
|
msgid "The %s contains a nonexistent directory:%s%s"
|
|
msgstr "%s enthält ein nicht existierendes Verzeichnis:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
|
#, object-pascal-format
|
|
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
|
msgstr "%s enthält das Zeichen Stern (*).%sLazarus verwendet es als normales Zeichen und erweitert es nicht zu einer Dateimaske."
|
|
|
|
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
|
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
|
msgstr "Der aktuelle FPC hat keine Konfigurationsdatei. Er wird vermutlich einige Units nicht finden. Überprüfen Sie Ihre FPC-Installation."
|
|
|
|
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
#, object-pascal-format
|
|
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
|
msgstr "Der Debugger \"%s\"%sfehlt oder ist nicht ausführbar.%sSiehe: Werkzeuge -> Einstellungen -> Debugger"
|
|
|
|
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
|
msgid "The default mode must be stored in project, not in session."
|
|
msgstr "Der Vorgabemodus muß im Projekt gespeichert werden, nicht in der Sitzung."
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
|
#, object-pascal-format
|
|
msgid "The destination directory%s\"%s\" does not exist."
|
|
msgstr "Das Zielverzeichnis%s\"%s\" ist nicht vorhanden."
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
|
msgstr "Das Verzeichnis \"%s\" enthält keine Projekt-Includedateien mehr. Soll dieses Verzeichnis aus dem Projekt-Includesuchpfad entfernt werden?"
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
|
msgstr "Das Verzeichnis \"%s\" enthält keine Projekt-Units mehr. Soll dieses Verzeichnis aus dem Projekt-Unitsuchpfad entfernt werden?"
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
|
msgstr "Das Verzeichnis \"%s\" wird nicht länger im Unit-Pfad benötigt.%sEntfernen?"
|
|
|
|
#: lazarusidestrconsts.listhefile
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\""
|
|
msgstr "Die Datei \"%s\""
|
|
|
|
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
|
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
|
msgstr "Der Dateiindex wird für Funktionen wie \"Deklaration suchen\" benötigt. Während des Scannens können Sie Dateien bearbeiten und kompilieren, aber Funktionen wie \"Deklaration suchen\" werden Unit-nicht-gefunden-Fehler anzeigen. Dies kann eine Minute dauern."
|
|
|
|
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
|
msgstr "Die Datei \"%s\" ist kein Lazarus-Projekt.%sEin neues Projekt für \"%s\" anlegen?"
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisinvalid
|
|
#, object-pascal-format
|
|
msgid "The file mask \"%s\" is invalid."
|
|
msgstr "Die Dateimaske \"%s\" ist ungültig."
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
|
#, object-pascal-format
|
|
msgid "The file mask \"%s\" is not a valid regular expression."
|
|
msgstr "Die Dateimaske \"%s\" ist kein gültiger regulärer Ausdruck."
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr "Die Datei \"%s\" scheint ein Programm zu sein.%sAktuelles Projekt schließen und ein neues Lazarus-Projekt für dieses Programm erzeugen?%s\"Nein\" lädt die Datei als normalen Quelltext."
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
#, object-pascal-format
|
|
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
|
msgstr "Die Datei %s scheint die Programmdatei eines vorhandenen Lazarus-Projekts zu sein."
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
|
msgstr "Die Datei \"%s\" wurde nicht gefunden.%sWollen Sie selbst nach ihr suchen?"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "Die Datei \"%s\" wurde nicht gefunden.%s »Übergehen« lädt das Projekt weiter,%s»Abbruch« beendet den Ladevorgang."
|
|
|
|
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
#, object-pascal-format
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
|
msgstr "Die folgenden Methoden, die von %s verwendet werden sind nicht im Quelltext%s%s%s%s%sDie hängenden Verweise löschen?"
|
|
|
|
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
|
msgstr "Das FPC-Quellverzeichnis \"%s\" sieht nicht korrekt aus:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
|
#, object-pascal-format
|
|
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
|
msgstr "Die ausführbare Datei des Free Pascal Compilers hat typischerweise den Namen \"%s\". Sie können ebenfalls den zielspezifischen Compiler wie \"%s\" verwenden. Geben Sie bitte den vollständigen Dateipfad an."
|
|
|
|
#: lazarusidestrconsts.listheideisstillbuilding
|
|
msgid "The IDE is still building."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
|
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
|
msgstr "Der Bezeichner ist eine Unit. Bitte benennen sie eine Unit mit Datei -> Speichern unter ... um"
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitproceedanyway
|
|
#, object-pascal-format
|
|
msgid "The identifier is a %s.%sNew file(s) will be created, old can be deleted.%sProceed anyway?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
#, object-pascal-format
|
|
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
|
msgstr "Die Taste %s ist bereits %s%s zugewiesen.%s%sDie alte Zuweisung entfernen und der Taste die neue Funktion %s zuordnen?"
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
|
#, object-pascal-format
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
|
msgstr "Das Anwendungspaket %s%sdas für die Ausführung nötig ist fehlt oder ist nicht ausführbar.%sWollen Sie es anlegen?%sDie Einstellungen finden Sie unter Projekt -> Projekteinstellungen -> Anwendung."
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
#, object-pascal-format
|
|
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
|
msgstr "Das ausführende Programm \"%s\"%sist nicht vorhanden oder nicht ausführbar.%sSiehe Start -> Startparameter -> Lokal"
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
|
#, object-pascal-format
|
|
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
|
msgstr "Das Lazarus Verzeichnis enthält die Quellen der IDE und die Package-Dateien der LCL und vieler Standardpackages. Zum Beispiel enthält es die Datei \"ide%slazarus.lpi\". Die Übersetzungsdateien befinden sich hier ebenfalls."
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
|
msgstr "Das Lazarus-Verzeichnis \"%s\" sieht nicht korrekt aus:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhelazarussourcesuse
|
|
#, object-pascal-format
|
|
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
|
msgstr "Die LFM-Datei (Lazarus Form) enthält ungültige Eigenschaften. Das bedeutet beispielsweise, daß einige Eigenschaften/Klassen nicht in der aktuellen LCL enthalten sind. Das wird normalerweise behoben, indem diese Eigenschaften aus der LFM-Datei entfernt und der Pascal-Quelltext manuell korrigiert wird."
|
|
|
|
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
|
#, object-pascal-format
|
|
msgid "The macro \"%s\" does not begin with \"%s\"."
|
|
msgstr "Das Makro \"%s\" beginnt nicht mit \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
|
#, object-pascal-format
|
|
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
|
msgstr "\"make\" hat typischerweise den Namen \"%s\". Es wird für die Erstellung der IDE benötigt. Bitte geben sie den vollständigen Dateipfad an."
|
|
|
|
#: lazarusidestrconsts.listhenamecontainsapascalkeyword
|
|
#, object-pascal-format
|
|
msgid "The name \"%s\" contains a Pascal keyword."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
|
#, object-pascal-format
|
|
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
|
msgstr "Die neue Include-Datei befindet sich noch nicht im Include-Suchpfad.%sVerzeichnis hinzufügen %s?"
|
|
|
|
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
#, object-pascal-format
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr "Die neue Unit ist noch nicht im Unit-Suchpfad.%sVerzeichnis %s hinzufügen?"
|
|
|
|
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
|
msgid "The old configuration will be upgraded."
|
|
msgstr "Die alte Konfiguration wird aktualisiert."
|
|
|
|
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
|
#, object-pascal-format
|
|
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
|
msgstr "\"Andere Quellen\" enthalten ein Verzeichnis, welches bereits in \"Andere Unitdateien\" vorkommt.%s%s"
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
|
#, object-pascal-format
|
|
msgid "The output directory \"%s\" is missing."
|
|
msgstr "Das Ausgabeverzeichnis \"%s\" fehlt."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr "Das Ausgabeverzeichnis von %s ist im Include-Pfad von %s aufgeführt."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr "Das Ausgabeverzeichnis von %s ist im abgeleiteten Include-Pfad von %s aufgeführt."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr "Das Ausgabeverzeichnis von %s ist im abgeleiteten Unit-Suchpfad von %s aufgeführt."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr "Das Ausgabeverzeichnis von %s ist im Unit-Suchpfad von %s aufgeführt."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr " Das Ausgabeverzeichnis sollte ein eigenes Verzeichnis sein und keine Quelldateien enthalten."
|
|
|
|
#: lazarusidestrconsts.listheownerclasshasthisname
|
|
msgid "The owner class has this name"
|
|
msgstr "Die Eigentümerklasse heißt"
|
|
|
|
#: lazarusidestrconsts.listheownerhasthisname
|
|
msgid "The owner has this name"
|
|
msgstr "Der Eigentümer heißt"
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
|
#, object-pascal-format
|
|
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr "Das Package %s fügt den Pfad \"%s\" zum Include-Pfad der IDE hinzu.%sDies ist wahrscheinlich eine Fehlkonfiguration des Packages."
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
|
#, object-pascal-format
|
|
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr "Das Package %s fügt den Pfad \"%s\" zum Unit-Pfad der IDE hinzu.%sDies ist wahrscheinlich eine Fehlkonfiguration des Packages."
|
|
|
|
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr "Das Package enthält bereits eine Unit mit diesem Namen."
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
|
#, object-pascal-format
|
|
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
|
|
msgstr "Das Package %s kann nicht installiert werden, weil es vom Package \"%s\" abhängt, welches ein Nur-Laufzeit-Package ist."
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
|
#, object-pascal-format
|
|
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
|
|
msgstr "Das Package %s kann nicht deinstalliert werden, da es von der IDE selbst benötigt wird."
|
|
|
|
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
|
#, object-pascal-format
|
|
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
|
msgstr "Das Package %s hat keine \"Register\"-Prozedur, was meistens bedeutet, dass es kein IDE-Addon darstellt. Seine Installation erhöht vermutlich nur die Größe der IDE und könnte sie sogar instabil machen.%sHinweis: Falls Sie ein Package in Ihrem Projekt verwenden wollen, benutzen Sie den Menüpunkt \"Zum Projekt hinzufügen\"."
|
|
|
|
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
|
#, object-pascal-format
|
|
msgid "The package %s is already in the list"
|
|
msgstr "Das Package %s ist bereits in der Liste"
|
|
|
|
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
|
#, object-pascal-format
|
|
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
|
msgstr "Das Package %s ist kein Entwicklungszeit-Package. Es kann nicht in der IDE installiert werden."
|
|
|
|
#: lazarusidestrconsts.listhepackageisusedby
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is used by"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
|
#, object-pascal-format
|
|
msgid "The path of \"make\" is not correct: \"%s\""
|
|
msgstr "Der Pfad von \"make\" ist nicht korrekt: \"%s\""
|
|
|
|
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
#, object-pascal-format
|
|
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
|
msgstr "Das Programm \"make\" wurde nicht gefunden.%sEs wird für das Kompilieren von Lazarus benötigt."
|
|
|
|
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
|
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
|
msgstr "Die Projekt-Compilereinstellungen unterscheiden sich von den Direktiven in der Hauptquelldatei. Für die neue Unit werden der Modus und der String-Typ der Projekteinstellungen verwendet:"
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
|
|
msgid "Running your application with debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
|
|
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
|
|
msgid "Run with no debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
|
|
#, object-pascal-format
|
|
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
|
|
msgid "Choose Debug Information format"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
|
#, object-pascal-format
|
|
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
|
msgstr "Das Projekt bindet die LCL-Unit-Schnittstellen nicht ein, welche von LCLBase benötigt werden.%sEs führt zu Linker-Fehlern, wenn die LCL-Fenster ohne ihre Interfaces eingebunden werden."
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
|
|
#, object-pascal-format
|
|
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
|
msgid "The project has no main source file."
|
|
msgstr "Das Projekt hat keine Haupt-Quelldatei."
|
|
|
|
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
|
#, object-pascal-format
|
|
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
|
msgstr "Die Projekt-Infodatei \"%s\"%sist identisch zur Haupt-Quelltextdatei des Projekts!"
|
|
|
|
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
|
#, object-pascal-format
|
|
msgid "The project information file \"%s\"%shas changed on disk."
|
|
msgstr "Die Projektinformationsdatei \"%s\"%sauf dem Datenträger hat sich geändert."
|
|
|
|
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
#, object-pascal-format
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Das Projekt muß vor dem Kompilieren gesichert werden.%sWenn Sie das Testverzeichnis in den Umgebungseinstellungen setzen,%skönnen Sie neue Projekte erzeugen und sofort kompilieren.%sProjekt speichern?"
|
|
|
|
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
|
|
msgid "The project uses FPC resources which require at least FPC 2.4"
|
|
msgstr "Das Projekt benutzt FPC-Ressourcen, die mindestens FPC 2.4 benötigen"
|
|
|
|
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
|
#, object-pascal-format
|
|
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
|
msgstr "Das Projekt nutzt die Ziele OS=%s und CPU=%s.%sDie system.ppu für dieses Ziel wurde nicht in den Binärverzeichnissen von FPC gefunden. %sStellen Sie sicher, daß fpc für diese Zielplattform richtig installiert ist und daß die fpc.cfg die richtigen Verzeichnisangaben enthält."
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
|
#, object-pascal-format
|
|
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
|
|
#, object-pascal-format
|
|
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
|
#, object-pascal-format
|
|
msgid "%sThere are additional notes for this message on%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
|
#, object-pascal-format
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "Das Verzeichnis enthält andere Dateien mit demselben Namen,%sdie sich nur in der Schreibung unterscheiden:%s%s%sSoll diese gelöscht werden?"
|
|
|
|
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
|
#, object-pascal-format
|
|
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
|
msgstr "Es gibt eine Datei mit dem gleichen Namen und einer ähnlichen Endung auf dem Datenträger%sVorhandene Datei: %s%sNeue Datei: %s%sProblematische Datei löschen?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
|
msgid "There is already a build mode with this name."
|
|
msgstr "Es gibt bereits einen Erstellmodus mit diesem Namen."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
|
#, object-pascal-format
|
|
msgid "There is already a component class with the name %s."
|
|
msgstr "Es gibt bereits eine Komponentenklasse mit dem Namen %s."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
|
msgid "There is already a component with this name"
|
|
msgstr "Es gibt bereits eine Komponente mit diesem Namen."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafilein
|
|
#, object-pascal-format
|
|
msgid "There is already a file%s%s%sin %s"
|
|
msgstr "Es gibt bereits eine Datei%s%s%sin %s."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
|
#, object-pascal-format
|
|
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
|
msgstr "Es gibt bereits eine Datei \"%s\" in %s%sAlt: %s%sNeu: %s%s%sFortfahren?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
|
#, object-pascal-format
|
|
msgid "There is already a form with the name \"%s\""
|
|
msgstr "Es gibt schon ein Formular mit dem Namen \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
|
#, object-pascal-format
|
|
msgid "There is already a macro with the name \"%s\"."
|
|
msgstr "Es gibt bereits ein Makro namens \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
|
#, object-pascal-format
|
|
msgid "There is already an IDE macro with the name \"%s\""
|
|
msgstr "Es gibt bereits ein IDE-Makro mit dem Namen \"%s\""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
|
#, object-pascal-format
|
|
msgid "There is already a package %s in the list"
|
|
msgstr "Es gibt bereits ein Package %s in der Liste"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
|
#, object-pascal-format
|
|
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
|
msgstr "Es gibt bereits eine Unit \"%s\" in %s%sAlt: %s%sNeu: %s%sStellen Sie sicher, daß der Unit-Suchpfad nur eine von ihnen enthält.%s%sFortfahren?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
#, object-pascal-format
|
|
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Es gibt bereits eine Unit mit dem Namen \"%s\". Pascal-Bezeichner müssen eindeutig sein."
|
|
|
|
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
|
#, object-pascal-format
|
|
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
|
msgstr "Es gibt schon eine Unit mit dem Namen \"%s\" im Projekt.%sBitte wählen Sie einen anderen Namen."
|
|
|
|
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
|
#, object-pascal-format
|
|
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
|
msgstr "Es gibt keine fpc.exe im Verzeichnis von %s. Üblicherweise wird \"make\" zusammen mit dem FPC-Compiler installiert."
|
|
|
|
#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
|
|
#, object-pascal-format
|
|
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
|
msgid "There must be at least one build mode."
|
|
msgstr "Es muß wenigstens einen Erstellmodus geben."
|
|
|
|
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
|
#, object-pascal-format
|
|
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
|
msgstr "Die Ressourcenklasse \"%s\" ist von \"%s\" abgeleitet. Vielleicht ist das ein Schreibfehler anstelle von TForm?"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
|
#, object-pascal-format
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr "Beim Schreiben der gewählten Komponente %s trat ein Fehler auf:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
#, object-pascal-format
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr "Beim Konvertieren des binären Streams der gewählten Komponente %s trat ein Fehler auf:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
#, object-pascal-format
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr "Beim Kopieren des Komponentenstroms in die Zwischenablage trat ein Fehler auf:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
|
msgid "The root component cannot be deleted."
|
|
msgstr "Die Ursprungskomponente kann nicht gelöscht werden."
|
|
|
|
#: lazarusidestrconsts.listhesefileswillbedeleted
|
|
msgid "These files will be deleted"
|
|
msgstr "Diese Dateien werden gelöscht werden:"
|
|
|
|
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
|
msgid "These settings are stored with the project."
|
|
msgstr "Diese Einstellungen werden mit dem Projekt gespeichert."
|
|
|
|
#: lazarusidestrconsts.listheseunitswerenotfound
|
|
msgid "These units were not found:"
|
|
msgstr "Diese Units wurden gefunden:"
|
|
|
|
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
|
#, object-pascal-format
|
|
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
|
msgstr "Die Quelldateien des Free Pascal Packages werden benötigt für die Codevervollständigung und -durchsuchung. Zum Beispiel enthält es die Datei \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listhetargetdirectoryisafile
|
|
#, object-pascal-format
|
|
msgid "The target directory is a file:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetargetfilenameisadirectory
|
|
msgid "The target file name is a directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetargetisnotwritable
|
|
#, object-pascal-format
|
|
msgid "The target %s is not writable."
|
|
msgstr "Das Ziel %s ist nicht beschreibbar."
|
|
|
|
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
|
#, object-pascal-format
|
|
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
|
msgstr "Das Testverzeichnis kann nicht gefunden werden:%s\"%s\"%s(siehe IDE-Einstellungen)"
|
|
|
|
#: lazarusidestrconsts.listheunitalreadyexists
|
|
#, object-pascal-format
|
|
msgid "The unit \"%s\" already exists."
|
|
msgstr "Die Unit \"%s\" existiert bereits."
|
|
|
|
#: lazarusidestrconsts.listheunitbelongstopackage
|
|
#, object-pascal-format
|
|
msgid "The unit belongs to package %s."
|
|
msgstr "Die Unit gehört zum Package %s."
|
|
|
|
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
|
#, object-pascal-format
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr "Die Unit %s existiert doppelt im Unitpfad der %s:"
|
|
|
|
#: lazarusidestrconsts.listheunithasthisname
|
|
msgid "The unit has this name"
|
|
msgstr "Die Unit heißt"
|
|
|
|
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
|
#, object-pascal-format
|
|
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
|
msgstr "Der Unitdateiname \"%s\" ist nicht in Kleinbuchstaben.%sDer Free-Pascal-Compiler sucht nicht nach allen Schreibweisen. Es wird empfohlen, Dateinamen in Kleinbuchstaben zu verwenden.%sDatei in Kleinbuchstaben umbenennen?"
|
|
|
|
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
|
#, object-pascal-format
|
|
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
|
#, object-pascal-format
|
|
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
|
msgstr "Die Unit %s wird von anderen Dateien benötigt.%sVerweise automatisch anpassen?"
|
|
|
|
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
|
#, object-pascal-format
|
|
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Die Unit selbst hat schon den Namen \"%s\". Pascal-Bezeichner müssen eindeutig sein."
|
|
|
|
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
#, object-pascal-format
|
|
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
|
msgstr "Der Unitsuchpfad von \"%s\" enthält das Quellverzeichnis \"%s\" des Packages %s."
|
|
|
|
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
#, object-pascal-format
|
|
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr "Das Arbeitsverzeichnis \"%s\" fehlt.%sBitte prüfen Sie das Arbeitsverzeichnis im Menü Start > Startparameter."
|
|
|
|
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
|
#, object-pascal-format
|
|
msgid "This component already contains a class with the name %s."
|
|
msgstr "Diese Komponente enthält bereits eine Klasse mit dem Namen %s."
|
|
|
|
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
|
msgid "This function needs an open .lfm file in the source editor."
|
|
msgstr "Diese Funktion benötigt eine geöffnete .lfm Datei im Quelltexteditor."
|
|
|
|
#: lazarusidestrconsts.listhishelpmessage
|
|
msgid "This help message."
|
|
msgstr "Diese Hilfeanzeige"
|
|
|
|
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
|
msgid "This is a test project for a design time package, testing it outside the IDE."
|
|
msgstr "Dies ist ein Testprojekt für ein Entwicklungszeit-Package. Testen sie es außerhalb der IDE."
|
|
|
|
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
#, object-pascal-format
|
|
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr "Das sieht wie eine Pascal-Datei aus.%sEs wird empfohlen, Dateinamen in Kleinbuchstaben anzugeben, um diverse Probleme auf einigen Dateisystemen und mit verschiedenen Compilern aus dem Weg zu gehen.%sIn Kleinbuchstaben umbenennen?"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
|
msgid "This project has no main source file"
|
|
msgstr "Das Projekt hat keine Haupt-Quelldatei"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
|
msgid "This project has only the default build mode."
|
|
msgstr "Dieses Projekt besitzt nur den Vorgabe-Erstellmodus."
|
|
|
|
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
|
#, object-pascal-format
|
|
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
|
msgstr "Diese Zusammenstellung von Optionen für das Kompilieren von Lazarus wird von dieser Installation nicht unterstützt.%sDas Verzeichnis \"%s\" ist nicht beschreibbar.%sSuchen Sie auf der Lazarus-Webseite nach anderen Möglichkeiten, Lazarus zu installieren."
|
|
|
|
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
|
#, object-pascal-format
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr "Diese Anweisung kann nicht extrahiert werden.%sBitte wählen Sie etwas Code, um eine neue Prozedur/Methode zu extrahieren."
|
|
|
|
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
|
msgid "This will allow changing all build modes at once. Not implemented yet."
|
|
msgstr "Dies erlaubt die Änderung aller Erstellmodi auf einmal. Noch nicht implementiert."
|
|
|
|
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
|
msgid "This will create a circular dependency."
|
|
msgstr "Dies wird eine zirkuläre Abhängigkeit erzeugen."
|
|
|
|
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
|
#, object-pascal-format
|
|
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
|
msgstr "Dies wird eine Menge Text (%s) in die Zwischenablage einfügen.%sFortfahren?"
|
|
|
|
#: lazarusidestrconsts.listitle
|
|
msgid "&Title"
|
|
msgstr "&Titel"
|
|
|
|
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
|
#, fuzzy
|
|
#| msgid "Title in taskbar shows for example: project1 - Lazarus"
|
|
msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus."
|
|
msgstr "Der Titel in der Taskbar zeigt z.B.: project1.lpi - Lazarus"
|
|
|
|
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr "Titel (für Voreinstellung leerlassen)"
|
|
|
|
#: lazarusidestrconsts.listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Pfad:"
|
|
|
|
#: lazarusidestrconsts.listoolbarconfiguration
|
|
msgid "Toolbar Configuration"
|
|
msgstr "Symbolleisten-Konfiguration"
|
|
|
|
#: lazarusidestrconsts.listoolhasnoexecutable
|
|
#, object-pascal-format
|
|
msgid "tool \"%s\" has no executable"
|
|
msgstr "Werkzeug \"%s\" hat keine ausführbare Datei"
|
|
|
|
#: lazarusidestrconsts.listoolheaderfailed
|
|
msgid "Tool Header: Failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderrunning
|
|
msgid "Tool Header: Running"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderscrolledup
|
|
msgid "Tool Header: Scrolled up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheadersuccess
|
|
msgid "Tool Header: Success"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
|
#, object-pascal-format
|
|
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
|
|
#, object-pascal-format
|
|
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listop
|
|
msgctxt "lazarusidestrconsts.listop"
|
|
msgid "Top"
|
|
msgstr "Oben"
|
|
|
|
#: lazarusidestrconsts.listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Oben verankert"
|
|
|
|
#: lazarusidestrconsts.listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr "Oberer Randabstand. Der Wert wird zum Grund-Randabstand addiert und für den Platz über dem Element verwendet."
|
|
|
|
#: lazarusidestrconsts.listopinfoview
|
|
msgid "Show Class/Procedure hint"
|
|
msgstr "Klassen/Prozeduren-Hinweis anzeigen"
|
|
|
|
#: lazarusidestrconsts.listops
|
|
msgid "Tops"
|
|
msgstr "Obere Kanten"
|
|
|
|
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Das ist das Geschwistercontrol, an das die Oberseite verankert wurde. Für den Parent leerlassen."
|
|
|
|
#: lazarusidestrconsts.listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr "Gleichmäßiger oberer Rand"
|
|
|
|
#: lazarusidestrconsts.listotalpages
|
|
#, object-pascal-format
|
|
msgid "Total Pages: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listranslatetheenglishmessages
|
|
msgid "Translate the English Messages"
|
|
msgstr "Englische Nachrichten übersetzen"
|
|
|
|
#: lazarusidestrconsts.listreeneedsrefresh
|
|
msgid "Tree needs refresh"
|
|
msgstr "Baum muß aktualisiert werden"
|
|
|
|
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
|
#, object-pascal-format
|
|
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
|
msgstr "Zwei verschobene Dateien werden den selben Dateinamen haben:%s%s%s%s%sin %s"
|
|
|
|
#: lazarusidestrconsts.listypes
|
|
msgid "Types (not removed if no replacement)"
|
|
msgstr "Typen (nicht entfernt wenn kein Ersatz)"
|
|
|
|
#: lazarusidestrconsts.lisudadditionaldirectories
|
|
msgid "Additional directories:"
|
|
msgstr "Zusätzliche Verzeichnisse:"
|
|
|
|
#: lazarusidestrconsts.lisudallpackageunits
|
|
msgid "All package units"
|
|
msgstr "Alle Package-Units"
|
|
|
|
#: lazarusidestrconsts.lisudallsourceeditorunits
|
|
msgid "All source editor units"
|
|
msgstr "Alle Quelltexteditor-Units"
|
|
|
|
#: lazarusidestrconsts.lisudallunits
|
|
msgid "All units"
|
|
msgstr "Alle Units"
|
|
|
|
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
|
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudcollapseallnodes
|
|
msgid "Collapse all nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudexpandallnodes
|
|
msgid "Expand all nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudfile
|
|
#, object-pascal-format
|
|
msgid "File: %s"
|
|
msgstr "Datei: %s"
|
|
|
|
#: lazarusidestrconsts.lisudfilter
|
|
msgid "(Filter)"
|
|
msgstr "(Filter)"
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses
|
|
#, object-pascal-format
|
|
msgid "Implementation Uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses2
|
|
#, object-pascal-format
|
|
msgid "implementation uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses
|
|
#, object-pascal-format
|
|
msgid "Interface Uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses2
|
|
#, object-pascal-format
|
|
msgid "interface uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudprojectsandpackages
|
|
msgid "Projects and packages"
|
|
msgstr "Projekte und Packages"
|
|
|
|
#: lazarusidestrconsts.lisudscanning
|
|
msgid "Scanning ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudscanningunits
|
|
#, object-pascal-format
|
|
msgid "Scanning: %s units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearch
|
|
msgid "(Search)"
|
|
msgstr "(Suchen)"
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
|
msgid "Find next occurrence of this phrase"
|
|
msgstr "Finde nächstes Vorkommen dieser Phrase"
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
|
msgid "Find next unit with this phrase"
|
|
msgstr "Finde nächste Unit mit dieser Phrase"
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
|
msgid "Find previous occurrence of this phrase"
|
|
msgstr "Finde vorheriges Vorkommen dieser Phrase"
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
|
msgid "Find previous unit with this phrase"
|
|
msgstr "Finde vorherige Unit mit dieser Phrase"
|
|
|
|
#: lazarusidestrconsts.lisudselectedunits
|
|
msgid "Selected units"
|
|
msgstr "Ausgewählte Units"
|
|
|
|
#: lazarusidestrconsts.lisudshownodesfordirectories
|
|
msgid "Show nodes for directories"
|
|
msgstr "Zeige Knoten für Verzeichnisse"
|
|
|
|
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
|
msgid "Show nodes for project and packages"
|
|
msgstr "Zeige Knoten für Projekt und Packages"
|
|
|
|
#: lazarusidestrconsts.lisudunits
|
|
msgid "Units"
|
|
msgstr "Units"
|
|
|
|
#: lazarusidestrconsts.lisudunits2
|
|
#, object-pascal-format
|
|
msgid "Units: %s"
|
|
msgstr "Units: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations
|
|
#, object-pascal-format
|
|
msgid "Used by Implementations: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations2
|
|
#, object-pascal-format
|
|
msgid "used by implementations: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces
|
|
#, object-pascal-format
|
|
msgid "Used by Interfaces: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
|
#, object-pascal-format
|
|
msgid "used by interfaces: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Diese Meldung nicht erneut anzeigen"
|
|
|
|
#: lazarusidestrconsts.lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Fehler im regulären Ausdruck"
|
|
|
|
#: lazarusidestrconsts.lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Schriftart ohne UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisuegotoline
|
|
msgid "Goto line:"
|
|
msgstr "Springe zu Zeile:"
|
|
|
|
#: lazarusidestrconsts.lisuemodeseparator
|
|
msgid "/"
|
|
msgstr "/"
|
|
|
|
#: lazarusidestrconsts.lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
|
#, object-pascal-format
|
|
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
|
msgstr "Dieses Vorkommen von \"%s\"%s mit \"%s\" ersetzen?"
|
|
|
|
#: lazarusidestrconsts.lisuesearching
|
|
#, object-pascal-format
|
|
msgid "Searching: %s"
|
|
msgstr "Suche: %s"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
|
msgid "Continue search from the beginning?"
|
|
msgstr "Suche am Beginn fortsetzen?"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
|
msgid "Continue search from the end?"
|
|
msgstr "Suche am Ende fortsetzen?"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringnotfound
|
|
#, object-pascal-format
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Suchbegriff »%s« nicht gefunden!"
|
|
|
|
#: lazarusidestrconsts.lisuethecurre
|
|
#, object-pascal-format
|
|
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
|
msgstr "Die aktuelle Editorschriftart unterstützt UTF-8 nicht, aber das System scheint das zu tun.%sDas bedeutet, daß Nicht-ASCII-Zeichen möglicherweise falsch angezeigt werden.%sSie sollten in den Editoreinstellungen eine andere Schriftart einstellen."
|
|
|
|
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr "Include-Cache löschen"
|
|
|
|
#: lazarusidestrconsts.lisuidbytes
|
|
#, object-pascal-format
|
|
msgid "%s bytes"
|
|
msgstr "%s Byte"
|
|
|
|
#: lazarusidestrconsts.lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Eingebunden von:"
|
|
|
|
#: lazarusidestrconsts.lisuidinproject
|
|
msgid "In project:"
|
|
msgstr "im Projekt:"
|
|
|
|
#: lazarusidestrconsts.lisuidlines
|
|
msgctxt "lazarusidestrconsts.lisuidlines"
|
|
msgid "Lines:"
|
|
msgstr "Zeilen:"
|
|
|
|
#: lazarusidestrconsts.lisuidname
|
|
msgctxt "lazarusidestrconsts.lisuidname"
|
|
msgid "Name:"
|
|
msgstr "Name:"
|
|
|
|
#: lazarusidestrconsts.lisuidno
|
|
msgid "no"
|
|
msgstr "Nein"
|
|
|
|
#: lazarusidestrconsts.lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Größe:"
|
|
|
|
#: lazarusidestrconsts.lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Typ:"
|
|
|
|
#: lazarusidestrconsts.lisuidyes
|
|
msgid "yes"
|
|
msgstr "Ja"
|
|
|
|
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Anzeige der CodeTools-Werte"
|
|
|
|
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr "Kann binären Datenstrom nicht in Text umwandeln"
|
|
|
|
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr "Kann Komponente nicht in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
|
#, object-pascal-format
|
|
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Kann den den Ressourcen-Header-Kommentar nicht zu der Ressourcendatei %s\"%s\" hinzufügen.%sMöglicherweise ein Syntaxfehler."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
#, object-pascal-format
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Kann die Ressource T%s:FORMDATA nicht zur Ressourcendatei %s\"%s\"hinzufügen.%sMöglicherweise ein Syntaxfehler."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
|
#, object-pascal-format
|
|
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
|
|
msgstr "Kann Abhängigkeit %s nicht hinzufügen, weil das Package %s bereits eine Abhängigkeit %s besitzt"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
|
#, object-pascal-format
|
|
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
#, object-pascal-format
|
|
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
|
|
msgstr "Kann %s nicht zum Projekt hinzufügen. Das Projekt enthält bereits eine Unit mit dem gleichen Namen."
|
|
|
|
#: lazarusidestrconsts.lisunabletobackupfileto
|
|
#, object-pascal-format
|
|
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
|
msgstr "Kann Datei \"%s\" nicht nach \"%s\" speichern!"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeclassofto
|
|
#, object-pascal-format
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr "%s%sKann die Klasse %s nicht nach %s ändern"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
|
|
#, object-pascal-format
|
|
msgid "Unable to change project scaled in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
|
#, object-pascal-format
|
|
msgid "Unable to change project title in source.%s%s"
|
|
msgstr "Kann den Projekttitel nicht im Quelltext ändern.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Kann Zielverzeichnis nicht aufräumen"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
|
#, object-pascal-format
|
|
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
|
msgstr "Kann \"%s\" nicht aufräumen.%sÜberprüfen Sie die Dateirechte."
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
|
#, object-pascal-format
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr "Kann Komponententext nicht ins Binärformat umwandeln:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to convert file \"%s\"%sError: %s"
|
|
msgstr "Kann Datei \"%s\"nicht konvertieren%sFehler: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
|
#, object-pascal-format
|
|
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
|
msgstr "Kann die Textformulardaten der Datei %s\"%s\"%snicht in einen Binärstream umwandeln. (%s)"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
|
#, object-pascal-format
|
|
msgid "Unable to convert to encoding \"%s\""
|
|
msgstr "Kann nicht zur Kodierung \"%s\" konvertieren"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
|
msgid "Unable to create new file because there is already a directory with this name."
|
|
msgstr "Kann neue Datei nicht erstellen, da es bereits ein Verzeichnis mit diesem Namen gibt."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr "Temporärer lfm-Puffer kann nicht erzeugt werden."
|
|
|
|
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
|
#, object-pascal-format
|
|
msgid "Unable to delete ambiguous file \"%s\""
|
|
msgstr "Kann die unklare Datei \"%s\" nicht löschen"
|
|
|
|
#: lazarusidestrconsts.lisunabletoexecute
|
|
#, object-pascal-format
|
|
msgid "unable to execute: %s"
|
|
msgstr "kann %s nicht ausführen"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr "Kann in dieser oder den anderen benutzten Units keinen ResourceString-Abschnitt finden"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
|
#, object-pascal-format
|
|
msgid "Unable to find a valid classname in \"%s\""
|
|
msgstr "In \"%s\" ist kein gültiger Klassenname enthalten."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfile
|
|
#, object-pascal-format
|
|
msgid "Unable to find file \"%s\"."
|
|
msgstr "Datei \"%s\" kann nicht gefunden werden."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
#, object-pascal-format
|
|
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
|
msgstr "Kann die Datei \"%s\" nicht finden.%sFalls sie zum Projekt gehört, prüfen Sie den Suchpfad in der Startseite von%sProjekt->Compilereinstellungen ... unter Andere Unit-Dateien. Wenn die Datei zu einem Package gehört, müssen dessen Einstellungen geprüft werden. Falls die Datei zu Lazarus gehört, muß sichergestellt sein, daß die IDE sauber kompiliert ist. Gehört die Datei zu FPC muß die fpc.cfg überprüft werden. Bei Unklarheiten hilft der Button Test unter Projekt -> Compilereinstellungen ... -> Test"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
|
#, object-pascal-format
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr "Kann %s nicht im lfm-Stream finden."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindmethod
|
|
msgid "Unable to find method."
|
|
msgstr "Kann Methode nicht finden"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
|
#, object-pascal-format
|
|
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
|
msgstr "Kann keine Pascal-Unit (.pas,.pp) finden für .lfm-Datei%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
|
#, object-pascal-format
|
|
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
|
msgstr "Kann die Komponentenklasse \"%s\" nicht finden.%sSie ist nicht mittels RegisterClass registriert und keine lfm wurde gefunden.%sSie wird benötigt von Unit:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr "Kann Editoränderungen nicht sammeln."
|
|
|
|
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr "Quelltexte des Designers können nicht geholt werden."
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadfile2
|
|
#, object-pascal-format
|
|
msgid "unable to load file %s: %s"
|
|
msgstr "kann Datei %s: %s nicht laden"
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadpackage
|
|
#, object-pascal-format
|
|
msgid "Unable to load package \"%s\""
|
|
msgstr "Fehler beim Laden von Package \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
#, object-pascal-format
|
|
msgid "Unable to load the component class \"%s\" because it depends on itself."
|
|
msgstr "Kann die Komponentenklasse \"%s\" nicht laden. Sie hängt von sich selbst ab."
|
|
|
|
#: lazarusidestrconsts.lisunabletoopen
|
|
#, object-pascal-format
|
|
msgid "Unable to open \"%s\""
|
|
msgstr "Kann \"%s\" nicht öffnen"
|
|
|
|
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr "Kann Vorfahrkomponente nicht öffnen"
|
|
|
|
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
#, object-pascal-format
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr "Designer kann nicht geöffnet werden.%sDie Klasse %s stammt nicht von einer designfähigen Klasse wie TForm oder TDataModule ab."
|
|
|
|
#: lazarusidestrconsts.lisunabletoread
|
|
#, object-pascal-format
|
|
msgid "Unable to read %s"
|
|
msgstr "Kann %s nicht lesen"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
|
msgid "unable to read process ExitStatus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
|
#, object-pascal-format
|
|
msgid "Unable to remove old backup file \"%s\"!"
|
|
msgstr "Die alte Sicherungsdatei \"%s\" kann nicht gelöscht werden!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
|
|
#, object-pascal-format
|
|
msgid "Unable to remove project scaled from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
|
#, object-pascal-format
|
|
msgid "Unable to remove project title from source.%s%s"
|
|
msgstr "Kann den Projekttitel nicht aus dem Quelltext entfernen.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
|
#, object-pascal-format
|
|
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
|
msgstr "Kann die unklare Datei \"%s\"%snicht nach \"%s\" umbenennen."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Kann Formular im Quelltext nicht umbenennen."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Die Methode kann nicht umbenannt werden. Beheben Sie bitte den im Meldungsfenster gezeigten Fehler."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Die Variable im Quelltext kann nicht umbenannt werden."
|
|
|
|
#: lazarusidestrconsts.lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr "Kann nicht starten"
|
|
|
|
#: lazarusidestrconsts.lisunabletorun2
|
|
#, object-pascal-format
|
|
msgid "Unable to run \"%s\""
|
|
msgstr "Kann \"%s\" nicht starten"
|
|
|
|
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr "Kann Ankerseiten-Kontrollelement nicht setzen"
|
|
|
|
#: lazarusidestrconsts.lisunabletoshowmethod
|
|
msgid "Unable to show method."
|
|
msgstr "Kann Methode nicht zeigen"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr "Kann die gewählten Komponenten nicht streamen"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr "Die ausgewählten Komponenten können nicht gestreamt werden."
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamt
|
|
#, object-pascal-format
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "Kann %s nicht streamen: T%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
|
#, object-pascal-format
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "Kann binären Komponentenstream von %s für T%s nicht in Text umwandeln."
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "Kann die CreateForm-Anweisung im Projektquelltext nicht aktualisieren"
|
|
|
|
#: lazarusidestrconsts.lisuncheckall
|
|
msgid "Uncheck All"
|
|
msgstr "Alle abwählen"
|
|
|
|
#: lazarusidestrconsts.lisundo
|
|
msgctxt "lazarusidestrconsts.lisundo"
|
|
msgid "Undo"
|
|
msgstr "Zurücknehmen"
|
|
|
|
#: lazarusidestrconsts.lisuninstall
|
|
#, object-pascal-format
|
|
msgid "Uninstall %s"
|
|
msgstr "Deinstalliere %s"
|
|
|
|
#: lazarusidestrconsts.lisuninstallfail
|
|
msgid "Uninstall failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallimpossible
|
|
msgid "Uninstall impossible"
|
|
msgstr "Deinstallation unmöglich"
|
|
|
|
#: lazarusidestrconsts.lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "Auswahl deinstallieren"
|
|
|
|
#: lazarusidestrconsts.lisuninstallthemtoo
|
|
msgid "Uninstall them too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunithaschangedsave
|
|
#, object-pascal-format
|
|
msgid "Unit \"%s\" has changed. Save?"
|
|
msgstr "Unit \"%s\" wurde geändert. Speichern?"
|
|
|
|
#: lazarusidestrconsts.lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Unit-Bezeichner ist vorhanden"
|
|
|
|
#: lazarusidestrconsts.lisunitinpackage
|
|
#, object-pascal-format
|
|
msgid "%s unit %s in package %s"
|
|
msgstr "%s Unit %s in Package %s"
|
|
|
|
#: lazarusidestrconsts.lisunitmustsavebeforeinherit
|
|
#, object-pascal-format
|
|
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Unit-Name ist bereits im Projekt vorhanden"
|
|
|
|
#: lazarusidestrconsts.lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr "Der Unit-Name beginnt mit ..."
|
|
|
|
#: lazarusidestrconsts.lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr "Der Unit-Name enthält ..."
|
|
|
|
#: lazarusidestrconsts.lisunitnotfound
|
|
#, object-pascal-format
|
|
msgid "unit %s not found"
|
|
msgstr "Unit %s nicht gefunden"
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
|
#, object-pascal-format
|
|
msgid "unit %s not found at new position \"%s\""
|
|
msgstr "Unit %s nicht an neuer Position \"%s\" gefunden"
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundinfile
|
|
#, object-pascal-format
|
|
msgid "A unit not found in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr "Unit-Ausgabeverzeichnis"
|
|
|
|
#: lazarusidestrconsts.lisunitpath
|
|
msgid "unit path"
|
|
msgstr "Unit-Pfad"
|
|
|
|
#: lazarusidestrconsts.lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Unit-Pfade"
|
|
|
|
#: lazarusidestrconsts.lisunitrequirespackage
|
|
#, object-pascal-format
|
|
msgid "unit %s requires package %s"
|
|
msgstr "Unit %s benötigt Package %s"
|
|
|
|
#: lazarusidestrconsts.lisunitsnotfoundinfile
|
|
#, object-pascal-format
|
|
msgid "Units not found in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusedunitsof
|
|
#, object-pascal-format
|
|
msgid "Unused units of %s"
|
|
msgstr "Ungenutzte Units von %s"
|
|
|
|
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
|
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
|
msgstr "Unüblicher Compiler-Dateiname. Üblicherweise startet er mit fpc, ppc oder ppcross."
|
|
|
|
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
|
|
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisup
|
|
msgctxt "lazarusidestrconsts.lisup"
|
|
msgid "Up"
|
|
msgstr "Hoch"
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationcreateform
|
|
msgid "Update Application.CreateForm statements in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationscaledstatement
|
|
msgid "Update Application.Scaled statement in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationtitlestatement
|
|
msgid "Update Application.Title statement in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateinfo
|
|
msgid "Update info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
|
msgid "Update other procedure signatures when only letter case has changed"
|
|
msgstr "Andere Prozedur-Signaturen aktualisieren bereits bei Änderung der Schreibweise"
|
|
|
|
#: lazarusidestrconsts.lisupdatereferences
|
|
msgid "Update references?"
|
|
msgstr "Verweise aktualisieren?"
|
|
|
|
#: lazarusidestrconsts.lisupgrade
|
|
msgid "Upgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgradeconfiguration
|
|
msgid "Upgrade configuration"
|
|
msgstr "Konfiguration aktualisieren"
|
|
|
|
#: lazarusidestrconsts.lisuppercasestring
|
|
msgid "uppercase string"
|
|
msgstr "Großbuchstabige Zeichenkette"
|
|
|
|
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
|
msgid "Uppercase string given as parameter."
|
|
msgstr "Großbuchstabige Zeichenkette als Parameter angegeben"
|
|
|
|
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
|
#, object-pascal-format
|
|
msgid "URL on wiki (the base url is %s)"
|
|
msgstr "URL im Wiki (die Basis-URL ist %s)"
|
|
|
|
#: lazarusidestrconsts.lisusagemessagehoption
|
|
msgid "Usage message (-h option)"
|
|
msgstr "Ausgabe für den Aufruf (Parameter -h)"
|
|
|
|
#: lazarusidestrconsts.lisuse
|
|
msgid "Use"
|
|
msgstr "Verwenden"
|
|
|
|
#: lazarusidestrconsts.lisuseansistrings
|
|
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Verwende Ansistrings"
|
|
|
|
#: lazarusidestrconsts.lisuseanyway
|
|
#, object-pascal-format
|
|
msgid "Use \"%s\" anyway"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
|
msgid "Use CheckBox for Boolean values"
|
|
msgstr "Verwende CheckBox für boolesche Werte"
|
|
|
|
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
|
msgid "Use comments in custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedby
|
|
#, object-pascal-format
|
|
msgid " used by %s"
|
|
msgstr " verwendet von %s"
|
|
|
|
#: lazarusidestrconsts.lisusedesigntimepackages
|
|
msgid "Use design time packages"
|
|
msgstr "Verwende Entwicklungszeit-Packages"
|
|
|
|
#: lazarusidestrconsts.lisusedforautocreatedforms
|
|
msgid "Used for auto-created forms."
|
|
msgstr "Verwendet für automatisch erzeugte Formulare"
|
|
|
|
#: lazarusidestrconsts.lisusefilterforextrafiles
|
|
msgid "Use filter to include extra files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseidentifier
|
|
msgid "Use identifier"
|
|
msgstr "Bezeichner verwenden"
|
|
|
|
#: lazarusidestrconsts.lisuseidentifierinat
|
|
#, object-pascal-format
|
|
msgid "Use identifier %s in %s at %s"
|
|
msgstr "Bezeichner %s in %s bei %s verwenden"
|
|
|
|
#: lazarusidestrconsts.lisuseinstead
|
|
#, object-pascal-format
|
|
msgid "Use \"%s\" instead"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr "Startprogramm"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage
|
|
#, object-pascal-format
|
|
msgid "Use package %s in package %s"
|
|
msgstr "Verwende Package %s in Package %s"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage2
|
|
msgid "Use package in package"
|
|
msgstr "Verwende Package in Package"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject
|
|
#, object-pascal-format
|
|
msgid "Use package %s in project"
|
|
msgstr "Verwende Package %s in Projekt"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject2
|
|
msgid "Use package in project"
|
|
msgstr "Verwende Package in Projekt"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
|
#, object-pascal-format
|
|
msgid "Add to list \"%s\""
|
|
msgstr "Zur Liste \"%s\" hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
|
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
|
msgid "User defined text markup"
|
|
msgstr "Benutzerdefinierte Texthervorhebung"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
|
#, object-pascal-format
|
|
msgid "Remove from list \"%s\""
|
|
msgstr "Von Liste \"%s\" entfernen"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
|
#, object-pascal-format
|
|
msgid "Toggle on list \"%s\""
|
|
msgstr "Liste \"%s\" umschalten"
|
|
|
|
#: lazarusidestrconsts.lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr "Heimatverzeichnis des Users"
|
|
|
|
#: lazarusidestrconsts.lisuseunit
|
|
msgctxt "lazarusidestrconsts.lisuseunit"
|
|
msgid "Add Unit to Uses Section"
|
|
msgstr "Unit zum uses Abschnitt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.lisuseunitinunit
|
|
#, object-pascal-format
|
|
msgid "Use unit %s in unit %s"
|
|
msgstr "Verwende Unit %s in Unit %s"
|
|
|
|
#: lazarusidestrconsts.lisutf8withbom
|
|
msgid "UTF-8 with BOM"
|
|
msgstr "UTF-8 mit BOM"
|
|
|
|
#: lazarusidestrconsts.lisvalue
|
|
msgctxt "lazarusidestrconsts.lisvalue"
|
|
msgid "Value"
|
|
msgstr "Wert:"
|
|
|
|
#: lazarusidestrconsts.lisvalue2
|
|
#, object-pascal-format
|
|
msgid "Value%s"
|
|
msgstr "Wert%s"
|
|
|
|
#: lazarusidestrconsts.lisvalue3
|
|
msgid "Value: "
|
|
msgstr "Wert: "
|
|
|
|
#: lazarusidestrconsts.lisvalues
|
|
msgid "Values"
|
|
msgstr "Werte"
|
|
|
|
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
|
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvariable
|
|
msgctxt "lazarusidestrconsts.lisvariable"
|
|
msgid "Variable"
|
|
msgstr "Variable"
|
|
|
|
#: lazarusidestrconsts.lisverbose
|
|
msgctxt "lazarusidestrconsts.lisverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr "Methodenaufrufe prüfen"
|
|
|
|
#: lazarusidestrconsts.lisversion
|
|
msgid "Version"
|
|
msgstr "Version"
|
|
|
|
#: lazarusidestrconsts.lisversionmismatch
|
|
msgid "Version mismatch"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvertical
|
|
msgid "Vertical"
|
|
msgstr "Senkrecht"
|
|
|
|
#: lazarusidestrconsts.lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr "Versionsinformationen in die Zwischenablage kopieren"
|
|
|
|
#: lazarusidestrconsts.lisveryverbose
|
|
msgid "Very Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Quelltext (.lfm) anzeigen"
|
|
|
|
#: lazarusidestrconsts.liswarning
|
|
msgid "Warning: "
|
|
msgstr "Warnung: "
|
|
|
|
#: lazarusidestrconsts.liswarnings
|
|
#, object-pascal-format
|
|
msgid ", Warnings: %s"
|
|
msgstr ", Warnungen: %s"
|
|
|
|
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
|
#, object-pascal-format
|
|
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
|
msgstr "%sWarnung: Dies ist die Hauptunit. Die neue Hauptunit wird %s.pas."
|
|
|
|
#: lazarusidestrconsts.liswelcometolazaruside
|
|
#, object-pascal-format
|
|
msgid "Welcome to Lazarus IDE %s"
|
|
msgstr "Willkommen zur Lazarus IDE %s"
|
|
|
|
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
|
#, object-pascal-format
|
|
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
|
msgstr "Willkommen zu Lazarus %s%sEs gibt bereits eine Konfiguration von Version %s in%s%s"
|
|
|
|
#: lazarusidestrconsts.liswhatneedsbuilding
|
|
msgid "What needs building"
|
|
msgstr "Noch zu erstellen"
|
|
|
|
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
|
msgid "When a unit is renamed, update references"
|
|
msgstr "Wenn eine Unit umbenannt wird, Referenzen aktualisieren ..."
|
|
|
|
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
|
msgid "When enabled the current options are saved to the template which is used when creating new projects"
|
|
msgstr "Wenn eingeschaltet, werden die derzeit gewählten Optionen in ein Template für das Anlegen neuer Projekte gespeichert"
|
|
|
|
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
|
|
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
|
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
|
msgstr "Wenn der Quelltexteditor den Cursor bewegt, zeige den aktuellen Knoten im Code-Explorer an"
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
|
msgid "Window menu shows designed form's name instead of caption"
|
|
msgstr "Fenstermenü zeigt Formularnamen anstatt Caption-Eigenschaft"
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
|
msgid "Useful especially if the caption is left empty."
|
|
msgstr "besonders hilfreich wenn die Caption-Eigenschaft leer gelassen wurde"
|
|
|
|
#: lazarusidestrconsts.liswindowstaysontop
|
|
msgid "Window stays on top"
|
|
msgstr "Fenster immer oben"
|
|
|
|
#: lazarusidestrconsts.liswithincludes2
|
|
msgid ", with includes "
|
|
msgstr ", mit Includes "
|
|
|
|
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
|
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
|
msgstr "Ohne funktionierenden Compiler wird das Durchsuchen und Kompilieren des Codes ziemlich enttäuschend sein."
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
|
msgid "Without a proper debugger, debugging will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
|
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
|
msgstr "Ohne ein passendes Lazarus-Verzeichnis werden Sie eine Menge Warnungen erhalten."
|
|
|
|
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
|
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
|
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
|
msgstr "Ohne richtige FPC-Quelltexte sind die Ansicht und Codevervollständigung recht eingeschränkt."
|
|
|
|
#: lazarusidestrconsts.liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "Mit benötigten Packages"
|
|
|
|
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Wort an der aktuellen Cursorposition im Editor"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr "Arbeitsverzeichnis für das Kompilieren"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr "Arbeitsverzeichnis für den Start"
|
|
|
|
#: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters
|
|
msgid "Write config instead of command line parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswritepackageinfofailed
|
|
msgid "Writing the package info file failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswriteprojectinfofailed
|
|
msgid "Writing the project info file failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswritewhatpackagefilesares
|
|
msgid "Write what package files are searched and found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswrongversionin
|
|
#, object-pascal-format
|
|
msgid "wrong version in %s: %s"
|
|
msgstr "falsche Version in %s: %s"
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
|
msgid "You can disable this for individual forms via the package editor"
|
|
msgstr "Sie können das für individuelle Formulare deaktivieren über den Package-Editor."
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
|
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
|
msgstr "Sie können dies deaktivieren für individuelle Formulare über das Kontextmenü im Projektinspektor."
|
|
|
|
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
|
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
|
msgstr "Sie können FPC und die FPC-Quellen herunterladen von http://sourceforge.net/projects/lazarus/?source=directory"
|
|
|
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
msgid "You cannot build Lazarus while debugging or compiling."
|
|
msgstr "Lazarus kann während des Debuggens oder Kompilierens nicht neu kompiliert werden."
|
|
|
|
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
|
|
msgid "You cannot change the build mode while compiling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
|
|
msgid "You can select items by simply pressing underscored letters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis_all_
|
|
msgctxt "lazarusidestrconsts.lis_all_"
|
|
msgid "<All>"
|
|
msgstr "<Alle>"
|
|
|
|
#: lazarusidestrconsts.locwndsrceditor
|
|
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
|
msgid "Source Editor"
|
|
msgstr "Quelltexteditor"
|
|
|
|
#: lazarusidestrconsts.lrsplddeleteselected
|
|
msgid "Delete selected"
|
|
msgstr "Ausgewählte löschen"
|
|
|
|
#: lazarusidestrconsts.lrspldinvalid
|
|
msgid "invalid"
|
|
msgstr "ungültig"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
|
#, object-pascal-format
|
|
msgid "lpk file invalid (%s)"
|
|
msgstr "ungültige lpk-Datei (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfilevalid
|
|
#, object-pascal-format
|
|
msgid "lpk file valid (%s)"
|
|
msgstr "gültige lpk-Datei (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldunabletodeletefile
|
|
#, object-pascal-format
|
|
msgid "Unable to delete file \"%s\""
|
|
msgstr "Kann Datei \"%s\" nicht löschen"
|
|
|
|
#: lazarusidestrconsts.lrspldvalid
|
|
msgid "valid"
|
|
msgstr "gültig"
|
|
|
|
#: lazarusidestrconsts.lrsrescanlplfiles
|
|
msgid "Rescan lpl files"
|
|
msgstr "lpl-Dateien erneut scannen"
|
|
|
|
#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
|
|
msgid "Add horizontal spacing between columns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphaddverticalspacingar
|
|
msgid "Add vertical spacing around nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphextraspacing
|
|
msgid "Extra spacing (x/y)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphnamesabovenode
|
|
msgid "Names above node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptabsolutelimi
|
|
msgid "Absolute limit for height of levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptcrossings
|
|
msgid "Crossings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptedgelen
|
|
msgid "Edge len"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptedges
|
|
msgid "Edges"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptinfo
|
|
msgid "Info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlevels
|
|
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
|
|
msgid "Levels"
|
|
msgstr "Stufen"
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
|
|
msgid "Limit height of Levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlimitrelativ
|
|
#, object-pascal-format
|
|
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptsplitpoints
|
|
msgid "Splitpoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphreducebackedges
|
|
msgid "Reduce backedges"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapecalculatelay
|
|
msgid "Calculate layout from high-edge"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapecurved
|
|
msgid "Curved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeedgesshape
|
|
msgid "Edges shape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
|
|
msgid "Edges split mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeminimizeedge
|
|
msgid "Minimize edges len"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapenodes
|
|
msgid "Nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapestraight
|
|
msgid "Straight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeathighe
|
|
msgid "Merge at highest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
|
|
msgid "Merge at source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeattarge
|
|
msgid "Merge at target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitnone
|
|
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
|
|
msgid "None"
|
|
msgstr "Keine"
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitseparate
|
|
msgid "Separate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphstraightengraph
|
|
msgid "Straighten graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterchanges
|
|
msgid "Changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterfolding
|
|
msgid "Folding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispguttermarks
|
|
msgid "Marks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutternocurrentlinecolor
|
|
msgid "No current line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterseparator
|
|
msgid "Separator"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterusecurrentlinecolor
|
|
msgid "Use current line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor
|
|
msgid "Use current line number color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr "Package-Unit zum Uses-Abschnitt zufügen"
|
|
|
|
#: lazarusidestrconsts.rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr "Umgekehrt zufügen"
|
|
|
|
#: lazarusidestrconsts.rsaddnewterm
|
|
msgid "Add new term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsattributes
|
|
msgid "Attributes"
|
|
msgstr "Attribute"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr "Kompiliernummer automatisch erhöhen"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
|
msgid "Increased every time the project is compiled."
|
|
msgstr "Wird bei jeder Kompilierung des Projekts erhöht"
|
|
|
|
#: lazarusidestrconsts.rsbuild
|
|
msgid "&Build:"
|
|
msgstr "Neu kompilieren:"
|
|
|
|
#: lazarusidestrconsts.rscharacterset
|
|
msgid "Character set:"
|
|
msgstr "Zeichensatz:"
|
|
|
|
#: lazarusidestrconsts.rscloseall
|
|
msgid "Close all pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsclosecurrentpage
|
|
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
|
|
msgstr "Aktuelle Seite schließen (Ctrl+F4)∥(Ctrl+W)"
|
|
|
|
#: lazarusidestrconsts.rscloseleft
|
|
msgid "Close page(s) on the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscloseothers
|
|
msgid "Close other page(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscloseright
|
|
msgid "Close page(s) on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr "Compilerschalter"
|
|
|
|
#: lazarusidestrconsts.rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr "Erzeugt neuen Schalter"
|
|
|
|
#: lazarusidestrconsts.rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr "i18n einschalten"
|
|
|
|
#: lazarusidestrconsts.rsfilterthelistwithstring
|
|
msgid "Filter the lines in list with a string (Ctrl+F)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
|
msgid "Found but not listed here: "
|
|
msgstr "Gefunden aber hier nicht aufgeführt: "
|
|
|
|
#: lazarusidestrconsts.rsi18nexcluded
|
|
msgid "Excluded"
|
|
msgstr "Ausgenommen"
|
|
|
|
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
|
|
msgid "Force update PO files on next build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nidentifiers
|
|
msgid "Identifiers:"
|
|
msgstr "Bezeichner:"
|
|
|
|
#: lazarusidestrconsts.rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr "i18n-Einstellungen"
|
|
|
|
#: lazarusidestrconsts.rsi18noriginals
|
|
msgid "Originals:"
|
|
msgstr "Originale:"
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfohint
|
|
msgid "Version info is stored if the executable format supports it."
|
|
msgstr "Versionsinformation wird gespeichert, wenn das Format der ausführbaren Datei es unterstützt."
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
|
msgid "Include version info in executable"
|
|
msgstr "Versionsinfo in ausführbare Datei einfügen"
|
|
|
|
#: lazarusidestrconsts.rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr "Spracheinstellungen"
|
|
|
|
#: lazarusidestrconsts.rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr "Sprachauswahl:"
|
|
|
|
#: lazarusidestrconsts.rsmajorversion
|
|
msgid "&Major version:"
|
|
msgstr "Hauptversion:"
|
|
|
|
#: lazarusidestrconsts.rsminorversion
|
|
msgid "Mi&nor version:"
|
|
msgstr "U&nterversion:"
|
|
|
|
#: lazarusidestrconsts.rsnewsearchwithsamecriteria
|
|
msgid "New search with same criteria (Ctrl+N)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsotherinfo
|
|
msgid "Other info"
|
|
msgstr "Andere Info"
|
|
|
|
#: lazarusidestrconsts.rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr "PO-Ausgabeverzeichnis:"
|
|
|
|
#: lazarusidestrconsts.rsrefreshthesearch
|
|
msgid "Refresh the search (F5)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresource
|
|
msgid "Resource"
|
|
msgstr "Ressource"
|
|
|
|
#: lazarusidestrconsts.rsresourceclear
|
|
msgid "Delete all resources?"
|
|
msgstr "Alle Ressourcen löschen?"
|
|
|
|
#: lazarusidestrconsts.rsresourcefilename
|
|
msgctxt "lazarusidestrconsts.rsresourcefilename"
|
|
msgid "File name"
|
|
msgstr "Dateiname"
|
|
|
|
#: lazarusidestrconsts.rsresourcetype
|
|
msgctxt "lazarusidestrconsts.rsresourcetype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.rsrevision
|
|
msgid "&Revision:"
|
|
msgstr "&Revision:"
|
|
|
|
#: lazarusidestrconsts.rsselectaninheritedentry
|
|
msgid "Select an inherited entry"
|
|
msgstr "Abgeleiteten Eintrag auswählen"
|
|
|
|
#: lazarusidestrconsts.rsshowabspath
|
|
msgid "Absolute path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsshowfilename
|
|
msgctxt "lazarusidestrconsts.rsshowfilename"
|
|
msgid "File name"
|
|
msgstr "Dateiname"
|
|
|
|
#: lazarusidestrconsts.rsshowpathmode
|
|
msgid "Path display mode (Ctrl+P)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsshowrelpath
|
|
msgid "Relative path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr "Versionszählung"
|
|
|
|
#: lazarusidestrconsts.showoptions
|
|
msgid "Show options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Befehle aus dem Menü 'Hilfe'"
|
|
|
|
#: lazarusidestrconsts.srkmcatclipboard
|
|
msgid "Clipboard commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Kommandoanweisungen"
|
|
|
|
#: lazarusidestrconsts.srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "CodeTools-Befehle"
|
|
|
|
#: lazarusidestrconsts.srkmcatcolselection
|
|
msgid "Text column selection commands"
|
|
msgstr "Textspaltenauswahlbefehle"
|
|
|
|
#: lazarusidestrconsts.srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Befehle für die Cursorsteuerung"
|
|
|
|
#: lazarusidestrconsts.srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Texteditorbefehle"
|
|
|
|
#: lazarusidestrconsts.srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Befehle aus dem Menü 'Datei'"
|
|
|
|
#: lazarusidestrconsts.srkmcatfold
|
|
msgid "Text folding commands"
|
|
msgstr "Textfaltungs-Befehle"
|
|
|
|
#: lazarusidestrconsts.srkmcatlinewrap
|
|
msgid "Line wrapping"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatmacrorecording
|
|
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
|
msgid "Macros"
|
|
msgstr "Makros"
|
|
|
|
#: lazarusidestrconsts.srkmcatmarker
|
|
msgid "Text bookmark commands"
|
|
msgstr "Lesezeichen-Befehle"
|
|
|
|
#: lazarusidestrconsts.srkmcatmulticaret
|
|
msgid "Multi caret commands"
|
|
msgstr "Mehrfachcursor-Befehle"
|
|
|
|
#: lazarusidestrconsts.srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr "Befehle aus dem Menü 'Package'"
|
|
|
|
#: lazarusidestrconsts.srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Befehle aus dem Menü 'Projekt'"
|
|
|
|
#: lazarusidestrconsts.srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Befehle aus dem Menü 'Start'"
|
|
|
|
#: lazarusidestrconsts.srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Befehle für Textsuche und -änderung"
|
|
|
|
#: lazarusidestrconsts.srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Textauswahlbefehle"
|
|
|
|
#: lazarusidestrconsts.srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Editorbefehle"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroedit
|
|
msgid "Syncron Editing"
|
|
msgstr "Synchronbearbeitung"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
|
msgid "Syncron Editing (not in Cell)"
|
|
msgstr "Synchronbearbeitung (nicht in Zelle)"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
|
msgid "Syncron Editing (while selecting)"
|
|
msgstr "Synchronbearbeitung (bei der Auswahl)"
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateedit
|
|
msgid "Template Editing"
|
|
msgstr "Vorlagenbearbeitung"
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateeditoff
|
|
msgid "Template Editing (not in Cell)"
|
|
msgstr "Vorlagenbearbeitung (nicht in Zelle)"
|
|
|
|
#: lazarusidestrconsts.srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Befehle aus dem Menü 'Werkzeuge'"
|
|
|
|
#: lazarusidestrconsts.srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Befehle aus dem Menü 'Ansicht'"
|
|
|
|
#: lazarusidestrconsts.srkmcommand
|
|
msgctxt "lazarusidestrconsts.srkmcommand"
|
|
msgid "Command:"
|
|
msgstr "Befehl:"
|
|
|
|
#: lazarusidestrconsts.srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Konflikt "
|
|
|
|
#: lazarusidestrconsts.srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "Kompiliervorgang abbrechen"
|
|
|
|
#: lazarusidestrconsts.srkmecabstractmethods
|
|
msgid "Abstract Methods ..."
|
|
msgstr "Abstrakte Methoden ..."
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpaddress
|
|
msgid "add address breakpoint"
|
|
msgstr "Adress-Haltepunkt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpsource
|
|
msgid "add source breakpoint"
|
|
msgstr "Quell-Haltepunkt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
|
msgid "add data/watchpoint"
|
|
msgstr "Daten-/Überwachungspunkt hinzufügen"
|
|
|
|
#: lazarusidestrconsts.srkmecaddjumppoint
|
|
msgid "Add Jump Point"
|
|
msgstr "Neue Sprungmarke"
|
|
|
|
#: lazarusidestrconsts.srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "Neuer überwachter Ausdruck"
|
|
|
|
#: lazarusidestrconsts.srkmecattach
|
|
msgid "Attach to program"
|
|
msgstr "An Prozess anhängen"
|
|
|
|
#: lazarusidestrconsts.srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Quelltextvervollständigung per Vorlage"
|
|
|
|
#: lazarusidestrconsts.srkmecblockcopy
|
|
msgid "Copy Block"
|
|
msgstr "Block kopieren"
|
|
|
|
#: lazarusidestrconsts.srkmecblockdelete
|
|
msgid "Delete Block"
|
|
msgstr "Block löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotobegin
|
|
msgid "Goto Block begin"
|
|
msgstr "Zum Blockanfang"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotoend
|
|
msgid "Goto Block end"
|
|
msgstr "Zum Blockende"
|
|
|
|
#: lazarusidestrconsts.srkmecblockhide
|
|
msgid "Hide Block"
|
|
msgstr "Block verbergen"
|
|
|
|
#: lazarusidestrconsts.srkmecblockindent
|
|
msgid "Indent line/block"
|
|
msgstr "Block einrücken"
|
|
|
|
#: lazarusidestrconsts.srkmecblockindentmove
|
|
msgid "Indent line/block (move columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockmove
|
|
msgid "Move Block"
|
|
msgstr "Block verschieben"
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetbegin
|
|
msgid "Set block begin"
|
|
msgstr "Blockanfang festlegen"
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetend
|
|
msgid "Set block end"
|
|
msgstr "Blockende festlegen"
|
|
|
|
#: lazarusidestrconsts.srkmecblockshow
|
|
msgid "Show Block"
|
|
msgstr "Block zeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecblocktogglehide
|
|
msgid "Toggle block"
|
|
msgstr "Block umschalten"
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindent
|
|
msgid "Unindent line/block"
|
|
msgstr "Block ausrücken"
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindentmove
|
|
msgid "Unindent line/block (move columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecbreakpointproperties
|
|
msgid "show breakpoint properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "Programm/Projekt kompilieren"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "Datei kompilieren"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildlazarus
|
|
msgid "Build Lazarus"
|
|
msgstr "Lazarus neu kompilieren"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildmanymodes
|
|
msgid "build many modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecchar
|
|
msgid "Char"
|
|
msgstr "Zeichen"
|
|
|
|
#: lazarusidestrconsts.srkmeccleanupandbuild
|
|
msgid "clean up and build"
|
|
msgstr "aufräumen und kompilieren"
|
|
|
|
#: lazarusidestrconsts.srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Gesamten Text löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecclearallbookmark
|
|
msgid "Clear all Bookmarks"
|
|
msgstr "Alle Lesezeichen löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
|
msgid "Clear Bookmarks for current file"
|
|
msgstr "Lesezeichen für aktuelle Datei löschen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseldown
|
|
msgid "Column Select Down"
|
|
msgstr "Spalte nach unten wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
|
msgid "Column Select to absolute end"
|
|
msgstr "Spalte bis zum absoluten Ende wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditortop
|
|
msgid "Column Select to absolute beginning"
|
|
msgstr "Spalte bis zum absoluten Anfang wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselleft
|
|
msgid "Column Select Left"
|
|
msgstr "Spalte links wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellineend
|
|
msgid "Column Select Line End"
|
|
msgstr "Spalte bis zum Zeilenende wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinestart
|
|
msgid "Column Select Line Start"
|
|
msgstr "Spalte bis zum Zeilenbeginn wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
|
msgid "Column Select to text start in line"
|
|
msgstr "Spalte bis zum Textanfang auf der Zeile wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagebottom
|
|
msgid "Column Select Page Bottom"
|
|
msgstr "Spalte bis zum Seitenende wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagedown
|
|
msgid "Column Select Page Down"
|
|
msgstr "Spalte seitenweise nach unten wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagetop
|
|
msgid "Column Select Page Top"
|
|
msgstr "Spalte bis zum Seitenanfang wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpageup
|
|
msgid "Column Select Page Up"
|
|
msgstr "Spalte seitenweise nach oben wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselright
|
|
msgid "Column Select Right"
|
|
msgstr "Spalte rechts wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselup
|
|
msgid "Column Select Up"
|
|
msgstr "Spalte hoch wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordleft
|
|
msgid "Column Select Word Left"
|
|
msgstr "Spalte Wort links wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordright
|
|
msgid "Column Select Word Right"
|
|
msgstr "Spalte Wort rechts wählen"
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnblockmoveleft
|
|
msgid "Move column-block left (delete before columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnblockmoveright
|
|
msgid "Move column-block right (delete after columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnblockshiftleft
|
|
msgid "Shift column-block left (delete in columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnblockshiftright
|
|
msgid "Shift column-block right (delete in columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Spaltenauswahlmodus"
|
|
|
|
#: lazarusidestrconsts.srkmeccompile
|
|
msgid "compile program/project"
|
|
msgstr "Programm/Projekt kompilieren"
|
|
|
|
#: lazarusidestrconsts.srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "Konfiguriere Kompilierungsdatei"
|
|
|
|
#: lazarusidestrconsts.srkmeccopy
|
|
msgctxt "lazarusidestrconsts.srkmeccopy"
|
|
msgid "Copy"
|
|
msgstr "Kopieren"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyadd
|
|
msgid "Copy to clipboard (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyaddcurrentline
|
|
msgid "Copy current line to clipboard (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopycurrentline
|
|
msgid "Copy current line to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
|
msgid "Copy editor to new window"
|
|
msgstr "Editor in neues Fenster kopieren"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
|
msgid "Copy editor to next free window"
|
|
msgstr "Editor in nächstes freies Fenster kopieren"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
|
msgid "Copy editor to prior free window"
|
|
msgstr "Editor in vorheriges freies Fenster kopieren"
|
|
|
|
#: lazarusidestrconsts.srkmeccut
|
|
msgctxt "lazarusidestrconsts.srkmeccut"
|
|
msgid "Cut"
|
|
msgstr "Ausschneiden"
|
|
|
|
#: lazarusidestrconsts.srkmeccutadd
|
|
msgid "Cut to clipboard (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccutaddcurrentline
|
|
msgid "Cut current line to clipboard (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccutcurrentline
|
|
msgid "Cut current line to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Bis zum Zeilenanfang löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Zeichen unter Cursor löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Bis zum Zeilenende löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Letztes Zeichen löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Bis zum Wortanfang löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Lösche aktuelle Zeile"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelinekeepx
|
|
msgid "Delete current line (keep X pos)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Bis zum Wortende löschen"
|
|
|
|
#: lazarusidestrconsts.srkmecdetach
|
|
msgid "Detach from program"
|
|
msgstr "Vom Prozess abtrennen"
|
|
|
|
#: lazarusidestrconsts.srkmecdiff
|
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
|
msgid "Diff"
|
|
msgstr "Dateivergleich"
|
|
|
|
#: lazarusidestrconsts.srkmecdown
|
|
msgid "Move cursor down"
|
|
msgstr "Cursor nach unten"
|
|
|
|
#: lazarusidestrconsts.srkmecduplicateline
|
|
msgid "Duplicate line (or lines in selection)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecduplicateselection
|
|
msgid "Duplicate selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Cursor ans absolute Ende bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Cursor an den absoluten Anfang bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmecemptymethods
|
|
msgid "Empty Methods ..."
|
|
msgstr "Leere Methoden ..."
|
|
|
|
#: lazarusidestrconsts.srkmecenvironmentoptions
|
|
msgid "IDE options"
|
|
msgstr "Umgebungseinstellungen"
|
|
|
|
#: lazarusidestrconsts.srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr "auswerten/ändern"
|
|
|
|
#: lazarusidestrconsts.srkmecextractproc
|
|
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
|
msgid "Extract Procedure"
|
|
msgstr "Prozedur extrahieren"
|
|
|
|
#: lazarusidestrconsts.srkmecexttool
|
|
#, object-pascal-format
|
|
msgid "External tool %d"
|
|
msgstr "Externes Werkzeug %d"
|
|
|
|
#: lazarusidestrconsts.srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Einstellungen für externe Werkzeuge"
|
|
|
|
#: lazarusidestrconsts.srkmecfind
|
|
msgid "Find Text"
|
|
msgstr "Text suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Anderes Blockende suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Blockanfang suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfinddeclaration
|
|
msgid "Find Declaration"
|
|
msgstr "Deklaration suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
|
msgid "Find Identifier References"
|
|
msgstr "Bezeichnerreferenzen suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindinfiles
|
|
msgid "Find in Files"
|
|
msgstr "In Dateien suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnext
|
|
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
|
msgid "Find Next"
|
|
msgstr "Nächstes suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
|
msgid "Find Next Word Occurrence"
|
|
msgstr "Nächste Fundstelle des Worts"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloads
|
|
msgid "Find Overloads"
|
|
msgstr "Überladungen suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
|
msgid "Find Overloads ..."
|
|
msgstr "Suche Überladungen ..."
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevious
|
|
msgid "Find Previous"
|
|
msgstr "Vorheriges suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
|
msgid "Find Previous Word Occurrence"
|
|
msgstr "Vorhergehende Fundstelle des Worts"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
|
msgid "Find Procedure Definiton"
|
|
msgstr "Prozedurdefinition suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduremethod
|
|
msgid "Find Procedure Method"
|
|
msgstr "Prozedur-Methode suchen"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldcurrent
|
|
msgid "Fold at Cursor"
|
|
msgstr "Beim Cursor falten"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldlevel
|
|
#, object-pascal-format
|
|
msgid "Fold to Level %d"
|
|
msgstr "Falten auf Ebene %d"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldtoggle
|
|
msgid "Toggle Fold at Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotoeditor
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "Go to editor %d"
|
|
msgid "Go to source editor %d"
|
|
msgstr "Zu Editorfenster %d gehen"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoincludedirective
|
|
msgid "Go to include directive of current include file"
|
|
msgstr "Zur Include-Anweisung der aktuellen Include-Datei springen"
|
|
|
|
#: lazarusidestrconsts.srkmecgotolinenumber
|
|
msgid "Go to Line Number"
|
|
msgstr "Zu Zeile springen"
|
|
|
|
#: lazarusidestrconsts.srkmecgotomarker
|
|
#, object-pascal-format
|
|
msgid "Go to bookmark %d"
|
|
msgstr "Gehe zu Lesezeichen %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Zu Position springen"
|
|
|
|
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
|
msgid "Guess Misplaced $IFDEF"
|
|
msgstr "Falsch gesetzte $IFDEF raten"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordleft
|
|
msgid "Move cursor part-word left (e.g. CamelCase)"
|
|
msgstr "Cursor halbes Wort nach links"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordright
|
|
msgid "Move cursor part-word right (e.g. CamelCase)"
|
|
msgstr "Cursor halbes Wort nach rechts"
|
|
|
|
#: lazarusidestrconsts.srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr "Ime-String"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "Eintrag für Änderungsprotokoll einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Aus der Zeichentabelle einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "CVS-Schlüsselwort »Author« einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "CVS-Schlüsselwort »Date« einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "CVS-Schlüsselwort für den Header einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "CVS-Schlüsselwort für die ID einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "CVS-Schlüsselwort für das Protokoll einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "CVS-Schlüsselwort für »Name« einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "CVS-Schlüsselwort für die Revision einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "CVS-Schlüsselwort für die Quelle einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Aktuelles Datum und Uhrzeit einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertfilename
|
|
msgid "Insert Full Filename"
|
|
msgstr "Vollen Dateinamen einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "GPL-Hinweis einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
|
msgid "Insert GPL notice (translated)"
|
|
msgstr "GPL-Hinweis (übersetzt) einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr "GUID einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "LGPL-Hinweis einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
|
msgid "Insert LGPL notice (translated)"
|
|
msgstr "LGPL-Hinweis (übersetzt) einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Zeilen trennen, Cursor belassen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnotice
|
|
msgid "Insert MIT notice"
|
|
msgstr "MIT-Notiz einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
|
msgid "Insert MIT notice (translated)"
|
|
msgstr "MIT-Hinweis (übersetzt) einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Einfügemodus"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr "Hinweis zur modifizierten LGPL einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
|
msgid "Insert modified LGPL notice (translated)"
|
|
msgstr "Angepaßten LGPL-Hinweis (übersetzt) einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Aktuellen Benutzernamen eintragen"
|
|
|
|
#: lazarusidestrconsts.srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "Inspizieren"
|
|
|
|
#: lazarusidestrconsts.srkmecinvertassignment
|
|
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Umgekehrte Zuweisung"
|
|
|
|
#: lazarusidestrconsts.srkmecjumptonextsearchresult
|
|
msgid "Jump to next search result"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecjumptoprevsearchresult
|
|
msgid "Jump to previous search result"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapleft
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapright
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: lazarusidestrconsts.srkmecleft
|
|
msgid "Move cursor left"
|
|
msgstr "Cursor nach links"
|
|
|
|
#: lazarusidestrconsts.srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Zeilen trennen und Cursor bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Cursor zum Zeilenende bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Zeilenauswahlmodus"
|
|
|
|
#: lazarusidestrconsts.srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Cursor zum Zeilenanfang bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmeclinetextstart
|
|
msgid "Move cursor to text start in line"
|
|
msgstr "Cursor an den Beginn des Texts in der Zeile setzen"
|
|
|
|
#: lazarusidestrconsts.srkmeclockeditor
|
|
msgid "Lock Editor"
|
|
msgstr "Editor sperren"
|
|
|
|
#: lazarusidestrconsts.srkmecmakeresourcestring
|
|
msgid "Make Resource String"
|
|
msgstr "Ressourcenstring erzeugen"
|
|
|
|
#: lazarusidestrconsts.srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Zur korrespondierenden Klammer springen"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Editor nach links bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr "Editor ganz nach links verschieben"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
|
msgid "Move editor to new window"
|
|
msgstr "Editor in neues Fenster kopieren"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
|
msgid "Move editor to next free window"
|
|
msgstr "Editor in nächstes freies Fenster kopieren"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
|
msgid "Move editor to prior free window"
|
|
msgstr "Editor in vorheriges freies Fenster kopieren"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Editor nach rechts bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr "Editor ganz nach rechts verschieben"
|
|
|
|
#: lazarusidestrconsts.srkmecmovelinedown
|
|
msgid "Move line down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmovelineup
|
|
msgid "Move line up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectdown
|
|
msgid "Move selection down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectleft
|
|
msgid "Move selection left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectright
|
|
msgid "Move selection right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectup
|
|
msgid "Move selection up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmultipaste
|
|
msgctxt "lazarusidestrconsts.srkmecmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr "Mehrfach einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Nächstes Lesezeichen"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Zu nächstem Editorfenster wechseln"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
|
msgid "Go to next editor in history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextsharededitor
|
|
msgid "Go to next editor with same Source"
|
|
msgstr "Zum nächsten Editor mit dem selben Quelltext"
|
|
|
|
#: lazarusidestrconsts.srkmecnextwindow
|
|
msgid "Go to next window"
|
|
msgstr "Zum nächsten Fenster"
|
|
|
|
#: lazarusidestrconsts.srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Normaler Auswahlmodus"
|
|
|
|
#: lazarusidestrconsts.srkmecopenfileatcursor
|
|
msgid "Open File at Cursor"
|
|
msgstr "Datei am Cursor öffnen"
|
|
|
|
#: lazarusidestrconsts.srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Überschreibe-Modus"
|
|
|
|
#: lazarusidestrconsts.srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Cursor zum Seitenende bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Bewege Cursor eine Seite nach unten"
|
|
|
|
#: lazarusidestrconsts.srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Bewege Cursor eine Seite nach links"
|
|
|
|
#: lazarusidestrconsts.srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Bewege Cursor eine Seite nach rechts"
|
|
|
|
#: lazarusidestrconsts.srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Cursor zum Seitenanfang bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Cursor eine Seite nach oben bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmecpaste
|
|
msgctxt "lazarusidestrconsts.srkmecpaste"
|
|
msgid "Paste"
|
|
msgstr "Einfügen"
|
|
|
|
#: lazarusidestrconsts.srkmecpasteascolumns
|
|
msgid "Paste (as Columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpause
|
|
msgid "pause program"
|
|
msgstr "Programmpause"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
|
msgid "Clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
|
msgid "Cursor keys clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
|
msgid "Cursor keys move all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
|
msgid "Add extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
|
msgid "Toggle extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
|
msgid "Remove extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Vorheriges Lesezeichen setzen"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Zu vorigem Editorfenster wechseln"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
|
msgid "Go to previous editor in history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevsharededitor
|
|
msgid "Go to prior editor with same Source"
|
|
msgstr "Zum vorherigen Editor mit dem selben Quelltext"
|
|
|
|
#: lazarusidestrconsts.srkmecprevwindow
|
|
msgid "Go to prior window"
|
|
msgstr "Zum vorherigen Fenster"
|
|
|
|
#: lazarusidestrconsts.srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "Schnelles Kompilieren, kein Linken"
|
|
|
|
#: lazarusidestrconsts.srkmecremovebreakpoint
|
|
msgid "remove breakpoint"
|
|
msgstr "Haltepunkt entfernen"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveemptymethods
|
|
msgid "Remove Empty Methods"
|
|
msgstr "Leere Methoden entfernen"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveunusedunits
|
|
msgid "Remove Unused Units"
|
|
msgstr "Ungenutzte Units entfernen"
|
|
|
|
#: lazarusidestrconsts.srkmecrenameidentifier
|
|
msgid "Rename Identifier"
|
|
msgstr "Bezeichner umbenennen"
|
|
|
|
#: lazarusidestrconsts.srkmecreplace
|
|
msgid "Replace Text"
|
|
msgstr "Ersetze Text"
|
|
|
|
#: lazarusidestrconsts.srkmecreportingbug
|
|
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
|
msgid "Reporting a bug"
|
|
msgstr "Fehler melden"
|
|
|
|
#: lazarusidestrconsts.srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "Debugger zurücksetzen"
|
|
|
|
#: lazarusidestrconsts.srkmecright
|
|
msgid "Move cursor right"
|
|
msgstr "Cursor nach rechts"
|
|
|
|
#: lazarusidestrconsts.srkmecrun
|
|
msgid "run program"
|
|
msgstr "Programm starten"
|
|
|
|
#: lazarusidestrconsts.srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "Datei starten"
|
|
|
|
#: lazarusidestrconsts.srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "Startparameter"
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithdebugging
|
|
msgid "run with debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithoutdebugging
|
|
msgid "run without debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Eine Zeile nach unten scrollen"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Ein Zeichen nach links scrollen"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Ein Zeichen nach rechts scrollen"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Eine Zeile nach oben scrollen"
|
|
|
|
#: lazarusidestrconsts.srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Zeile unten auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecselectall
|
|
msgctxt "lazarusidestrconsts.srkmecselectall"
|
|
msgid "Select All"
|
|
msgstr "Alles auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Umwandeln von Tabulatoren in Leerzeichen im Auswahlbereich"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Auswahl bis zum absoluten Ende"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Auswahl bis zum absoluten Anfang"
|
|
|
|
#: lazarusidestrconsts.srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr "Bis zu Position auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordleft
|
|
msgid "Select part-word left (e.g. CamelCase)"
|
|
msgstr "Halbwort links markieren"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordright
|
|
msgid "Select part-word right (e.g. CamelCase)"
|
|
msgstr "Halbwort rechts markieren"
|
|
|
|
#: lazarusidestrconsts.srkmecselleft
|
|
msgid "Select Left"
|
|
msgstr "Zeichen links auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecsellineend
|
|
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
|
msgid "Select Line End"
|
|
msgstr "Zeilenende auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinestart
|
|
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Zeilenanfang auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinetextstart
|
|
msgid "Select to text start in line"
|
|
msgstr "Bis zum Textbeginn in der Zeile auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagebottom
|
|
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Bis zu Seitenende auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Auswahl Seite nach unten"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Auswahl Seite links"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "Auswahl Seite rechts"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagetop
|
|
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Auswahl Seitenanfang"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Auswahl Seite hoch"
|
|
|
|
#: lazarusidestrconsts.srkmecselright
|
|
msgid "Select Right"
|
|
msgstr "Zeichen rechts auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecselsmartwordleft
|
|
msgid "Smart select word left (start/end of word)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselsmartwordright
|
|
msgid "Smart select word right (start/end of word)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselsticky
|
|
msgid "Start sticky selecting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickycol
|
|
msgid "Start sticky selecting (Columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickyline
|
|
msgid "Start sticky selecting (Line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickystop
|
|
msgid "Stop sticky selecting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Auswahl nach oben"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendleft
|
|
msgid "Select word-end left"
|
|
msgstr "Wortende links markieren"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendright
|
|
msgid "Select word-end right"
|
|
msgstr "Wortende rechts markieren"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordleft
|
|
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Wort links auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordright
|
|
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Wort rechts auswählen"
|
|
|
|
#: lazarusidestrconsts.srkmecsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
|
msgid "Set a free Bookmark"
|
|
msgstr "Freies Lesezeichen setzen"
|
|
|
|
#: lazarusidestrconsts.srkmecsetmarker
|
|
#, object-pascal-format
|
|
msgid "Set bookmark %d"
|
|
msgstr "Lesezeichen %d setzen"
|
|
|
|
#: lazarusidestrconsts.srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr "Umsch-Tab"
|
|
|
|
#: lazarusidestrconsts.srkmecshowabstractmethods
|
|
msgid "Show Abstract Methods"
|
|
msgstr "Abstrakte Methoden anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecshowcodecontext
|
|
msgid "Show Code Context"
|
|
msgstr "Code-Kontext anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
|
msgid "show execution point"
|
|
msgstr "Ausführungspunkt anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecsmartwordleft
|
|
msgid "Smart move cursor left (start/end of word)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsmartwordright
|
|
msgid "Smart move cursor right (start/end of word)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "Programm anhalten"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacroplay
|
|
msgid "Play Macro"
|
|
msgstr "Makro abspielen"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacrorecord
|
|
msgid "Record Macro"
|
|
msgstr "Makro aufnehmen"
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewrapcolsellineend
|
|
msgid "Column Select to wrapped line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewrapcolsellinestart
|
|
msgid "Column Select to wrapped line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewraplineend
|
|
msgid "Move cursor to wrapped line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewraplinestart
|
|
msgid "Move cursor to wrapped line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewrapsellineend
|
|
msgid "Select to wrapped line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewrapsellinestart
|
|
msgid "Select to wrapped line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedaddcell
|
|
msgid "Add Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase
|
|
msgid "Add Cell (case-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx
|
|
msgid "Add Cell (context-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase
|
|
msgid "Add Cell (context & case-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr "Zur letzten Stelle in der Zelle"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr "Zur ersten Stelle in der Zelle"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
|
msgid "Select Cell"
|
|
msgstr "Zelle wählen"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroeddelcell
|
|
msgid "Remove current Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
|
msgid "Escape"
|
|
msgstr "Abbrechen"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft
|
|
msgid "Grow cell on the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright
|
|
msgid "Grow cell on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Nächste Zelle"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Nächste Zelle (alle ausgewählt)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr "Nächste Zelle (nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr "Nächste Zelle (alle gewählten / nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Vorherige Zelle"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Vorherige Zelle (alle ausgewählt)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr "Vorherige Zelle (nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr "Vorherige Zelle (alle gewählten / nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft
|
|
msgid "Shrink cell on the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright
|
|
msgid "Shrink cell on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
|
msgid "Start Syncro edit"
|
|
msgstr "Synchronbearbeitung beginnen"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstartcase
|
|
msgid "Start Syncro edit (case-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstartctx
|
|
msgid "Start Syncro edit (context-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase
|
|
msgid "Start Syncro edit (context & case-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr "Zur letzten Stelle in der Zelle"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr "Zur ersten Stelle in der Zelle"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
|
msgid "Select cell"
|
|
msgstr "Zelle wählen"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
|
msgid "Escape"
|
|
msgstr "Abbrechen"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
|
msgid "Finish"
|
|
msgstr "Beenden"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Nächste Zelle"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
|
msgid "Next Cell (rotate)"
|
|
msgstr "Nächste Zelle (rotiert)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Nächste Zelle (alle gewählt)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
|
msgid "Next Cell (rotate / all selected)"
|
|
msgstr "Nächste Zelle (rotiert/alle gewählt)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr "Nächste Zelle (nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
|
msgid "Next Cell (rotate / firsts only)"
|
|
msgstr "Nächste Zelle (rotieren / nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr "Nächste Zelle (alle gewählten / nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
|
msgid "Next Cell (rotate / all selected / firsts only)"
|
|
msgstr "Nächste Zelle (rotieren / alle gewählten / nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Vorherige Zelle"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Vorherige Zelle (alle gewählt)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr "Vorherige Zelle (nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr "Vorherige Zelle (alle gewählten / nur erste)"
|
|
|
|
#: lazarusidestrconsts.srkmecsyntaxcheck
|
|
msgid "Syntax Check"
|
|
msgstr "Syntaxüberprüfung"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleassembler
|
|
msgid "View assembler"
|
|
msgstr "Assembler anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoint
|
|
msgid "toggle breakpoint"
|
|
msgstr "Haltepunkt umschalten"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpointenabled
|
|
msgid "enable/disable breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Haltepunkte anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Aufruf-Stack anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr "Code Browser anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "CodeExplorer anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Komponentenpalette anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Debuggerausgabe anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Zwischen Formular und Unit umschalten"
|
|
|
|
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr "Dokumentationseditor anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
|
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
|
msgid "View IDE speed buttons"
|
|
msgstr "Speedbuttons der IDE anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Lokale Variablen anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarker
|
|
#, object-pascal-format
|
|
msgid "Toggle bookmark %d"
|
|
msgstr "Lesezeichen %d umschalten"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarkupword
|
|
msgid "Toggle Current-Word highlight"
|
|
msgstr "Aktuelles Wort hervorheben (ein/aus)"
|
|
|
|
#: lazarusidestrconsts.srkmectogglememviewer
|
|
msgctxt "lazarusidestrconsts.srkmectogglememviewer"
|
|
msgid "View Mem viewer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Meldungen anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Modus wechseln"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Objektinspektor anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleregisters
|
|
msgid "View registers"
|
|
msgstr "Register anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr "Browser für bedingte Eigenschaften anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Suchergebnisse anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Quelltexteditor anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Überwachte Ausdrücke anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldall
|
|
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Alle entfalten"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldcurrent
|
|
msgid "Unfold at Cursor"
|
|
msgstr "Beim Cursor entfalten"
|
|
|
|
#: lazarusidestrconsts.srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "unbekannter Editorbefehl"
|
|
|
|
#: lazarusidestrconsts.srkmecunusedunits
|
|
msgid "Unused Units ..."
|
|
msgstr "Ungenutzte Units ..."
|
|
|
|
#: lazarusidestrconsts.srkmecup
|
|
msgid "Move cursor up"
|
|
msgstr "Cursor nach oben"
|
|
|
|
#: lazarusidestrconsts.srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Ankereditor anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr "Komponenten anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecvieweditormacros
|
|
msgid "View editor macros"
|
|
msgstr "Editormakros anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Formulare anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecviewhistory
|
|
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
|
msgid "View History"
|
|
msgstr "Historie anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
|
msgid "View console in/output"
|
|
msgstr "Zeige die Ein/Ausgaben der Konsole"
|
|
|
|
#: lazarusidestrconsts.srkmecviewtaborder
|
|
msgid "View Tab Order"
|
|
msgstr "Tabulatorreihenfolge anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecviewthreads
|
|
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Zeige die Threads"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Unit-Abhängigkeiten anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Unit-Informationen anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Units anzeigen"
|
|
|
|
#: lazarusidestrconsts.srkmecwordcompletion
|
|
msgid "Word Completion"
|
|
msgstr "Wortvervollständigung"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendleft
|
|
msgid "Move cursor word-end left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordendright
|
|
msgid "Move cursor word-end right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Cursor ein Wort nach links bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Cursor ein Wort nach rechts bewegen"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomin
|
|
msgid "Zoom in"
|
|
msgstr "Ansicht vergrößern"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomout
|
|
msgid "Zoom out"
|
|
msgstr "Ansicht verkleinern"
|
|
|
|
#: lazarusidestrconsts.srkmeditforcmd
|
|
msgid "Edit keys of command"
|
|
msgstr "Taste für Befehl bearbeiten"
|
|
|
|
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
|
msgid "Continue with next mouse up action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldcomments
|
|
msgid "Fold comments"
|
|
msgstr "Kommentare falten"
|
|
|
|
#: lazarusidestrconsts.synffoldcommentsinselection
|
|
msgid "Fold comments in selection"
|
|
msgstr "Kommentare in Auswahl falten"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdef
|
|
msgid "Fold inactive Ifdef"
|
|
msgstr "Inaktive Ifdef falten"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
|
msgid "Fold inactive Ifdef (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
|
msgid "Fold inactive Ifdef in selection"
|
|
msgstr "Inaktive Ifdef in Auswahl falten"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
|
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfhidecomments
|
|
msgid "Hide comments"
|
|
msgstr "Kommentare verbergen"
|
|
|
|
#: lazarusidestrconsts.synfhidecommentsinselection
|
|
msgid "Hide comments in selection"
|
|
msgstr "Kommentare in Auswahl verbergen"
|
|
|
|
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
|
msgid "Match action button of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
|
msgid "Match action line of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
|
msgid "Match action modifiers of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
|
msgid "Match action pos of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
|
msgid "Search all action of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdef
|
|
msgid "Unfold active Ifdef"
|
|
msgstr "Aktive Ifdef entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
|
msgid "Unfold active Ifdef in selection"
|
|
msgstr "Aktive Ifdef in Auswahl entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldall
|
|
msgctxt "lazarusidestrconsts.synfunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Alle entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdef
|
|
msgid "Unfold all Ifdef"
|
|
msgstr "Alle Ifdef entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
|
msgid "Unfold all Ifdef in selection"
|
|
msgstr "Alle Ifdef in Auswahl entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallinselection
|
|
msgid "Unfold all in selection"
|
|
msgstr "Alles in Auswahl entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldcomments
|
|
msgid "Unfold comments"
|
|
msgstr "Kommentare entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
|
msgid "Unfold comments in selection"
|
|
msgstr "Kommentare in Auswahl entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
|
msgid "Unfold inactive Ifdef"
|
|
msgstr "Inaktive Ifdef entfalten"
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
|
msgid "Unfold inactive Ifdef in selection"
|
|
msgstr "Inaktive Ifdef in Auswahl entfalten"
|
|
|
|
#: lazarusidestrconsts.uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "Datei ist nur lesbar"
|
|
|
|
#: lazarusidestrconsts.uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "Die Datei »"
|
|
|
|
#: lazarusidestrconsts.uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "« ist schreibgeschützt."
|
|
|
|
#: lazarusidestrconsts.uelocked
|
|
msgid "Locked"
|
|
msgstr "Gesperrt"
|
|
|
|
#: lazarusidestrconsts.uemacrorecording
|
|
msgid "Recording"
|
|
msgstr "Aufzeichnung"
|
|
|
|
#: lazarusidestrconsts.uemacrorecordingpaused
|
|
msgid "Rec-pause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "Überwachung an Cursorpos. &hinzufügen"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
|
msgid "Add Watch&Point At Cursor"
|
|
msgstr "Überwachungs&punkt am Cursor hinzufügen"
|
|
|
|
#: lazarusidestrconsts.uembookmarknset
|
|
#, object-pascal-format
|
|
msgid "Bookmark &%s: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uembookmarknunset
|
|
#, object-pascal-format
|
|
msgid "Bookmark &%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uembookmarknunsetdisabled
|
|
#, object-pascal-format
|
|
msgid "Bookmark %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpages
|
|
msgid "Close All &Other Pages"
|
|
msgstr "Alle anderen Seiten schließen"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesplain
|
|
msgid "Close All Other Pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesright
|
|
msgid "Close Pages on the &Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesrightplain
|
|
msgid "Close Pages on the Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "Seite s&chließen"
|
|
|
|
#: lazarusidestrconsts.uemcopyfilename
|
|
msgid "Copy Filename"
|
|
msgstr "Dateiname kopieren"
|
|
|
|
#: lazarusidestrconsts.uemcopytonewwindow
|
|
msgid "Clone to New Window"
|
|
msgstr "In neues Fenster kopieren"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindow
|
|
msgid "Clone to Other Window"
|
|
msgstr "In anderes Fenster kopieren"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Neues Fenster"
|
|
|
|
#: lazarusidestrconsts.uemdebugword
|
|
msgctxt "lazarusidestrconsts.uemdebugword"
|
|
msgid "Debug"
|
|
msgstr "Debug"
|
|
|
|
#: lazarusidestrconsts.uemencoding
|
|
msgid "Encoding"
|
|
msgstr "Zeichenkodierung"
|
|
|
|
#: lazarusidestrconsts.uemevaluatemodify
|
|
msgid "&Evaluate/Modify ..."
|
|
msgstr "Üb&erprüfen/Ändern"
|
|
|
|
#: lazarusidestrconsts.uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "&Suche Deklaration"
|
|
|
|
#: lazarusidestrconsts.uemfindinotherwindow
|
|
msgid "Find in other Window"
|
|
msgstr "in anderem Fenster finden"
|
|
|
|
#: lazarusidestrconsts.uemgotobookmark
|
|
msgctxt "lazarusidestrconsts.uemgotobookmark"
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Gehe zum Lesezeichen"
|
|
|
|
#: lazarusidestrconsts.uemgotobookmarks
|
|
msgid "Goto Bookmark ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr "Highlighter"
|
|
|
|
#: lazarusidestrconsts.ueminspect
|
|
msgctxt "lazarusidestrconsts.ueminspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Prüfen..."
|
|
|
|
#: lazarusidestrconsts.ueminvertassignment
|
|
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Umgekehrte Zuweisung"
|
|
|
|
#: lazarusidestrconsts.uemlineending
|
|
msgid "Line Ending"
|
|
msgstr "Zeilenende"
|
|
|
|
#: lazarusidestrconsts.uemlockpage
|
|
msgid "&Lock Page"
|
|
msgstr "Seite sperren"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleft
|
|
msgid "Move Page Left"
|
|
msgstr "nach links"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleftmost
|
|
msgid "Move Page Leftmost"
|
|
msgstr "nach ganz links"
|
|
|
|
#: lazarusidestrconsts.uemmovepageright
|
|
msgid "Move Page Right"
|
|
msgstr "nach rechts"
|
|
|
|
#: lazarusidestrconsts.uemmovepagerightmost
|
|
msgid "Move Page Rightmost"
|
|
msgstr "nach ganz rechts"
|
|
|
|
#: lazarusidestrconsts.uemmovetonewwindow
|
|
msgid "Move to New Window"
|
|
msgstr "In neues Fenster verschieben"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindow
|
|
msgid "Move to Other Window"
|
|
msgstr "In anderes Fenster verschieben"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Neues Fenster"
|
|
|
|
#: lazarusidestrconsts.uemnextbookmark
|
|
msgid "Goto Next Bookmark"
|
|
msgstr "Springe zum nächsten Lesezeichen"
|
|
|
|
#: lazarusidestrconsts.uemodified
|
|
msgid "Modified"
|
|
msgstr "Geändert"
|
|
|
|
#: lazarusidestrconsts.uemopenfileatcursor
|
|
msgid "&Open File at Cursor"
|
|
msgstr "Öffne &Datei beim Cursor"
|
|
|
|
#: lazarusidestrconsts.uemprevbookmark
|
|
msgid "Goto Previous Bookmark"
|
|
msgstr "Springe zum vorigen Lesezeichen"
|
|
|
|
#: lazarusidestrconsts.uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Prozedursprung"
|
|
|
|
#: lazarusidestrconsts.uemreadonly
|
|
msgctxt "lazarusidestrconsts.uemreadonly"
|
|
msgid "Read Only"
|
|
msgstr "Schreibgeschützt"
|
|
|
|
#: lazarusidestrconsts.uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Refactoring"
|
|
|
|
#: lazarusidestrconsts.uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Zeilennummern einblenden"
|
|
|
|
#: lazarusidestrconsts.uemsource
|
|
msgctxt "lazarusidestrconsts.uemsource"
|
|
msgid "Source"
|
|
msgstr "Quelle"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmark
|
|
msgid "&Toggle Bookmark"
|
|
msgstr "Lese&zeichen umschalten"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarknset
|
|
#, object-pascal-format
|
|
msgid "Toggle Bookmark &%s: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarknunset
|
|
#, object-pascal-format
|
|
msgid "Toggle Bookmark &%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarks
|
|
msgid "Toggle Bookmark ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemtogglebreakpoint
|
|
msgid "Toggle &Breakpoint"
|
|
msgstr "Haltepunkt umschal&ten"
|
|
|
|
#: lazarusidestrconsts.uemviewcallstack
|
|
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Aufrufstack anzeigen"
|
|
|
|
#: lazarusidestrconsts.uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Noch nicht implementiert"
|
|
|
|
#: lazarusidestrconsts.uepins
|
|
msgid "INS"
|
|
msgstr "Einfg"
|
|
|
|
#: lazarusidestrconsts.uepovr
|
|
msgid "OVR"
|
|
msgstr "Üb"
|
|
|
|
#: lazarusidestrconsts.uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Schreibgeschützt"
|
|
|
|
#: lazarusidestrconsts.uepselchars
|
|
#, object-pascal-format
|
|
msgid "%d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepselcol
|
|
msgid "COL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepselcxchars
|
|
#, object-pascal-format
|
|
msgid "%d * %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepselline
|
|
msgctxt "lazarusidestrconsts.uepselline"
|
|
msgid "LINE"
|
|
msgstr "Zeile"
|
|
|
|
#: lazarusidestrconsts.uepselnorm
|
|
msgid "DEF"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.unitdepoptionsforpackage
|
|
msgid "Options for Package graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.unitdepoptionsforunit
|
|
msgid "Options for Unit graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Versionsinformation"
|
|
|