mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-04-05 17:37:53 +02:00
22122 lines
653 KiB
Plaintext
22122 lines
653 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Last-Translator: Sławomir Niedziela <slniedz@poczta.onet.pl>\n"
|
|
"PO-Revision-Date: 2020-06-30 21:31+0200\n"
|
|
"Project-Id-Version: lazaruside\n"
|
|
"Language-Team: \n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"POT-Creation-Date: \n"
|
|
"MIME-Version: 1.0\n"
|
|
"X-Poedit-SourceCharset: utf-8\n"
|
|
"Language: pl_PL\n"
|
|
"X-Generator: Poedit 2.3.1\n"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
|
|
#, object-pascal-format
|
|
msgid "Address Breakpoint %s"
|
|
msgstr "Pułapka na adresie %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddress
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "at $%s"
|
|
msgstr "Błąd zapisu: %s%sPlik: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
|
|
#, object-pascal-format, fuzzy
|
|
msgid "at $%s: from origin %s line %d"
|
|
msgstr "Usunąć pułapkę w %s\"%s\" linia %d?"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
|
|
#, object-pascal-format, fuzzy
|
|
msgid "at $%s: %s line %d"
|
|
msgstr "Usunąć pułapkę w %s\"%s\" linia %d?"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
|
|
#, object-pascal-format
|
|
msgid "Source Breakpoint %s"
|
|
msgstr "Pułapka źródła %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
|
|
#, object-pascal-format
|
|
msgid "Unknown Breakpoint %s"
|
|
msgstr "Nieznana pułapka %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakwatchpoint
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Watchpoint %s"
|
|
msgstr "%s nie istnieje: %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
|
|
#, object-pascal-format
|
|
msgid "Unknown Watchpoint out of scope %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
|
|
#, object-pascal-format
|
|
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventwatchscopeended
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Watchpoint for \"%s\" out of scope %s"
|
|
msgstr "%s Indeks %d przekracza zakres 0 .. %d"
|
|
|
|
#: lazarusidestrconsts.dbgeventwatchtriggered
|
|
#, object-pascal-format
|
|
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
|
msgid "Use predefined scheme"
|
|
msgstr "Użyj schematu predefiniowanego"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetall
|
|
msgid "Reset all settings"
|
|
msgstr "Przywróć wszystkie ustawienia"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetgutter
|
|
msgid "Reset all gutter settings"
|
|
msgstr "Przywróć domyślne ustawienia lewego marginesu ikon"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresettext
|
|
msgid "Reset all text settings"
|
|
msgstr "Przywróć wszystkie ustawienia tekstu"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
|
msgid "Add history point"
|
|
msgstr "Dodaj punkt w historii"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
|
msgid "Context Menu"
|
|
msgstr "Menu kontekstowe"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
|
msgid "Context Menu (debug)"
|
|
msgstr "Menu kontekstowe (odpluskwianie)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
|
msgid "Context Menu (tab)"
|
|
msgstr "Menu kontekstowe (tab)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
|
msgid "Jumps to implementation"
|
|
msgstr "Przekok do implementacji"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
|
msgid "Jumps to implementation/other block end"
|
|
msgstr "Przeskok do implementacji/drugiego końca bloku"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
|
msgid "History back"
|
|
msgstr "Wstecz w historii"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
|
msgid "History forward"
|
|
msgstr "Do przodu w historii"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
|
#, fuzzy
|
|
msgid "Toggle extra Caret"
|
|
msgstr "Kursor"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr "Nic/Domyślnie"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
|
msgid "Paste"
|
|
msgstr "Wklej"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
|
#, object-pascal-format
|
|
msgid "Continue %0:s (Bound to: %1:s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
|
#, object-pascal-format
|
|
msgid "Continue %0:s"
|
|
msgstr "Kontynuuj %0:s"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
|
msgid "Select text"
|
|
msgstr "Zaznacz tekst"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
|
msgid "Select text (lines)"
|
|
msgstr "Zaznacz tekst (wiersze)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
|
msgid "Select text (tokens)"
|
|
msgstr "Zaznacz tekst (nazwy)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
|
msgid "Select text (words)"
|
|
msgstr "Zaznacz tekst (słowa)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
|
msgid "Select text (Column mode)"
|
|
msgstr "Zaznacz tekst (Tryb kolumn)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
|
msgid "Select text (Line mode)"
|
|
msgstr "Zaznacz tekst (Tryb wierszy)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
|
msgid "Set free bookmark"
|
|
msgstr "Ustaw wolną zakładkę"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
|
msgid "Select current Line (Full)"
|
|
msgstr "Zaznacz bieżący wiersz (całość)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
|
msgid "Select current Line (Text)"
|
|
msgstr "Zaznacz bieżący wiersz (tekst)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
|
msgid "Select current Paragraph"
|
|
msgstr "Zaznacz bieżący akapit"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
|
msgid "Select current Word"
|
|
msgstr "Wybierz bieżące słowo"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
|
msgid "Reset zoom"
|
|
msgstr "Przywróć powiększenie"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplediff
|
|
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
|
msgstr "Ta strona nie przedstawia bieżących ustawień. Zobacz stronę zaawansowane. Użyj tej strony do przywrócenia zmian zaawansowanych"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
|
msgid "General"
|
|
msgstr "Ogólne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
|
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
|
msgstr "Standardowe, wszystkie działania (pułapka, zwijanie) przy wciśnięciu klawisza myszy"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
|
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
|
msgstr "Rozszerzone, działania (pułapka, zwijanie) przy puszczeniu klawisza myszy. Zaznaczenie przy wciśnięciu klawisza myszy i ruchu"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
|
msgid "Extended, Actions, right gutter half only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
|
msgid "Use line numbers to select lines"
|
|
msgstr "Użyj numerów wierszy do zaznaczania wierszy"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
|
msgid "Gutter"
|
|
msgstr "Lewy margines ikon"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
|
msgid "Right button click includes caret move"
|
|
msgstr "Prawy klawisz myszy wywołuje przesunięcie kursora"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
|
msgid "Alt-Ctrl Button"
|
|
msgstr "Alt-Ctrl i przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
|
msgid "Alt-Ctrl Wheel"
|
|
msgstr "Alt-Ctrl i kółko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
|
msgid "Alt Button"
|
|
msgstr "Alt i przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
|
msgid "Alt Wheel"
|
|
msgstr "Alt i kółko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
|
msgid "Ctrl Button"
|
|
msgstr "Ctrl i przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
|
msgid "Ctrl Wheel"
|
|
msgstr "Ctrl i kółko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
|
msgid "Drag selection (copy/paste)"
|
|
msgstr "Przeciągaj zaznaczenie (kopiuj/wklej)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
|
#, fuzzy
|
|
msgid "Extra-1 Button"
|
|
msgstr "Przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
|
#, fuzzy
|
|
msgid "Extra-2 Button"
|
|
msgstr "Przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
|
msgid "Alt Double"
|
|
msgstr "Alt i podwójne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
|
msgid "Ctrl Double"
|
|
msgstr "Ctrl i podwójne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
|
msgid "Double"
|
|
msgstr "Podwójne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
|
msgid "Shift Double"
|
|
msgstr "Shift i podwójne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
|
msgid "Quad"
|
|
msgstr "Poczwórne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
|
msgid "Triple"
|
|
msgstr "Potrójne"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
|
msgid "Middle Button"
|
|
msgstr "Środkowy klawisz"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
|
msgid "Middle"
|
|
msgstr "Środkowy"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
|
msgid "Extra 1"
|
|
msgstr "Lewy 1"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
|
msgid "Extra 2"
|
|
msgstr "Lewy 2"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
|
|
msgid "Horizontal-Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
|
msgid "Left 1"
|
|
msgstr "Lewy 1"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
|
msgid "Left 2"
|
|
msgstr "Lewy 2"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
|
msgid "Right"
|
|
msgstr "Prawy"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
|
msgid "Wheel"
|
|
msgstr "Kółko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
|
msgid "Right Button"
|
|
msgstr "Prawy przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
|
msgid "Shift-Alt-Ctrl Button"
|
|
msgstr "Shift-Alt-Ctrl i przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
|
msgid "Shift-Alt-Ctrl"
|
|
msgstr "Shift-Alt-Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
|
msgid "Shift-Alt Button"
|
|
msgstr "Shift-Alt i przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
|
msgid "Shift-Alt Wheel"
|
|
msgstr "Shift-Alt i kółko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
|
msgid "Shift-Ctrl Button"
|
|
msgstr "Shift-Ctrl i przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
|
msgid "Shift-Ctrl Wheel"
|
|
msgstr "Shift-Ctrl i kółko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
|
msgid "Shift Button"
|
|
msgstr "Shift i przycisk"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
|
msgid "Wheel"
|
|
msgstr "Kółko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
|
msgid "Shift Wheel"
|
|
msgstr "Shift i kółko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewarning
|
|
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
|
msgstr "Posiadasz niezapisane zmiany. Użycie tej strony spowoduje cofnięcie zmian na stronie zaawansowane"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
|
msgid "Scroll horizontal (System speed)"
|
|
msgstr "Przewiń poziomo (szybkość systemowa)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
|
#, fuzzy
|
|
msgid "Scroll horizontal (Single line)"
|
|
msgstr "Przewiń w dół o jedną linię"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
|
#, fuzzy
|
|
msgid "Scroll horizontal (Page)"
|
|
msgstr "Przewijaj pół strony"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
|
#, fuzzy
|
|
msgid "Scroll horizontal (Half page)"
|
|
msgstr "Przewijaj pół strony"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
|
msgid "Scroll horizontal (Page, less one line)"
|
|
msgstr "Przewiń poziomo (Strona minus jeden wiersz)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr "Nic/Domyślnie"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
|
msgid "Scroll (System speed)"
|
|
msgstr "Przewiń (szybkość systemowa)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
|
msgid "Scroll (Single line)"
|
|
msgstr "Przewiń o jedną linię"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
|
msgid "Scroll (Page)"
|
|
msgstr "Przewiń o stronę"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
|
msgid "Scroll (Half page)"
|
|
msgstr "Przewiń pół strony"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
|
msgid "Scroll (Page, less one line)"
|
|
msgstr "Przewiń o stronę minus jedna linia"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
|
msgid "Zoom"
|
|
msgstr "Powiększenie"
|
|
|
|
#: lazarusidestrconsts.dlfnopredefinedscheme
|
|
msgid "< None >"
|
|
msgstr "< Brak >"
|
|
|
|
#: lazarusidestrconsts.dlfreadonlycolor
|
|
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
|
msgid "Read Only"
|
|
msgstr "Tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Małymi Literami, Pierwsza Duża"
|
|
|
|
#: lazarusidestrconsts.dlgactivedesktop
|
|
msgid "active"
|
|
msgstr "aktywny"
|
|
|
|
#: lazarusidestrconsts.dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr "Dodaj operator przypisania :="
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
|
msgid "Brackets highlight"
|
|
msgstr "Podświetlenie nawiasów"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
|
msgid "Code folding tree"
|
|
msgstr "Drzewo zwijanego kodu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefault
|
|
msgid "Default Text"
|
|
msgstr "Tekst domyślny"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
|
|
msgid "Default Text / Window"
|
|
msgstr "Tekst domyślny / okno"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
|
msgid "Disabled breakpoint"
|
|
msgstr "Wyłączona pułapka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
|
msgid "Enabled breakpoint"
|
|
msgstr "Włączona pułapka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
|
msgid "Error line"
|
|
msgstr "Wiersz błędu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
|
msgid "Execution point"
|
|
msgstr "Punkt wykonania"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
|
msgid "Folded code marker"
|
|
msgstr "Znacznik zwiniętego kodu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
|
|
msgid "Fold start-line"
|
|
msgstr "Zwiń początkową linię"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
|
msgid "Global"
|
|
msgstr "Globalny"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
|
msgid "Gutter"
|
|
msgstr "Lewy margines ikon"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
|
msgid "Line"
|
|
msgstr "Wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
|
|
#, fuzzy
|
|
msgid "Outline Colors"
|
|
msgstr "Kolory"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
|
msgid "Syncron Edit"
|
|
msgstr "Edycja Syncron"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
|
msgid "Template Edit"
|
|
msgstr "Edycja szablonów"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
|
msgid "Gutter Separator"
|
|
msgstr "Separator kolektora"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
|
|
msgid "Hide start-line"
|
|
msgstr "Ukryj początkową linię"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
|
#, fuzzy
|
|
msgid "Incremental others"
|
|
msgstr "Wyszukiwanie przyrostowe"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
|
|
msgid "Highlight prefix"
|
|
msgstr "Nie podświetlaj"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
|
msgid "Highlight current word"
|
|
msgstr "Podświetl bieżący wyraz"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
|
msgid "Incremental search"
|
|
msgstr "Wyszukiwanie przyrostowe"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
|
msgid "Invalid breakpoint"
|
|
msgstr "Nieprawidłowa pułapka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
|
msgid "Current line highlight"
|
|
msgstr "Podświetlenie bieżącego wiersza"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
|
msgid "Line number"
|
|
msgstr "Numer wiersza"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
|
msgid "Modified line"
|
|
msgstr "Wiersz zmodyfikowany"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
|
#, fuzzy
|
|
msgid "Mouse link"
|
|
msgstr "Łącz sprytnie"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
|
|
msgid "Level 10"
|
|
msgstr "Poziom 10"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
|
|
msgid "Level 1"
|
|
msgstr "Poziom 1"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
|
|
msgid "Level 2"
|
|
msgstr "Poziom 2"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
|
|
msgid "Level 3"
|
|
msgstr "Poziom 3"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
|
|
msgid "Level 4"
|
|
msgstr "Poziom 4"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
|
|
msgid "Level 5"
|
|
msgstr "Poziom 5"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
|
|
msgid "Level 6"
|
|
msgstr "Poziom 6"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
|
|
msgid "Level 7"
|
|
msgstr "Poziom 7"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
|
|
msgid "Level 8"
|
|
msgstr "Poziom 8"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
|
|
msgid "Level 9"
|
|
msgstr "Poziom 9"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
|
msgid "Selected Area"
|
|
msgstr "Zaznaczony obszar"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktywna komórka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Inne komórki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr "Inne komórki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktywna komórka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Inne komórki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr "Inne komórki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
|
msgid "Text block"
|
|
msgstr "Blok tekstu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
|
msgid "Unknown breakpoint"
|
|
msgstr "Nieznana pułapka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwindowborder
|
|
msgid "Window border"
|
|
msgstr "Obramowanie okna"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
|
#, fuzzy
|
|
msgid "Word-Brackets"
|
|
msgstr "Nawiasy"
|
|
|
|
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
|
msgid "Visualized Special Chars"
|
|
msgstr "Widoczne znaki specjalne"
|
|
|
|
#: lazarusidestrconsts.dlgaddnewmode
|
|
msgid "Add new mode"
|
|
msgstr "Dodaj nowy tryb"
|
|
|
|
#: lazarusidestrconsts.dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr "Dodaj średnik"
|
|
|
|
#: lazarusidestrconsts.dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Wyrównaj górną linię do komentarza z przodu"
|
|
|
|
#: lazarusidestrconsts.dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "Alfabetycznie"
|
|
|
|
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
|
msgid "Always keep caret in visible area of editor"
|
|
msgstr "Kursor zawsze w widocznym obszarze edytora"
|
|
|
|
#: lazarusidestrconsts.dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Przy dwuznacznej nazwie pliku:"
|
|
|
|
#: lazarusidestrconsts.dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Ostrzegaj przed kompilacją"
|
|
|
|
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
|
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgansicommenttab
|
|
msgid "Ansi (* *)"
|
|
msgstr "Ansi (* *)"
|
|
|
|
#: lazarusidestrconsts.dlgapplicationsettings
|
|
msgid "Application settings"
|
|
msgstr "Ustawienia aplikacji"
|
|
|
|
#: lazarusidestrconsts.dlgassertcode
|
|
msgid "Include assertion code"
|
|
msgstr "Dołącz asercje (-Sa)"
|
|
|
|
#: lazarusidestrconsts.dlgassociateddebugdesktop
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "Associated debug desktop"
|
|
msgid "Associated debug desktop for \"%s\""
|
|
msgstr "Skojarzony pulpit odpluskwiania"
|
|
|
|
#: lazarusidestrconsts.dlgassociateddebugdesktophint
|
|
msgid "If you select the desktop, the associated debug desktop will be selected as well."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Automatycznie twórz:"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateformshint
|
|
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreatenewforms
|
|
msgid "Auto-create new forms"
|
|
msgstr "Nowe formularze dodawaj do tworzonych automatycznie"
|
|
|
|
#: lazarusidestrconsts.dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Automatycznie usuń plik"
|
|
|
|
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
|
msgid "Auto Display Function Prototypes"
|
|
msgstr "Automatycznie wyświetl prototypy funkcji"
|
|
|
|
#: lazarusidestrconsts.dlgautohidecursor
|
|
msgctxt "lazarusidestrconsts.dlgautohidecursor"
|
|
msgid "Hide mouse pointer when typing"
|
|
msgstr "Ukryj wskaźnik myszy podczas pisania"
|
|
|
|
#: lazarusidestrconsts.dlgautoindent
|
|
msgctxt "lazarusidestrconsts.dlgautoindent"
|
|
msgid "Auto indent"
|
|
msgstr "Automatyczne wcięcia"
|
|
|
|
#: lazarusidestrconsts.dlgautoindentlink
|
|
msgid "(Set up smart indent)"
|
|
msgstr "(Ustaw sprytne wcięcia)"
|
|
|
|
#: lazarusidestrconsts.dlgautoindenttype
|
|
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
|
msgid "Auto indent"
|
|
msgstr "Automatyczne wcięcia"
|
|
|
|
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
|
msgid "Auto remove empty methods"
|
|
msgstr "Automatycznie usuwaj puste metody"
|
|
|
|
#: lazarusidestrconsts.dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Automatycznie zmień nazwę na małe litery"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
|
msgid "Auto save active desktop"
|
|
msgstr "Automatycznie zapisuj aktywny pulpit"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "Save active desktop on IDE close\n"
|
|
#| "Save debug desktop on IDE close and debug end\n"
|
|
msgid ""
|
|
"Save active desktop on IDE close\n"
|
|
"Save debug desktop on IDE close and debug end"
|
|
msgstr ""
|
|
"Zapisz aktywny pulpit przy zamykaniu IDE\n"
|
|
"Zapisz pulpit odpluskwiania przy zamykaniu IDE i zakończeniu odpluskwiania\n"
|
|
|
|
#: lazarusidestrconsts.dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Dostępne formularze:"
|
|
|
|
#: lazarusidestrconsts.dlgavailableformshint
|
|
msgid "These forms must be created and freed in the program code."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
|
|
msgid "Avoid unnecessary jumps"
|
|
msgstr "Zapobiegaj niepotrzebnym skokom"
|
|
|
|
#: lazarusidestrconsts.dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Tło"
|
|
|
|
#: lazarusidestrconsts.dlgbaknosubdirectory
|
|
msgctxt "lazarusidestrconsts.dlgbaknosubdirectory"
|
|
msgid "(no subdirectory)"
|
|
msgstr "(brak podkatalogu)"
|
|
|
|
#: lazarusidestrconsts.dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Taka sama nazwa (w podkatalogu)"
|
|
|
|
#: lazarusidestrconsts.dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Za metodami"
|
|
|
|
#: lazarusidestrconsts.dlgblockgroupoptions
|
|
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
|
msgid "Selection"
|
|
msgstr "Zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.dlgblockindent
|
|
msgctxt "lazarusidestrconsts.dlgblockindent"
|
|
msgid "Block indent (spaces)"
|
|
msgstr "Wcięcie bloku (spacjami)"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentkeys
|
|
msgid "Block indent"
|
|
msgstr "Wcięcia blokowe"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentlink
|
|
msgid "(edit keys)"
|
|
msgstr "(ustawianie klawiszy)"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypecopy
|
|
msgid "Space/tab as prev Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypepos
|
|
msgid "Position only"
|
|
msgstr "Tylko pozycja"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypespace
|
|
msgid "Spaces"
|
|
msgstr "Spacje"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
|
#, fuzzy
|
|
msgid "Tabs, cut off"
|
|
msgstr "Tabulatory"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
|
msgid "Tabs, then spaces"
|
|
msgstr "Tabulatory, potem spacje"
|
|
|
|
#: lazarusidestrconsts.dlgblocktabindent
|
|
msgid "Block indent (tabs)"
|
|
msgstr "Wcięcie bloku (tabulatorem)"
|
|
|
|
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
|
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgborderspacingcolor
|
|
msgid "BorderSpacing frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbrackethighlight
|
|
msgid "Bracket highlight"
|
|
msgstr "Podświetlanie nawiasów"
|
|
|
|
#: lazarusidestrconsts.dlgbracketmatchgroup
|
|
msgid "Matching bracket and quote pairs"
|
|
msgstr "Pasujące pary nawiasów i cudzysłowów"
|
|
|
|
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
|
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
|
msgstr "Nie można używać pulpitu z dokowaniem w środowisku bez dokowania i na odwrót."
|
|
|
|
#: lazarusidestrconsts.dlgcaretbackcolor
|
|
msgid "Secondary carets (multi-caret mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcaretcolor
|
|
#, fuzzy
|
|
#| msgid "Caret"
|
|
msgctxt "lazarusidestrconsts.dlgcaretcolor"
|
|
msgid "Caret (Text-Cursor)"
|
|
msgstr "Kursor"
|
|
|
|
#: lazarusidestrconsts.dlgcaretcolorinfo
|
|
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcaretforecolor
|
|
#, fuzzy
|
|
#| msgid "Color (NotXor)"
|
|
msgid "Main or primary caret"
|
|
msgstr "Kolor (NotXor)"
|
|
|
|
#: lazarusidestrconsts.dlgcaretgroupoptions
|
|
msgid "Caret (Text Cursor)"
|
|
msgstr "Kursor (tekstowy)"
|
|
|
|
#: lazarusidestrconsts.dlgcaretscrollgroupoptions
|
|
msgid "Caret (Text Cursor) past end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcasesensitive
|
|
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
|
msgid "&Case sensitive"
|
|
msgstr "&Uwzględnij wielkość liter"
|
|
|
|
#: lazarusidestrconsts.dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr "Sprawdzanie opcji kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
|
#, object-pascal-format
|
|
msgid "orphaned file found: %s"
|
|
msgstr "znaleziono osierocony plik: %s"
|
|
|
|
#: lazarusidestrconsts.dlgccoresults
|
|
msgid "Results"
|
|
msgstr "Wyniki"
|
|
|
|
#: lazarusidestrconsts.dlgccotest
|
|
msgctxt "lazarusidestrconsts.dlgccotest"
|
|
msgid "Test"
|
|
msgstr "Test"
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr "Test: Sprawdzanie kompilatora..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr "Test: Sprawdzanie konfiguracji kompilatora..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr "Test: Sprawdzanie daty kompilatora..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr "Test: Kompilacja pustego pliku..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestrtlunits
|
|
msgid "Test: Checking RTL units ..."
|
|
msgstr "Test: Sprawdzanie moduły RTL ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr "Test: Kompilacja pustego pliku"
|
|
|
|
#: lazarusidestrconsts.dlgccousingconfigfile
|
|
#, object-pascal-format
|
|
msgid "using config file %s"
|
|
msgstr "używa plik konfiguracyjny %s"
|
|
|
|
#: lazarusidestrconsts.dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "W kolejności klas"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Na końcu"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "małymi literami"
|
|
|
|
#: lazarusidestrconsts.dlgcdtpreview
|
|
msgid "Preview (max line length = 1)"
|
|
msgstr "Podgląd (maks. długość wiersza = 1)"
|
|
|
|
#: lazarusidestrconsts.dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "Przedrostek odczytu"
|
|
|
|
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "Przyrostek \"zachowany\""
|
|
|
|
#: lazarusidestrconsts.dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "WIELKIMI LITERAMI"
|
|
|
|
#: lazarusidestrconsts.dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Przedrostek zmiennej"
|
|
|
|
#: lazarusidestrconsts.dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "Przedrostek zapisu"
|
|
|
|
#: lazarusidestrconsts.dlgcharcasefileact
|
|
msgid "Save As - auto rename Pascal files lower case"
|
|
msgstr "Zapisz jako - automatyczna zmiana nazwy pliku Pascala na małe litery"
|
|
|
|
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
|
msgid "Check and Auto Save Files"
|
|
msgstr "Sprawdzaj i automatycznie zapisuj pliki"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
|
msgid "Check packages on form create"
|
|
msgstr "Sprawdź pakiety przy tworzeniu formularza"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
|
msgid "The form may require a package to work. Install such a package automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Wybierz szablon źródła (*.dci)"
|
|
|
|
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Pokaż przyciski zamykania w zakładkach"
|
|
|
|
#: lazarusidestrconsts.dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Schemat kolorów"
|
|
|
|
#: lazarusidestrconsts.dlgcmacro
|
|
msgid "C style macros (global)"
|
|
msgstr "Makra w stylu C (globalne)"
|
|
|
|
#: lazarusidestrconsts.dlgcoansistr
|
|
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Używaj łańcuchów typu AnsiString"
|
|
|
|
#: lazarusidestrconsts.dlgcoasmstyle
|
|
msgid "Assembler style"
|
|
msgstr "Styl asemblera"
|
|
|
|
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
|
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
|
msgid "Messages"
|
|
msgstr "Komunikaty"
|
|
|
|
#: lazarusidestrconsts.dlgcochecksandassertion
|
|
msgid "Checks and assertion"
|
|
msgstr "Testy i asercje"
|
|
|
|
#: lazarusidestrconsts.dlgcocompilercommands
|
|
msgid "Compiler Commands"
|
|
msgstr "Komendy kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgcocops
|
|
msgid "C style operators (*=, +=, /= and -=)"
|
|
msgstr "Operatory w stylu języka C ( +=, -=, *= i /= )"
|
|
|
|
#: lazarusidestrconsts.dlgcocreatemakefile
|
|
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Utwórz Makefile"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugging
|
|
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
|
msgid "Debugging"
|
|
msgstr "Odpluskwianie"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Dodatkowe ścieżki dla odpluskiwacza:"
|
|
|
|
#: lazarusidestrconsts.dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Tworzenie źródła"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenableboth
|
|
msgid "Both"
|
|
msgstr "Oba"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablefold
|
|
msgid "Fold"
|
|
msgstr "Zwiń"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablehide
|
|
msgid "Hide"
|
|
msgstr "Ukryj"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
|
msgid "Reverse fold-order in Popup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcogdb
|
|
msgid "Generate info for the debugger (slower / increases exe-size)"
|
|
msgstr "Twórz informację odpluskwiacza dla GDB (zwalnia kompilację / zwiększa plik wykonywalny)"
|
|
|
|
#: lazarusidestrconsts.dlgcoheaptrc
|
|
msgid "Use Heaptrc unit (check for mem-leaks)"
|
|
msgstr "Użyj modułu Heaptrc (zaznacz przy wyciekach pamięci)"
|
|
|
|
#: lazarusidestrconsts.dlgcoincfiles
|
|
msgid "Include files (-Fi):"
|
|
msgstr "Katalogi dołączanych plików (-Fi):"
|
|
|
|
#: lazarusidestrconsts.dlgcoinfoforgdb
|
|
msgid "Debugger info"
|
|
msgstr "Informacja odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Biblioteki (-Fl)"
|
|
|
|
#: lazarusidestrconsts.dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Łączenie"
|
|
|
|
#: lazarusidestrconsts.dlgcoloadsavehint
|
|
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
|
|
msgid "Compiler options can be saved to an XML file."
|
|
msgstr "Opcje kompilatora można zapisać w pliku XML"
|
|
|
|
#: lazarusidestrconsts.dlgcolorlink
|
|
msgid "(Edit Color)"
|
|
msgstr "(Edytuj kolor)"
|
|
|
|
#: lazarusidestrconsts.dlgcolornotmodified
|
|
msgid "Not modified"
|
|
msgstr "Niezmodyfikowany"
|
|
|
|
#: lazarusidestrconsts.dlgcolors
|
|
msgctxt "lazarusidestrconsts.dlgcolors"
|
|
msgid "Colors"
|
|
msgstr "Kolory"
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Parametry linii poleceń (bez nazwy pliku)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
|
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
|
msgid "Limit indent to"
|
|
msgstr "Ogranicz wcięcia do"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinue
|
|
#, fuzzy
|
|
msgid "Prefix comments on linebreak"
|
|
msgstr "Przedrostek odczytu"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematch
|
|
#, fuzzy
|
|
msgid "Match current line"
|
|
msgstr "Tylko cały wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
|
msgid "Match text including \"*\" of token \"(*\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
|
msgid "Match whole line"
|
|
msgstr "Tylko cały wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
|
#, object-pascal-format
|
|
msgid "Match text after token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
|
#, object-pascal-format
|
|
msgid "Match text including token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
|
#, fuzzy
|
|
msgid "Prefix new line"
|
|
msgstr "Przedrostek zmiennej"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
|
msgid "Align Prefix at indent of previous line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
|
msgid "Align Prefix below start of comment on first comment line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
|
#, fuzzy
|
|
msgid "Do not indent prefix"
|
|
msgstr "Przedrostek odczytu"
|
|
|
|
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
|
msgid "Comments and Strings"
|
|
msgstr "Komentarze i łańcuchy znaków"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
|
msgid "Extend if matched or not matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
|
msgid "Extend if matched or not matched (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
|
msgid "Extend if matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
|
msgid "Extend if matched and caret in the middle of text (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilationandlinking
|
|
msgid "Compilation and Linking"
|
|
msgstr "Kompilacja i łączenie"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessage
|
|
msgid "Compiler messages"
|
|
msgstr "Komunikaty kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessages
|
|
msgid "Compiler messages language file (*.msg)"
|
|
msgstr "Plik tłumaczeń komunikatów kompilatora (*.msg)"
|
|
|
|
#: lazarusidestrconsts.dlgcompileroptions
|
|
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
|
msgid "Compiler Options"
|
|
msgstr "Opcje kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Uzupełniaj właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
|
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigandtarget
|
|
msgid "Config and Target"
|
|
msgstr "Konfiguracja i platforma docelowa"
|
|
|
|
#: lazarusidestrconsts.dlgconfigfiles
|
|
msgid "Config files"
|
|
msgstr "Pliki konfiguracyjne"
|
|
|
|
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
|
msgid "Other debugging info"
|
|
msgstr "Pozostałe informacje odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Przepełnienie"
|
|
|
|
#: lazarusidestrconsts.dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Analiza"
|
|
|
|
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
|
msgid "Copy/Paste with fold info"
|
|
msgstr "Kopiuj/Wklej z informacją zwinięcia"
|
|
|
|
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
|
msgid "Copy current word when no selection exists"
|
|
msgstr "Kopiuj bieżące słowo gdy nie ma zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.dlgcorange
|
|
msgctxt "lazarusidestrconsts.dlgcorange"
|
|
msgid "Range"
|
|
msgstr "Zakres"
|
|
|
|
#: lazarusidestrconsts.dlgcorelocatable
|
|
msgid "Relocatable"
|
|
msgstr "Relokowalny"
|
|
|
|
#: lazarusidestrconsts.dlgcosetasdefault
|
|
msgid "Set compiler options as default"
|
|
msgstr "Ustaw jako domyślne opcje kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgcoshowoptions
|
|
msgid "&Show Options"
|
|
msgstr "Pokaż opcje"
|
|
|
|
#: lazarusidestrconsts.dlgcosmartlinkable
|
|
msgid "Smart linkable"
|
|
msgstr "Sprytne łączenie"
|
|
|
|
#: lazarusidestrconsts.dlgcosources
|
|
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Inne źródła (pliki .pp/.pas, używane tylko przez IDE, nie przez kompilator)"
|
|
|
|
#: lazarusidestrconsts.dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Stos"
|
|
|
|
#: lazarusidestrconsts.dlgcostrip
|
|
msgid "Strip symbols from executable"
|
|
msgstr "Wyczyść z symboli plik wykonywalny"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltype
|
|
msgid "Type of debug info"
|
|
msgstr "Format kodu odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypeauto
|
|
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
|
msgid "Automatic"
|
|
msgstr "Automatycznie"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
|
msgid "Dwarf 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
|
#, fuzzy
|
|
#| msgid "Dwarf with sets"
|
|
msgid "Dwarf 2 with sets"
|
|
msgstr "ustawia IncPath na %s"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
|
msgid "Dwarf 3 (beta)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypestabs
|
|
msgid "Stabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcotrashvariables
|
|
msgid "Trash variables"
|
|
msgstr "Śmieci w zmiennych"
|
|
|
|
#: lazarusidestrconsts.dlgcounitstyle
|
|
msgid "Unit style"
|
|
msgstr "Rodzaj modułu"
|
|
|
|
#: lazarusidestrconsts.dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Generuj kod dla valgrind"
|
|
|
|
#: lazarusidestrconsts.dlgcoverbosity
|
|
msgid "Verbosity"
|
|
msgstr "Gadatliwość"
|
|
|
|
#: lazarusidestrconsts.dlgcppinline
|
|
msgid "C++ styled INLINE"
|
|
msgstr "INLINE w stylu C++"
|
|
|
|
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
|
|
msgid "Create new Run Parameters settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcurlycommenttab
|
|
msgid "Curly { }"
|
|
msgstr "Klamry { }"
|
|
|
|
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
|
msgid "Currently respected by messages window, jump history and search results."
|
|
msgstr "Aktualnie działa tylko w oknie komunikatów, historii skoków oraz wynikach wyszukiwania."
|
|
|
|
#: lazarusidestrconsts.dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Kursor poza końcem linii"
|
|
|
|
#: lazarusidestrconsts.dlgcursormoveclearsselection
|
|
msgid "Caret left/right clears selection (no move)"
|
|
msgstr "Kursor w lewo/prawo usuwa zaznaczenie (bez przesunięcia)"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipsselection
|
|
msgid "Caret skips selection"
|
|
msgstr "Kursor przeskakuje zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipstab
|
|
msgid "Caret skips tabs"
|
|
msgstr "Kursor przeskakuje tabulację"
|
|
|
|
#: lazarusidestrconsts.dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Inne rozszerzenie (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts.dlgdebugdesktop
|
|
msgid "debug"
|
|
msgstr "odpluskwianie"
|
|
|
|
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr "Edytor ścieżki"
|
|
|
|
#: lazarusidestrconsts.dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Rodzaj i ścieżka do odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Domyślna czcionka edytora"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulttabfont
|
|
msgid "Default tab font"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdefvaluecolor
|
|
msgid "Default Value"
|
|
msgstr "Wartość domyślna"
|
|
|
|
#: lazarusidestrconsts.dlgdeletemode
|
|
msgid "Delete mode"
|
|
msgstr "Usuń tryb"
|
|
|
|
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
|
|
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
|
|
msgid "Delete"
|
|
msgstr "Usuń"
|
|
|
|
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
|
|
msgid "Delete selected desktop"
|
|
msgstr "Usuń wybrany pulpit"
|
|
|
|
#: lazarusidestrconsts.dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Usuń szablon "
|
|
|
|
#: lazarusidestrconsts.dlgdesktopbuttons
|
|
msgid "Buttons - "
|
|
msgstr "Przyciski - "
|
|
|
|
#: lazarusidestrconsts.dlgdesktophints
|
|
msgid "Hints"
|
|
msgstr "Podpowiedzi"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopmenus
|
|
msgid "Menus - "
|
|
msgstr "Menu - "
|
|
|
|
#: lazarusidestrconsts.dlgdesktopname
|
|
msgid "Desktop name"
|
|
msgstr "Nazwa pulpitu"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsexported
|
|
#, object-pascal-format
|
|
msgid "%d desktop(s) successfully exported to \"%s\""
|
|
msgstr "%d pulpit(y/ów) wyeksportowano z powodzeniem do \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsimported
|
|
#, object-pascal-format
|
|
msgid "%d desktop(s) successfully imported from \"%s\""
|
|
msgstr "%d pulpit(y/ów) zaimportowano z powodzeniem z \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
|
|
#, fuzzy
|
|
msgid "Different values background"
|
|
msgstr "Wartości"
|
|
|
|
#: lazarusidestrconsts.dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Kierunek"
|
|
|
|
#: lazarusidestrconsts.dlgdisableantialiasing
|
|
msgid "Disable anti-aliasing"
|
|
msgstr "Wyłącz wygładzanie"
|
|
|
|
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
|
msgid "Distance between grid points is the smallest step when moving a control."
|
|
msgstr "Odległość pomiędzy punktami siatki jest najmniejszym krokiem przesunięcia kontrolki."
|
|
|
|
#: lazarusidestrconsts.dlgdividercolordefault
|
|
msgid "Use right margin color"
|
|
msgstr "Użyj koloru prawego marginesu"
|
|
|
|
#: lazarusidestrconsts.dlgdividerdrawdepth
|
|
msgid "Draw divider level"
|
|
msgstr "Rysuj linie poziomu"
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolor
|
|
msgid "Nested line color"
|
|
msgstr "Kolor zagnieżdżonego wiersza"
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolor
|
|
msgid "Line color"
|
|
msgstr "Kolor wiersza"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasbeginendname
|
|
#, fuzzy
|
|
msgid "Begin/End"
|
|
msgstr "Begin/End (zagnieżdżone)"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasprocedurename
|
|
msgid "Procedure/Function"
|
|
msgstr "Procedura/Funkcja"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
|
msgid "Class/Struct"
|
|
msgstr "Klasa/Struktura"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
|
msgid "Class/Struct (local)"
|
|
msgstr "Klasa/Struktura (lokalnie)"
|
|
|
|
#: lazarusidestrconsts.dlgdivpastryname
|
|
msgid "Try/Except"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
|
msgid "Unit sections"
|
|
msgstr "Sekcje modułu"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasusesname
|
|
msgid "Uses clause"
|
|
msgstr "Klauzule Uses"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
|
#, fuzzy
|
|
msgid "Var/Type"
|
|
msgstr "Var/Type (lokalne)"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
|
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (lokalne)"
|
|
|
|
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
|
msgid "Draw the component's name below it."
|
|
msgstr "Pisz nazwę komponentu poniżej."
|
|
|
|
#: lazarusidestrconsts.dlgedback
|
|
msgid "Back"
|
|
msgstr "W tył"
|
|
|
|
#: lazarusidestrconsts.dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Pogrubiony"
|
|
|
|
#: lazarusidestrconsts.dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Podkatalog"
|
|
|
|
#: lazarusidestrconsts.dlgedcodetempl
|
|
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
|
msgid "Code Templates"
|
|
msgstr "Szablony źródeł"
|
|
|
|
#: lazarusidestrconsts.dlgedcompleteblocks
|
|
msgid "Add close statement for Pascal blocks"
|
|
msgstr "Domykaj bloki Pascala"
|
|
|
|
#: lazarusidestrconsts.dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Inne rozszerzenie"
|
|
|
|
#: lazarusidestrconsts.dlgeddelayinsec
|
|
#, object-pascal-format
|
|
msgid "(%s sec delay)"
|
|
msgstr "(%s sek. opóźnienia)"
|
|
|
|
#: lazarusidestrconsts.dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Ekran"
|
|
|
|
#: lazarusidestrconsts.dlgedfiles
|
|
msgid "Editor Files"
|
|
msgstr "Pliki edytora"
|
|
|
|
#: lazarusidestrconsts.dlgedidcomlet
|
|
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
|
msgid "Identifier completion"
|
|
msgstr "Uzupełnianie identyfikatorów"
|
|
|
|
#: lazarusidestrconsts.dlgedinvert
|
|
msgid "Invert"
|
|
msgstr "Odwróć przyporządkowanie"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
|
msgid "Ignore Locks, use longest unused editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
|
#, fuzzy
|
|
msgid "Ignore Locks, if editor is current"
|
|
msgstr "Słowo przy kursorze"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
|
msgid "Ignore Locks, if editor in current window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
|
#, fuzzy
|
|
msgid "Locked, if text in view"
|
|
msgstr "Zablokowane"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
|
msgid "Unlocked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
|
msgid "Unlocked, if text in centered view"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
|
msgid "New tab, existing or new window"
|
|
msgstr "Nowa zakładka w bieżącym oknie lub nowym"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
|
msgid "New tab in new window"
|
|
msgstr "Nowa zakładka w nowym oknie"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
|
msgid "New tab in existing window"
|
|
msgstr "Nowa zakładka w bieżącym oknie"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
|
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
|
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
|
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
|
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
|
msgid "This option will use any not locked Editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
|
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
|
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedital
|
|
msgid "Italic"
|
|
msgstr "Pochylony"
|
|
|
|
#: lazarusidestrconsts.dlgeditexportbackcolor
|
|
msgid "Use Background color in HTML export"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditorfontsize
|
|
msgid "Editor font size"
|
|
msgstr "Rozmiar czcionki"
|
|
|
|
#: lazarusidestrconsts.dlgeditoroptions
|
|
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
|
msgid "Editor options"
|
|
msgstr "Opcje edytora"
|
|
|
|
#: lazarusidestrconsts.dlgeditschemdefaults
|
|
#, fuzzy
|
|
msgid "Scheme globals"
|
|
msgstr "Schemat kolorów"
|
|
|
|
#: lazarusidestrconsts.dlgedmisc
|
|
msgctxt "lazarusidestrconsts.dlgedmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Pozostałe"
|
|
|
|
#: lazarusidestrconsts.dlgedoff
|
|
#, fuzzy
|
|
msgid "Off"
|
|
msgstr "--gdk-no-debug flags Wyłącz specificzne dla GDK komunikaty śledzenia/odpluskwiania."
|
|
|
|
#: lazarusidestrconsts.dlgedon
|
|
msgid "On"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedtabindent
|
|
msgid "Tab and Indent"
|
|
msgstr "Tabulacje i wcięcia"
|
|
|
|
#: lazarusidestrconsts.dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Podkreślony"
|
|
|
|
#: lazarusidestrconsts.dlgelementattributes
|
|
msgid "Element Attributes"
|
|
msgstr "Atrybuty elementu"
|
|
|
|
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
|
msgid "End key jumps to nearest end"
|
|
msgstr "Klawisz End przenosi do najbliższego końca"
|
|
|
|
#: lazarusidestrconsts.dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Zapytaj"
|
|
|
|
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Informacja: plikami projektu są wszystkie pliki w jego katalogu"
|
|
|
|
#: lazarusidestrconsts.dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Kopia zapasowa"
|
|
|
|
#: lazarusidestrconsts.dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "Pliki"
|
|
|
|
#: lazarusidestrconsts.dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Siatka"
|
|
|
|
#: lazarusidestrconsts.dlgenvidestartup
|
|
msgid "IDE Startup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguage
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
|
msgid "Language"
|
|
msgstr "Język"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguagehint
|
|
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
|
|
msgstr "Język wszystkich napisów IDE. Uruchom ponownie IDE aby zobaczyć zmianę."
|
|
|
|
#: lazarusidestrconsts.dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Linie naprowadzające"
|
|
|
|
#: lazarusidestrconsts.dlgenvmisc
|
|
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Pozostałe"
|
|
|
|
#: lazarusidestrconsts.dlgenvnone
|
|
msgctxt "lazarusidestrconsts.dlgenvnone"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.dlgenvotherfiles
|
|
msgid "Other Files"
|
|
msgstr "Inne pliki"
|
|
|
|
#: lazarusidestrconsts.dlgenvproject
|
|
msgid "Tabs for project"
|
|
msgstr "Zakładki należące do projektu"
|
|
|
|
#: lazarusidestrconsts.dlgenvtype
|
|
msgctxt "lazarusidestrconsts.dlgenvtype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
|
|
msgid "Focus messages at compilation"
|
|
msgstr "Ustaw aktywne okno komunikatów podczas kompilacji"
|
|
|
|
#: lazarusidestrconsts.dlgextracharspacing
|
|
msgctxt "lazarusidestrconsts.dlgextracharspacing"
|
|
msgid "Extra character spacing"
|
|
msgstr "Dodatkowy odstęp między znakami"
|
|
|
|
#: lazarusidestrconsts.dlgextralinespacing
|
|
msgctxt "lazarusidestrconsts.dlgextralinespacing"
|
|
msgid "Extra line spacing"
|
|
msgstr "Odstęp między wierszami"
|
|
|
|
#: lazarusidestrconsts.dlgextsymb
|
|
#, fuzzy
|
|
#| msgid "Use external gdb debug symbols file"
|
|
msgctxt "lazarusidestrconsts.dlgextsymb"
|
|
msgid "Use external debug symbols file"
|
|
msgstr "Użyj zewnętrznego pliku symboli odpluskiwacza"
|
|
|
|
#: lazarusidestrconsts.dlgfileassociationinos
|
|
msgid "Opening Files from OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Rozszerzenia plików"
|
|
|
|
#: lazarusidestrconsts.dlgfiles
|
|
#, object-pascal-format
|
|
msgid "%s files"
|
|
msgstr "%s pliki(ów)"
|
|
|
|
#: lazarusidestrconsts.dlgfilterall
|
|
msgctxt "lazarusidestrconsts.dlgfilterall"
|
|
msgid "All files"
|
|
msgstr "Wszystkie pliki"
|
|
|
|
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
|
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
|
msgid "CodeTools template file"
|
|
msgstr "Plik szablonu CodeTools"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdcifile
|
|
msgid "DCI file"
|
|
msgstr "Plik DCI"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiform
|
|
msgid "Delphi form"
|
|
msgstr "Formularz Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphipackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
|
msgid "Delphi package"
|
|
msgstr "Pakiet Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiproject
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
|
msgid "Delphi project"
|
|
msgstr "Projekt Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
|
msgid "Delphi unit"
|
|
msgstr "Moduł Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterexecutable
|
|
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
|
msgid "Executable"
|
|
msgstr "Plik wykonywalny"
|
|
|
|
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
|
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
|
|
msgid "FPC message file"
|
|
msgstr "Plik z komunikatami FPC"
|
|
|
|
#: lazarusidestrconsts.dlgfilterhtml
|
|
msgid "HTML files"
|
|
msgstr "Pliki HTML"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
|
msgid "Bitmap images"
|
|
msgstr "Pliki bitmap"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespixmap
|
|
msgid "Pixmap images"
|
|
msgstr "Obrazy"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespng
|
|
msgid "PNG images"
|
|
msgstr "Obrazki PNG"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Ustawienia pulpitu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
|
|
msgid "Editor file types"
|
|
msgstr "Typy plików edytora"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
|
|
msgid "Lazarus file"
|
|
msgstr "Plik Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusform
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
|
|
msgid "Lazarus form"
|
|
msgstr "Formularze Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
|
|
msgid "Lazarus include file"
|
|
msgstr "Dołączane pliki Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
|
|
msgid "Lazarus other file"
|
|
msgstr "Inny plik Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
|
|
msgid "Lazarus package"
|
|
msgstr "Pakiet Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusproject
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
|
|
msgid "Lazarus project"
|
|
msgstr "Projekt Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
|
|
msgid "Lazarus project source"
|
|
msgstr "Źródło projektu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarussession
|
|
msgid "Lazarus session"
|
|
msgstr "Sesja Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
|
|
msgid "Lazarus unit"
|
|
msgstr "Moduł Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterpascalfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
|
|
msgid "Pascal file"
|
|
msgstr "Plik Pascala"
|
|
|
|
#: lazarusidestrconsts.dlgfilterprograms
|
|
msgctxt "lazarusidestrconsts.dlgfilterprograms"
|
|
msgid "Programs"
|
|
msgstr "Programy"
|
|
|
|
#: lazarusidestrconsts.dlgfilterxml
|
|
msgctxt "lazarusidestrconsts.dlgfilterxml"
|
|
msgid "XML files"
|
|
msgstr "Pliki XML"
|
|
|
|
#: lazarusidestrconsts.dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Wyszukaj tekst przy kursorze"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunk
|
|
msgid "Chunk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunksect
|
|
#, fuzzy
|
|
msgid "Chunk section"
|
|
msgstr "Sekcja modułu"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlasp
|
|
msgid "ASP"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
|
msgid "Comment"
|
|
msgstr "Komentarz"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
|
msgid "Node"
|
|
msgstr "Węzeł"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmitem
|
|
msgid "Item"
|
|
msgstr "Element"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmlist
|
|
msgid "List <>"
|
|
msgstr "Lista <>"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmobject
|
|
#, fuzzy
|
|
msgid "Object (inherited, inline)"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (lokalne)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasansicomment
|
|
msgid "Comment (* *)"
|
|
msgstr "Komentarz (* *)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasasm
|
|
#, fuzzy
|
|
msgid "Asm"
|
|
msgstr "Pliki asemblera 68HC11 (*.hc11,*.asm,*.asc)|*.HC11;*.ASM;*.ASC"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasbeginend
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasbeginend"
|
|
msgid "Begin/End (nested)"
|
|
msgstr "Begin/End (zagnieżdżone)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasborcomment
|
|
msgid "Comment { }"
|
|
msgstr "Komentarz { }"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpascase
|
|
#, fuzzy
|
|
msgid "Case"
|
|
msgstr "Zamień wielkość liter w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclass
|
|
msgid "Class/Object"
|
|
msgstr "Klasa/Obiekt"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclasssection
|
|
msgid "public/private"
|
|
msgstr "publiczne/prywatne"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasexcept
|
|
msgid "Except/Finally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasfordo
|
|
#, fuzzy
|
|
msgid "For/Do"
|
|
msgstr "nie dopuszczaj wielu instancji"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifdef
|
|
#, fuzzy
|
|
msgid "{$IfDef}"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifthen
|
|
#, fuzzy
|
|
msgid "If/Then/Else"
|
|
msgstr "else"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasnestedcomment"
|
|
msgid "Nested Comment"
|
|
msgstr "Zagnieżdżony komentarz"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocbeginend"
|
|
msgid "Begin/End (procedure)"
|
|
msgstr "Begin/End (procedura)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocedure
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedura"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprogram
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecord
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
|
msgid "Record"
|
|
msgstr "Nagraj"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrepeat
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Powtarzaj"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
|
msgid "Comment //"
|
|
msgstr "Komentarz //"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpastry
|
|
#, fuzzy
|
|
msgid "Try"
|
|
msgstr "Porada: Funkcja Make Resourcestring wymaga stałej łańcuchowej.%sWybierz wyrażenie i spróbuj ponownie."
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunit
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
|
msgid "Unit"
|
|
msgstr "Moduł"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunitsection
|
|
msgid "Unit section"
|
|
msgstr "Sekcja modułu"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuserregion
|
|
msgid "{%Region}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuses
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
|
msgid "Uses"
|
|
msgstr "Wstaw do sekcji Uses"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasvartype"
|
|
msgid "Var/Type (global)"
|
|
msgstr "Var/Type (globalne)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswhiledo
|
|
#, fuzzy
|
|
msgid "While/Do"
|
|
msgstr "nie zmieniaj"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswithdo
|
|
#, fuzzy
|
|
msgid "With/Do"
|
|
msgstr "nie dopuszczaj wielu instancji"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcdata
|
|
msgid "CData"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
|
msgid "Comment"
|
|
msgstr "Komentarz"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmldoctype
|
|
msgid "DocType"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
|
msgid "Node"
|
|
msgstr "Węzeł"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlprocess
|
|
msgid "Processing Instruction"
|
|
msgstr "Przetwarzanie instrukcji"
|
|
|
|
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
|
|
msgid "Force DPI scaling in design-time"
|
|
msgstr "Wymuś skalowanie DPI w trybie projektowania"
|
|
|
|
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
|
|
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
|
msgid "The running Lazarus instance cannot accept any files."
|
|
msgstr "Uruchomiona instancja Lazarusa nie akceptuje żadnych plików."
|
|
|
|
#: lazarusidestrconsts.dlgforecolor
|
|
msgid "Foreground"
|
|
msgstr "Kolor tekstu"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
|
|
msgid "Change Object Inspector contents on clicking form title bar"
|
|
msgstr "Zmień zawartość Inspektora obiektów po kliknięciu paska tytułowego formularza"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
|
|
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Zasady wstawiania procedur"
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Zachowaj kolejność procedur"
|
|
|
|
#: lazarusidestrconsts.dlgfpcexecutable
|
|
#, object-pascal-format
|
|
msgid "Compiler executable (e.g. %s)"
|
|
msgstr "Plik wykonywalny kompilatora (%s)"
|
|
|
|
#: lazarusidestrconsts.dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "Katalog źródeł FPC"
|
|
|
|
#: lazarusidestrconsts.dlgfppkgconfigurationfile
|
|
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgframecolor
|
|
#, fuzzy
|
|
#| msgid "Frame color"
|
|
msgid "Text-mark"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Edytor formularza"
|
|
|
|
#: lazarusidestrconsts.dlgfrombeginning
|
|
msgid "From b&eginning"
|
|
msgstr "Od &początku"
|
|
|
|
#: lazarusidestrconsts.dlgfromcursor
|
|
#, fuzzy
|
|
#| msgid "&From cursor"
|
|
msgid "From c&ursor"
|
|
msgstr "&Od kursora"
|
|
|
|
#: lazarusidestrconsts.dlgglobal
|
|
msgid "&Global"
|
|
msgstr "&Globalnie"
|
|
|
|
#: lazarusidestrconsts.dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Twórz kod dla gprof"
|
|
|
|
#: lazarusidestrconsts.dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Kolor paska ikon"
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsdocked
|
|
msgid "Grayed desktops are for docked environment."
|
|
msgstr "Pulpity wyświetlone jako szare przeznaczone są do środowiska z dokowaniem."
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
|
msgid "Grayed desktops are for undocked environment."
|
|
msgstr "Pulpity wyświetlone jako szare przeznaczone są do środowiska bez dokowania."
|
|
|
|
#: lazarusidestrconsts.dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Kolor siatki"
|
|
|
|
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
|
msgid "Grid consists of small dots which help aligning controls."
|
|
msgstr "Siatka małych punktów pomagająca w ustawianiu komponentów."
|
|
|
|
#: lazarusidestrconsts.dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Rozmiar siatki X"
|
|
|
|
#: lazarusidestrconsts.dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Odstępy poziome siatki"
|
|
|
|
#: lazarusidestrconsts.dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Rozmiar siatki Y"
|
|
|
|
#: lazarusidestrconsts.dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Odstępy pionowe siatki"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodeexplorer
|
|
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Przeglądarka źródeł"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodetools
|
|
#, fuzzy
|
|
msgid "Codetools"
|
|
msgstr "Wybierz plik z szablonami CodeTools"
|
|
|
|
#: lazarusidestrconsts.dlggroupdebugger
|
|
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Odpluskiwacz"
|
|
|
|
#: lazarusidestrconsts.dlggroupeditor
|
|
msgid "Editor"
|
|
msgstr "Edytor"
|
|
|
|
#: lazarusidestrconsts.dlggroupenvironment
|
|
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
|
msgid "Environment"
|
|
msgstr "Środowisko"
|
|
|
|
#: lazarusidestrconsts.dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr "Cofanie grupowe"
|
|
|
|
#: lazarusidestrconsts.dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Pokaż linie naprowadzające"
|
|
|
|
#: lazarusidestrconsts.dlgguidelineshint
|
|
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutter
|
|
msgctxt "lazarusidestrconsts.dlggutter"
|
|
msgid "Gutter"
|
|
msgstr "Margines ikon"
|
|
|
|
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
|
msgid "Collapsed"
|
|
msgstr "Zwinięte"
|
|
|
|
#: lazarusidestrconsts.dlgguttercolor
|
|
msgid "Gutter Color"
|
|
msgstr "Kolor marginesu ikon"
|
|
|
|
#: lazarusidestrconsts.dlggutteredgecolor
|
|
msgid "Gutter Edge Color"
|
|
msgstr "Kolor krawędzi marginesu ikon"
|
|
|
|
#: lazarusidestrconsts.dlggutterseparatorindex
|
|
msgid "Gutter separator index"
|
|
msgstr "Indeks separatora kolektora"
|
|
|
|
#: lazarusidestrconsts.dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Przewijaj pół strony"
|
|
|
|
#: lazarusidestrconsts.dlgheapandstacksize
|
|
msgid "Heap and stack sizes"
|
|
msgstr "Rozmiar sterty i stosu"
|
|
|
|
#: lazarusidestrconsts.dlgheapsize
|
|
msgid "Heap size"
|
|
msgstr "Rozmiar sterty"
|
|
|
|
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
|
msgid "Height of one property in the grid."
|
|
msgstr "Wysokość jednej właściwości w siatce."
|
|
|
|
#: lazarusidestrconsts.dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Wysokość:"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrun
|
|
msgid "Hide IDE windows on run"
|
|
msgstr "Ukryj okna IDE przy uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrunhint
|
|
msgid "Do not show the IDE at all while program is running."
|
|
msgstr "Nie pokazuj IDE gdy program jest uruchomiony."
|
|
|
|
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
|
msgid "Hide tab in single page windows"
|
|
msgstr "Ukryj zakładkę w pojedynczym oknie"
|
|
|
|
#: lazarusidestrconsts.dlghighlightcolor
|
|
msgid "Highlight Color"
|
|
msgstr "Kolor podświetlenia"
|
|
|
|
#: lazarusidestrconsts.dlghighlightfontcolor
|
|
msgid "Highlight Font Color"
|
|
msgstr "Kolor czcionki podświetlenia"
|
|
|
|
#: lazarusidestrconsts.dlghighlightleftofcursor
|
|
msgid "Left Of Caret"
|
|
msgstr "Po lewej od kursora"
|
|
|
|
#: lazarusidestrconsts.dlghighlightrightofcursor
|
|
msgid "Right Of Caret"
|
|
msgstr "Po prawej od kursora"
|
|
|
|
#: lazarusidestrconsts.dlghintsparametersendernotused
|
|
msgid "Show hints for parameter \"Sender\" not used"
|
|
msgstr "Wskazówka - nieużywany parametr \"Sender\""
|
|
|
|
#: lazarusidestrconsts.dlghintsunused
|
|
msgid "Show hints for unused units in main"
|
|
msgstr "Wskazówka - nieużywany moduł w gł. źródle"
|
|
|
|
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Klawisz Home przenosi do najbliższego początku"
|
|
|
|
#: lazarusidestrconsts.dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Główna aplikacja"
|
|
|
|
#: lazarusidestrconsts.dlgidentifiercompletion
|
|
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
|
msgid "Identifier Completion"
|
|
msgstr "Uzupełniaj identyfikatory"
|
|
|
|
#: lazarusidestrconsts.dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Identyfikatorów"
|
|
|
|
#: lazarusidestrconsts.dlgideoptions
|
|
msgid "IDE Options"
|
|
msgstr "Opcje IDE"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockactive
|
|
#, fuzzy
|
|
msgid "Active $IFDEF code"
|
|
msgstr "Aktywny"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockinactive
|
|
#, fuzzy
|
|
msgid "Inactive $IFDEF code"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
|
msgid "Included mixed state $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeactive
|
|
#, fuzzy
|
|
msgid "Active $IFDEF node"
|
|
msgstr "Aktywny"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeinactive
|
|
#, fuzzy
|
|
msgid "Inactive $IFDEF node"
|
|
msgstr "Węzeł"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
|
msgid "Included mixed state $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgimportdesktopexists
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "A desktop with the same name already exists.\n"
|
|
#| "Please confirm the desktop name:\n"
|
|
msgid ""
|
|
"A desktop with the same name already exists.\n"
|
|
"Please confirm the desktop name:"
|
|
msgstr ""
|
|
"Pulpit o takiej samej nazwie już istnieje.\n"
|
|
"Proszę potwierdzić nazwę pulpitu:\n"
|
|
|
|
#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
|
|
msgid "Include code templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
|
|
msgid "Include identifiers containing prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
|
|
msgid "Include all keywords and operators"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Dołącz zmienne systemowe"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl
|
|
msgid "Include words"
|
|
msgstr "Włączaj słowa"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
|
|
msgid "don't include"
|
|
msgstr "nie włączaj"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
|
|
msgid "from all units"
|
|
msgstr "z wszystkich modułów"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
|
|
msgid "from current unit"
|
|
msgstr "od bieżącego modułu"
|
|
|
|
#: lazarusidestrconsts.dlgindentsindentgroupoptions
|
|
msgid "Indent"
|
|
msgstr "Wcięcia"
|
|
|
|
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
|
msgid "Tabs"
|
|
msgstr "Tabulatory"
|
|
|
|
#: lazarusidestrconsts.dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Przed metodami"
|
|
|
|
#: lazarusidestrconsts.dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Konstruktor musi nazywać się 'init' (destruktor - 'done')"
|
|
|
|
#: lazarusidestrconsts.dlginsertclassparts
|
|
msgid "Insert class parts"
|
|
msgstr "Wstawianie części klas"
|
|
|
|
#: lazarusidestrconsts.dlginsertimplementation
|
|
#, fuzzy
|
|
msgid "Implementation"
|
|
msgstr "brakuje elementu implementacji"
|
|
|
|
#: lazarusidestrconsts.dlginsertinterface
|
|
msgid "Interface"
|
|
msgstr "Interfejs"
|
|
|
|
#: lazarusidestrconsts.dlginsertmethods
|
|
msgid "Insert method implementations"
|
|
msgstr "Wstaw implementacje metod"
|
|
|
|
#: lazarusidestrconsts.dlginsertsection
|
|
msgid "Insert into Uses section of"
|
|
msgstr "Dodaj moduł do sekcji Uses w"
|
|
|
|
#: lazarusidestrconsts.dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Wstaw odstęp po"
|
|
|
|
#: lazarusidestrconsts.dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Wstaw odstęp przed"
|
|
|
|
#: lazarusidestrconsts.dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Odstęp w sekundach"
|
|
|
|
#: lazarusidestrconsts.dlgjumpcodeblockpos
|
|
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Skoki (np. skoki do metod)"
|
|
|
|
#: lazarusidestrconsts.dlgjumpsinglelinepos
|
|
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgjumptomethodbody
|
|
msgid "Jump directly to method body"
|
|
msgstr "Skocz bezpośrednio do ciała metody"
|
|
|
|
#: lazarusidestrconsts.dlgkeepcursorx
|
|
msgid "Keep caret X position when navigating up/down"
|
|
msgstr "Zachowaj pozycję X kursora przy przesuwaniu w górę/dół"
|
|
|
|
#: lazarusidestrconsts.dlgkeylink
|
|
msgid "(Edit Key)"
|
|
msgstr "(ustawianie klawisza)"
|
|
|
|
#: lazarusidestrconsts.dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Klawisze skrótów"
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Błędne klawisze skrótu"
|
|
|
|
#: lazarusidestrconsts.dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Słów kluczowych"
|
|
|
|
#: lazarusidestrconsts.dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "Pozwalaj na instrukcje LABEL i GOTO"
|
|
|
|
#: lazarusidestrconsts.dlglang
|
|
msgctxt "lazarusidestrconsts.dlglang"
|
|
msgid "Language"
|
|
msgstr "Język"
|
|
|
|
#: lazarusidestrconsts.dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Na końcu (np. na końcu źródła)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Katalog Lazarusa (domyślny dla wszystkich projektów)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusinstances
|
|
msgid "Lazarus instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglefttopclr
|
|
msgid "Guide lines Left,Top"
|
|
msgstr "Prowadnica lewa i górna"
|
|
|
|
#: lazarusidestrconsts.dlglevel1opt
|
|
#, fuzzy
|
|
#| msgid "1 (quick, debugger friendly)"
|
|
msgid "1 (quick, debugger friendly with small limitations)"
|
|
msgstr "1 (szybki i przyjazny dla debugowania)"
|
|
|
|
#: lazarusidestrconsts.dlglevel2opt
|
|
msgid "2 (-O1 + quick optimizations)"
|
|
msgstr "2 (-O1 + szybkie optymalizacje)"
|
|
|
|
#: lazarusidestrconsts.dlglevel3opt
|
|
msgid "3 (-O2 + slow optimizations)"
|
|
msgstr "3 (-O2 + wolne optymalizacje)"
|
|
|
|
#: lazarusidestrconsts.dlglevel4opt
|
|
msgid "4 (-O3 + aggressive optimizations, beware)"
|
|
msgstr "4 (-O3 + agresywne optymalizacje, ostrożnie)"
|
|
|
|
#: lazarusidestrconsts.dlglevelnoneopt
|
|
#, fuzzy
|
|
#| msgid "0 (no optimization)"
|
|
msgid "0 (no optimization, for debugging)"
|
|
msgstr "0 (bez dodatkowej optymalizacji)"
|
|
|
|
#: lazarusidestrconsts.dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Dzielenie linii"
|
|
|
|
#: lazarusidestrconsts.dlglinksmart
|
|
msgid "Link smart"
|
|
msgstr "Łącz sprytnie"
|
|
|
|
#: lazarusidestrconsts.dlglnumsbct
|
|
msgid "Display line numbers in run-time error backtraces"
|
|
msgstr "Wyświetlaj numery linii w zrzucie błędu uruchomieniowego"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewforms
|
|
msgid "View Project Forms"
|
|
msgstr "Pokaż formularze wchodzące w skład projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewframes
|
|
#, fuzzy
|
|
msgid "View Project Frames"
|
|
msgstr "Pokaż źródło projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewunits
|
|
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
|
msgid "View Project Units"
|
|
msgstr "Pokaż moduły wchodzące w skład projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmakeexecutable
|
|
msgid "\"Make\" executable"
|
|
msgstr "Plik wykonywalny \"make\""
|
|
|
|
#: lazarusidestrconsts.dlgmanagedesktops
|
|
msgid "Manage desktops"
|
|
msgstr "Zarządzaj pulpitami"
|
|
|
|
#: lazarusidestrconsts.dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Margines i pasek ikon"
|
|
|
|
#: lazarusidestrconsts.dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Kolor zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupfoldcolor
|
|
#, fuzzy
|
|
msgid "Vertical-mark"
|
|
msgstr "&Pionowo"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupgroup
|
|
#, fuzzy
|
|
#| msgid "Word under Caret Highlight"
|
|
msgid "Highlight all occurrences of Word under Caret"
|
|
msgstr "Podświetlenie słowa przy kursorze"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutline
|
|
#, fuzzy
|
|
msgid "Outline (global)"
|
|
msgstr "&Globalnie"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
|
|
msgid "Warning: There are no colors configured for the selected language"
|
|
msgstr "Uwaga: Nie ma konfiguracji kolorów dla wybranego języka"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefined
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
|
msgid "User defined markup"
|
|
msgstr "Znaczniki użytkownika"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
|
msgid "Delete"
|
|
msgstr "Usuń"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
|
#, object-pascal-format
|
|
msgid "Delete list \"%s\"?"
|
|
msgstr "Skasować listę \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
|
#, fuzzy
|
|
msgid "Add Word or Term"
|
|
msgstr "Word"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
|
#, fuzzy
|
|
msgid "Remove Word or Term"
|
|
msgstr "Word"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
|
#, fuzzy
|
|
msgid "Toggle Word or Term"
|
|
msgstr "Word"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
|
#, fuzzy
|
|
msgid "Duplicate Term"
|
|
msgstr "wyrażenie nie jest typu prostego"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
|
#, object-pascal-format
|
|
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
|
#, fuzzy
|
|
msgid "Add/Remove in all editors"
|
|
msgstr "Usuń wszystkie nieprawidłowe właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
|
msgid "Delete list"
|
|
msgstr "Skasuj listę"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
|
msgid "Name"
|
|
msgstr "Nazwa"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
|
msgid "Add list"
|
|
msgstr "Dodaj listę"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
|
msgid "Case sensitive"
|
|
msgstr "Uwzględnij wielkość liter"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
|
#, fuzzy
|
|
msgid "Set bound at term end"
|
|
msgstr "Ustaw koniec bloku"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
|
msgid "Set bound at term start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
|
msgid "Ignore bounds for terms longer than"
|
|
msgstr "Ignoruj granice dla określeń dłuższych niż"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
|
msgid "selection"
|
|
msgstr "zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
|
msgid "current word"
|
|
msgstr "bieżące słowo"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
|
#, fuzzy
|
|
msgid "Settings for terms added by key"
|
|
msgstr "Ustawienia klawiszy"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
|
msgid "Smart match selection bounds"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
|
msgid "New list"
|
|
msgstr "Nowa lista"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
|
msgid "No lists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
|
msgid "Select ..."
|
|
msgstr "Wybierz..."
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
|
msgid "Key Settings"
|
|
msgstr "Ustawienia klawiszy"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
|
msgid "Main settings"
|
|
msgstr "Główne ustawienia"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordbracket
|
|
msgid "Keyword brackets on caret (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
|
#, fuzzy
|
|
#| msgid "Match word boundaries for words up to this length:"
|
|
msgid "Match whole words, if length is less or equal to:"
|
|
msgstr "Dopasowywuj granice słowa dla słów od długości:"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
|
msgid "Ignore keywords"
|
|
msgstr "Ignoruj słowa kluczowe"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
|
msgid "Disable timer for markup current word"
|
|
msgstr "Wyłącz licznik czasu dla zaznaczenia bieżącego słowa"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordtrim
|
|
msgid "Trim spaces (when highlighting current selection)"
|
|
msgstr "Spacje końcowe (gdy podświetlone bieżące zaznaczenie)"
|
|
|
|
#: lazarusidestrconsts.dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Maksymalny licznik"
|
|
|
|
#: lazarusidestrconsts.dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Maks. długość wiersza:"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Liczba niedawno otwartych plików"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecenthint
|
|
msgid "Value 0 means unlimited."
|
|
msgstr "Wartość 0 oznacza brak ograniczeń."
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Liczba niedawno otwartych projektów"
|
|
|
|
#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
|
|
msgid "Middle-click-modifier to close all other tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
|
|
msgid "Middle-click-modifier to close tabs on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Mieszanie metod i właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgmode
|
|
msgid "Mode"
|
|
msgstr "Tryb"
|
|
|
|
#: lazarusidestrconsts.dlgmouseaction
|
|
msgid "Mouse Action"
|
|
msgstr "Działanie myszy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
|
msgid "Single"
|
|
msgstr "Pojedyncze"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
|
msgid "Double"
|
|
msgstr "Podwójne"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn3
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
|
msgid "Triple"
|
|
msgstr "Potrójne"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn4
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
|
msgid "Quad"
|
|
msgstr "Poczwórne"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnany
|
|
msgid "Any"
|
|
msgstr "Dowolny"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
|
msgid "Extra 1"
|
|
msgstr "Lewy 1"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
|
msgid "Extra 2"
|
|
msgstr "Lewy 2"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
|
msgid "Left"
|
|
msgstr "Lewy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
|
msgid "Middle"
|
|
msgstr "Środkowy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
|
#, fuzzy
|
|
msgid "Make Fallback"
|
|
msgstr "Nie znaleziono \"make\""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnright
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
|
msgid "Right"
|
|
msgstr "Prawy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
|
msgid "Wheel down"
|
|
msgstr "Kółko w dół"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
|
|
msgid "Wheel left"
|
|
msgstr "Kółko w lewo"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelright
|
|
msgid "Wheel right"
|
|
msgstr "Kółko w prawo"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
|
msgid "Wheel up"
|
|
msgstr "Kółko w górę"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcapture
|
|
msgid "Capture"
|
|
msgstr "Przechwyć"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
|
#, fuzzy
|
|
msgid "Move Caret (extra)"
|
|
msgstr "Kursor"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
|
#, fuzzy
|
|
msgid "Act on Mouse up"
|
|
msgstr "Mysz"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescaction
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
|
msgid "Action"
|
|
msgstr "Działanie"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
|
msgid "Click"
|
|
msgstr "Zaznaczanie prawym klawiszem"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
|
msgid "Edit Mouse"
|
|
msgstr "Edycja myszy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrordup
|
|
msgid "Duplicate Entry"
|
|
msgstr "Zduplikowany wpis"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
|
msgid "This entry conflicts with an existing entry"
|
|
msgstr "Ten wpis jest w konflikcie z istniejącym"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
|
msgid "Button"
|
|
msgstr "Przycisk"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
|
|
msgid "Caret"
|
|
msgstr "Kursor"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
|
msgid "Context"
|
|
msgstr "Kontekst"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcount
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
|
msgid "Click"
|
|
msgstr "Zaznaczanie prawym klawiszem"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
|
msgid "Action"
|
|
msgstr "Działanie"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddir
|
|
msgid "Up/Down"
|
|
msgstr "W górę/W dół"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadopt
|
|
msgid "Option"
|
|
msgstr "Opcje"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadorder
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
|
msgid "Order"
|
|
msgstr "Inne"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
|
msgid "Priority"
|
|
msgstr "Priorytet"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptions
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
|
msgid "Mouse"
|
|
msgstr "Mysz"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsadv
|
|
msgid "Advanced"
|
|
msgstr "Zaawansowane"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
|
msgid "IDE-Command"
|
|
msgstr "Polecenie IDE"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
|
#, fuzzy
|
|
msgid "n"
|
|
msgstr "Każdy n-ty numer linii"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
|
msgid "-"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
|
msgid "Y"
|
|
msgstr "Y"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
|
msgid "Y"
|
|
msgstr "Y"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeall
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
|
msgid "All"
|
|
msgstr "Wszystko"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
|
msgid "Gutter"
|
|
msgstr "Kolektor"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
|
#, fuzzy
|
|
msgid "Line Changes"
|
|
msgstr "Zapisać zmiany"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
|
msgid "Fold Tree"
|
|
msgstr "Drzewo zwijania"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
|
msgid "Collapsed [+]"
|
|
msgstr "Zwinięte [+]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
|
msgid "Expanded [-]"
|
|
msgstr "Rozwinięte [-]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
|
|
msgid "Overview"
|
|
msgstr "Przegląd"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
|
|
#, fuzzy
|
|
msgid "Overview Mark"
|
|
msgstr "Znacznik katalogu źródeł pakietu"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
|
msgid "Line Numbers"
|
|
msgstr "Numery wierszy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodemain
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
|
msgid "Selection"
|
|
msgstr "Zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptopt2label
|
|
msgid "Opt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheract
|
|
msgid "Other actions using the same button"
|
|
msgstr "Inne działania przy użyciu tego samego przycisku"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
|
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
|
#, fuzzy
|
|
msgid "Filter Mod-Keys"
|
|
msgstr "Filtr"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
|
msgid "Priority"
|
|
msgstr "Priorytet"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
|
msgid "Debug"
|
|
msgstr "Odpluskwanie"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
|
msgid "Error"
|
|
msgstr "Błąd"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
|
msgid "Fatal"
|
|
msgstr "Błąd krytyczny"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
|
msgid "Hint"
|
|
msgstr "Podpowiedź"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
|
msgid "Important"
|
|
msgstr "Ważne"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
|
msgid "Normal"
|
|
msgstr "Normalny"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
|
msgid "Note"
|
|
msgstr "Uwaga"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
|
msgid "Time and statistics"
|
|
msgstr "Czas i statystyki"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
|
#, fuzzy
|
|
msgid "Verbose 2"
|
|
msgstr "Lewy 2"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
|
#, fuzzy
|
|
msgid "Verbose 3"
|
|
msgstr "Ustaw znacznik 3"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
|
msgid "Warning"
|
|
msgstr "Ostrzeżenie"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
|
msgid "Navigation keys move all carets (column-select)"
|
|
msgstr "Klawisze nawigacyjne przesuwają wszystkie kursory (zaznaczanie kolumn)"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretdelskipcr
|
|
msgid "Skip delete key at EOL (do not join lines)"
|
|
msgstr "Pomiń klawisz delete na końcu wiersza (nie łącz wierszy)"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretgroupoptions
|
|
msgid "Multi-caret"
|
|
msgstr "Kursor wielokrotny"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretmode
|
|
msgid "Navigation keys move all carets"
|
|
msgstr "Klawisze nawigacyjne przesuwają wszystkie kursory"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
|
msgid "Enable multi-caret for column selection"
|
|
msgstr "Włącz kursor wielokrotny do zaznaczania kolumn"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
|
msgid "always start a new instance"
|
|
msgstr "zawsze uruchamiaj nową instancję"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
|
msgid "do not allow multiple instances"
|
|
msgstr "nie dopuszczaj wielu instancji"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
|
msgid "open files in a running instance"
|
|
msgstr "otwieraj pliki w uruchomionej instancji"
|
|
|
|
#: lazarusidestrconsts.dlgmultiselect
|
|
#, fuzzy
|
|
msgid "Multi Select"
|
|
msgstr "Wybierz..."
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
|
msgid "Jump target priority between multiple editors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
|
msgid "Order to use for editors matching the same criteria"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
|
msgid "Most recent focused editor for this file"
|
|
msgstr "Ostatnio użyty edytor dla tego pliku"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
|
msgid "Editor (for file) in most recent focused window"
|
|
msgstr "Okno ostatnio użytego edytora (dla pliku)"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
|
msgid "Priority list of criteria to choose an editor:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinoptions
|
|
msgid "Pages and Windows"
|
|
msgstr "Strony i okna"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwintabgroup
|
|
msgid "Notebook Tabs"
|
|
msgstr "Zakładki karty"
|
|
|
|
#: lazarusidestrconsts.dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Nazewnictwo"
|
|
|
|
#: lazarusidestrconsts.dlgnewdesktop
|
|
msgid "New desktop ..."
|
|
msgstr "Nowy pulpit..."
|
|
|
|
#: lazarusidestrconsts.dlgnewprojecttype
|
|
msgid "New Project Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
|
msgid "No automatic renaming"
|
|
msgstr "Bez automatycznej zmiany nazwy"
|
|
|
|
#: lazarusidestrconsts.dlgnoavailableunits
|
|
msgid "No available units to add."
|
|
msgstr "Brak modułów dostępnych do dodania."
|
|
|
|
#: lazarusidestrconsts.dlgnobrackethighlight
|
|
msgid "No Highlight"
|
|
msgstr "Nie podświetlaj"
|
|
|
|
#: lazarusidestrconsts.dlgnonformbackgroundcolor
|
|
msgid "Other Designer background (e. g. TDataModule)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotebooktabpos
|
|
msgid "Source notebook tabs position"
|
|
msgstr "Pozycja zakładek w edytorze źródeł"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlineafter
|
|
msgid "Do not split line after"
|
|
msgstr "Nie dziel wiersza po"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlinefront
|
|
msgid "Do not split line in front of"
|
|
msgstr "Nie dziel wiersza przed"
|
|
|
|
#: lazarusidestrconsts.dlgnsprincipalclass
|
|
msgid "NSPrincipalClass"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgobjinsp
|
|
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
|
msgid "Object Inspector"
|
|
msgstr "Inspektor obiektów"
|
|
|
|
#: lazarusidestrconsts.dlgoiitemheight
|
|
msgid "Item height (0 = auto)"
|
|
msgstr "Wysokość elementu (0 = auto)"
|
|
|
|
#: lazarusidestrconsts.dlgoimiscellaneous
|
|
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Pozostałe"
|
|
|
|
#: lazarusidestrconsts.dlgoispeedsettings
|
|
msgid "Speed settings"
|
|
msgstr "Szybkie ustawienia"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
|
msgid "Use default Delphi settings"
|
|
msgstr "Użyj domyślnych ustawień Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
|
msgid "Use default Lazarus settings"
|
|
msgstr "Użyj domyślnych ustawień Lazarusa"
|
|
|
|
#: lazarusidestrconsts.dlgoptimizationlevels
|
|
msgid "Optimization levels"
|
|
msgstr "Poziom optymalizacji"
|
|
|
|
#: lazarusidestrconsts.dlgotheroptimizations
|
|
msgid "Other optimizations"
|
|
msgstr "Pozostałe optymalizacje"
|
|
|
|
#: lazarusidestrconsts.dlgotherunitfiles
|
|
msgid "Other unit files (-Fu):"
|
|
msgstr "Pozostałe katalogi modułów (-Fu) (średnik jest separatorem):"
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterback1color
|
|
msgid "Background 1"
|
|
msgstr "Tło 1"
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterback2color
|
|
msgid "Background 2"
|
|
msgstr "Tło 2"
|
|
|
|
#: lazarusidestrconsts.dlgoverviewguttercolor
|
|
msgid "Overview Gutter"
|
|
msgstr "Pasek przeglądu"
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterpagecolor
|
|
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
|
|
msgid "Page"
|
|
msgstr "Strona"
|
|
|
|
#: lazarusidestrconsts.dlgoverwriteblock
|
|
msgid "Overwrite block"
|
|
msgstr "Nadpisz blok"
|
|
|
|
#: lazarusidestrconsts.dlgoverwritedesktop
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid ""
|
|
#| "Desktop with the name \"%s\" was found.\n"
|
|
#| "Should the old desktop be overwritten?\n"
|
|
msgid ""
|
|
"Desktop with the name \"%s\" was found.\n"
|
|
"Should the old desktop be overwritten?"
|
|
msgstr ""
|
|
"Znaleziono pulpit o nazwie \"%s\".\n"
|
|
"Czy stary pulpit powinien być nadpisany?\n"
|
|
|
|
#: lazarusidestrconsts.dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Podpowiedzi dla palety komponentów"
|
|
|
|
#: lazarusidestrconsts.dlgpasext
|
|
msgid "Default Pascal extension"
|
|
msgstr "Domyślne rozszerzenie pascala"
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywords
|
|
msgid "Highlight control statements as keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
|
#, fuzzy
|
|
msgid "Extended Pascal Keyword Options"
|
|
msgstr "Jako nazwy komponentu \"%s\" próbujesz użyć słowa kluczowego języka Pascal"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmarkup
|
|
#, fuzzy
|
|
msgid "Markup (on caret)"
|
|
msgstr "Kursor"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
|
msgid "Matching Keywords"
|
|
msgstr "Odpowiednie słowa kluczowe"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsoutline
|
|
msgid "Outline"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpassoptslinker
|
|
msgid "Pass options to linker with \"-k\", delimiter is space"
|
|
msgstr "Prześlij opcje do linkera za pomocą \"-k\" (oddzielone spacją)"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywords
|
|
#, fuzzy
|
|
msgid "Highlight \"String\" keyword(s)"
|
|
msgstr "Nie znaleziono wyrażenia '%s'!"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
|
msgid "Default"
|
|
msgstr "Domyślnie"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
|
#, fuzzy
|
|
msgid "Only \"String\""
|
|
msgstr "String"
|
|
|
|
#: lazarusidestrconsts.dlgpersistentblock
|
|
msgid "Persistent block"
|
|
msgstr "Niezmienny blok"
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursor
|
|
msgid "Visible caret in unfocused editor"
|
|
msgstr "Kursor widoczny w edytorze bez fokusa"
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursornoblink
|
|
msgid "Caret in unfocused editor does not blink"
|
|
msgstr "Kursor w edytorze bez fokusa nie miga"
|
|
|
|
#: lazarusidestrconsts.dlgpoansiutf8
|
|
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Aplikacja"
|
|
|
|
#: lazarusidestrconsts.dlgpoasinvoker
|
|
msgid "as invoker (asInvoker)"
|
|
msgstr "jako wywołujący (asInvoker)"
|
|
|
|
#: lazarusidestrconsts.dlgpoclearicon
|
|
msgid "&Clear Icon"
|
|
msgstr "Usuń ikonę"
|
|
|
|
#: lazarusidestrconsts.dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr "Utwórz Zestaw Aplikacji"
|
|
|
|
#: lazarusidestrconsts.dlgpodebugger
|
|
msgctxt "lazarusidestrconsts.dlgpodebugger"
|
|
msgid "Debugger"
|
|
msgstr "Odpluskiwacz"
|
|
|
|
#: lazarusidestrconsts.dlgpodefaulticon
|
|
msgid "Load &Default"
|
|
msgstr "Przywróć domyślną"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawareness
|
|
msgid "DPI awareness"
|
|
msgstr "Obsługa różnych DPI"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
|
#, fuzzy
|
|
msgid "off"
|
|
msgstr "--gdk-no-debug flags Wyłącz specificzne dla GDK komunikaty śledzenia/odpluskwiania."
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
|
msgid "Vista-8: off, 8.1+: per monitor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
|
msgid "Vista-8: on, 8.1+: per monitor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
|
|
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenesson
|
|
msgid "on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoexecutionlevel
|
|
msgid "Execution Level"
|
|
msgstr "Poziom wykonywania"
|
|
|
|
#: lazarusidestrconsts.dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Formularze"
|
|
|
|
#: lazarusidestrconsts.dlgpohighestavailable
|
|
msgid "highest available (highestAvailable)"
|
|
msgstr "najwyższy możliwy (highestAvailable)"
|
|
|
|
#: lazarusidestrconsts.dlgpoi18n
|
|
#, fuzzy
|
|
msgid "i18n"
|
|
msgstr "Włącz i18n dla LFM"
|
|
|
|
#: lazarusidestrconsts.dlgpoicon
|
|
msgid "Icon:"
|
|
msgstr "Ikona:"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondesc
|
|
#, object-pascal-format
|
|
msgid "(size: %d:%d, bpp: %d)"
|
|
msgstr "(rozmiar: %d:%d, bpp: %d)"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondescnone
|
|
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
|
msgid "(none)"
|
|
msgstr "(brak)"
|
|
|
|
#: lazarusidestrconsts.dlgpointertypecheck
|
|
msgid "@<pointer> returns a typed pointer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoloadicon
|
|
msgid "&Load Icon"
|
|
msgstr "Dodaj ikonę"
|
|
|
|
#: lazarusidestrconsts.dlgpolongpathaware
|
|
msgid "Long path awareness"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpomisc
|
|
msgctxt "lazarusidestrconsts.dlgpomisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Pozostałe"
|
|
|
|
#: lazarusidestrconsts.dlgporequireadministrator
|
|
msgid "require administrator (requireAdministrator)"
|
|
msgstr "wymaga administratora (requireAdministrator)"
|
|
|
|
#: lazarusidestrconsts.dlgporesources
|
|
msgid "Resources"
|
|
msgstr "Zasoby"
|
|
|
|
#: lazarusidestrconsts.dlgposaveicon
|
|
msgid "&Save Icon"
|
|
msgstr "Zapisz ikonę"
|
|
|
|
#: lazarusidestrconsts.dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Sesja"
|
|
|
|
#: lazarusidestrconsts.dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Nazwa:"
|
|
|
|
#: lazarusidestrconsts.dlgpouiaccess
|
|
#, fuzzy
|
|
msgid "UI Access (uiAccess)"
|
|
msgstr "brak uprawnień do wykonania dla %s"
|
|
|
|
#: lazarusidestrconsts.dlgpouseappbundle
|
|
msgid "Use Application Bundle for running and debugging"
|
|
msgstr "Użyj Zestawu Aplikacji do uruchomienia i odpluskiwania"
|
|
|
|
#: lazarusidestrconsts.dlgpouselclscaling
|
|
msgid "Use LCL scaling (Hi-DPI)"
|
|
msgstr "Użyj skalowania LCL (Hi-DPI)"
|
|
|
|
#: lazarusidestrconsts.dlgpousemanifest
|
|
msgid "Use manifest resource (and enable themes)"
|
|
msgstr "Użyj pliku manifest (i odblokuj kompozycje)"
|
|
|
|
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
|
msgid "Prefer double-click over single-click"
|
|
msgstr "Preferuj podwójne kliknięcie zamiast pojedynczego"
|
|
|
|
#: lazarusidestrconsts.dlgpriorities
|
|
msgid "Priorities"
|
|
msgstr "Priorytety"
|
|
|
|
#: lazarusidestrconsts.dlgproject
|
|
msgctxt "lazarusidestrconsts.dlgproject"
|
|
msgid "Project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptions
|
|
msgid "Project Options"
|
|
msgstr "Opcje projektu"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptionsfor
|
|
#, object-pascal-format
|
|
msgid "Options for Project: %s"
|
|
msgstr "Opcje dla projektu: %s"
|
|
|
|
#: lazarusidestrconsts.dlgprojecttoopenorcreate
|
|
msgid "Project to Open or Create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojfiles
|
|
msgid "Project Files"
|
|
msgstr "Pliki projektu"
|
|
|
|
#: lazarusidestrconsts.dlgpromptonreplace
|
|
msgid "&Prompt on replace"
|
|
msgstr "Za&pytaj czy zmienić"
|
|
|
|
#: lazarusidestrconsts.dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "Uzupełnianie właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgpropnamecolor
|
|
msgid "Property Name"
|
|
msgstr "Nazwa właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgqopenlastprj
|
|
msgid "Open last project and packages at start"
|
|
msgstr "Otwórz ostatnio otwarty projekt po uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.dlgqshowborderspacing
|
|
msgctxt "lazarusidestrconsts.dlgqshowborderspacing"
|
|
msgid "Show border spacing"
|
|
msgstr "Pokaż obramowanie odstępu"
|
|
|
|
#: lazarusidestrconsts.dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Pokaż siatkę"
|
|
|
|
#: lazarusidestrconsts.dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Przyciągaj do siatki"
|
|
|
|
#: lazarusidestrconsts.dlgreallydeletedesktop
|
|
#, object-pascal-format
|
|
msgid "Really delete desktop \"%s\"?"
|
|
msgstr "Na pewno usunąć pulpit \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr "Odnośnik"
|
|
|
|
#: lazarusidestrconsts.dlgregularexpressions
|
|
msgid "Regular e&xpressions"
|
|
msgstr "&Wyrażenia regularne"
|
|
|
|
#: lazarusidestrconsts.dlgrenamedesktop
|
|
msgid "Rename desktop"
|
|
msgstr "Zmień nazwę pulpitu"
|
|
|
|
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
|
|
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
|
|
msgid "Rename"
|
|
msgstr "Zmień nazwę"
|
|
|
|
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
|
|
msgid "Rename selected desktop"
|
|
msgstr "Zmień nazwę pulpitu"
|
|
|
|
#: lazarusidestrconsts.dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "Zastąp &wszystko"
|
|
|
|
#: lazarusidestrconsts.dlgreplacewith
|
|
msgid "Replace wit&h"
|
|
msgstr "&Zamień na"
|
|
|
|
#: lazarusidestrconsts.dlgreport
|
|
msgid "Report"
|
|
msgstr "Raport"
|
|
|
|
#: lazarusidestrconsts.dlgreset
|
|
msgctxt "lazarusidestrconsts.dlgreset"
|
|
msgid "Reset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgresetall
|
|
msgid "Reset all"
|
|
msgstr "Zresetuj wszystko"
|
|
|
|
#: lazarusidestrconsts.dlgrightbottomclr
|
|
msgid "Guide lines Right,Bottom"
|
|
msgstr "Prowadnica prawa i dolna"
|
|
|
|
#: lazarusidestrconsts.dlgrightclickselects
|
|
msgid "Right click selects"
|
|
msgstr "Zaznaczanie prawym klawiszem"
|
|
|
|
#: lazarusidestrconsts.dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "Prawy margines"
|
|
|
|
#: lazarusidestrconsts.dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Katalog roboczy"
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
|
msgid "Select grandchildren"
|
|
msgstr "Zaznaczaj wszystkich potomków"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
|
#, fuzzy
|
|
#| msgid "Creation"
|
|
msgid "Rubberband Creation"
|
|
msgstr "Tworzenie źródła"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
|
#, fuzzy
|
|
#| msgid "Selection"
|
|
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
|
msgid "Rubberband Selection"
|
|
msgstr "Zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"The running Lazarus instance cannot accept any files.\n"
|
|
"Do you want to open them in a new IDE instance?\n"
|
|
"\n"
|
|
"%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
|
msgid "Lazarus instance is running but not responding."
|
|
msgstr "Instancja Lazarusa jest uruchomiona, ale nie odpowiada."
|
|
|
|
#: lazarusidestrconsts.dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Ekran (nie dotyczy win32), np. 198.112.45.11:0, x.org:1, hydra:0.1"
|
|
|
|
#: lazarusidestrconsts.dlgrunoenvironment
|
|
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
|
msgid "Environment"
|
|
msgstr "Środowisko"
|
|
|
|
#: lazarusidestrconsts.dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Lokalne"
|
|
|
|
#: lazarusidestrconsts.dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Zmienne systemowe"
|
|
|
|
#: lazarusidestrconsts.dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Użyj ekranu"
|
|
|
|
#: lazarusidestrconsts.dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Nadpisanie zmiennych"
|
|
|
|
#: lazarusidestrconsts.dlgrunparameters
|
|
msgid "Run Parameters"
|
|
msgstr "Uruchom z parametrami"
|
|
|
|
#: lazarusidestrconsts.dlgrunwithdebug
|
|
msgid "Run uses the debugger (disable for release-mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktop
|
|
msgid "Save current desktop"
|
|
msgstr "Zapisz obecny pulpit"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
|
msgid "Save current desktop as"
|
|
msgstr "Zapisz obecny pulpit jako"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
|
|
msgid "Save active desktop as ..."
|
|
msgstr "Zapisz obecny pulpit jako..."
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
|
|
msgid "Save active desktop as"
|
|
msgstr "Zapisz obecny pulpit jako"
|
|
|
|
#: lazarusidestrconsts.dlgsavedlinecolor
|
|
msgid "Saved line"
|
|
msgstr "Zapisany wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Zapisuj informację edytora dla zamykanych plików"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
|
msgid "The files are available in the \"Open Recent\" history list."
|
|
msgstr "Pliki dostępne na liście \"Otwórz poprzedni\"."
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Zapisuj informację edytora tylko dla plików projektu"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
|
msgid "Only files that belong to this project."
|
|
msgstr "Tylko pliki należące do tego projektu."
|
|
|
|
#: lazarusidestrconsts.dlgsavein
|
|
msgid "Save in"
|
|
msgstr "Zapisz w"
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolfixed
|
|
msgid "Force 1024 columns minimum for horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolnone
|
|
msgid "Do not add any permanent space to horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolpage
|
|
msgid "Always add one page to horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Przewiń o jeden mniej"
|
|
|
|
#: lazarusidestrconsts.dlgscrollgroupoptions
|
|
msgid "Scrolling"
|
|
msgstr "Przewijanie"
|
|
|
|
#: lazarusidestrconsts.dlgscrollhint
|
|
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
|
msgid "Show scroll hint"
|
|
msgstr "Pokaż wskazówkę przewijania"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Przewijaj poza końcem pliku"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendline
|
|
#, fuzzy
|
|
#| msgid "Allow caret to move past end of line"
|
|
msgid "Allow Caret to move past the end of line"
|
|
msgstr "Dopuszczaj kursor poza końcem wiersza"
|
|
|
|
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
|
#, object-pascal-format
|
|
msgid "Search directory \"%s\" not found."
|
|
msgstr "Nie znaleziono katalogu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Wyszukiwane przerwane przez użytkownika."
|
|
|
|
#: lazarusidestrconsts.dlgsearchcaption
|
|
msgid "Searching ..."
|
|
msgstr "Wyszukiwanie..."
|
|
|
|
#: lazarusidestrconsts.dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Ścieżki"
|
|
|
|
#: lazarusidestrconsts.dlgsearchscope
|
|
msgid "Search scope"
|
|
msgstr "Zakres poszukiwań"
|
|
|
|
#: lazarusidestrconsts.dlgselectallchildcontrols
|
|
msgid "Select all child controls together with their parent."
|
|
msgstr "Zaznaczaj wszystkie potomne kontrolki wraz z ich rodzicem."
|
|
|
|
#: lazarusidestrconsts.dlgselectallnoscroll
|
|
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectedtext
|
|
msgid "&Selected text"
|
|
msgstr "&Zaznaczony tekst"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
|
|
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
|
|
msgid "Set active"
|
|
msgstr "Ustaw jako aktywny"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
|
|
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
|
|
msgid "Set active"
|
|
msgstr "Ustaw jako aktywny"
|
|
|
|
#: lazarusidestrconsts.dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Domyślny wygląd wszystkich elementów"
|
|
|
|
#: lazarusidestrconsts.dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Domyślny wygląd elementu"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "Zmienna właściwości"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
|
msgid "The parameter name for the default setter procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
|
#, fuzzy
|
|
msgid "is prefix"
|
|
msgstr "Przedrostek odczytu"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
|
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
|
#, fuzzy
|
|
msgid "use const"
|
|
msgstr "Zastosuj >"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
|
msgid "If checked, the setter parameter is marked with \"const\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowallunits
|
|
msgid "Show all units"
|
|
msgstr "Pokaż wszystkie moduły"
|
|
|
|
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
|
msgid "Show captions of nonvisual components"
|
|
msgstr "Pokaż etykiety niewizualnych komponentów"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Pokaż kompilowane procedury"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Pokaż numery wierszy"
|
|
|
|
#: lazarusidestrconsts.dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Pokaż dyrektywy warunkowe"
|
|
|
|
#: lazarusidestrconsts.dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Pokaż informacje dla odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhints
|
|
msgid "Show designer hints"
|
|
msgstr "Pokaż podpowiedzi przy projektowaniu"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
|
msgid "Hint shows control's position or size while moving or resizing it."
|
|
msgstr "Podpowiedź zawiera pozycję lub rozmiar kontrolki przy jej przesuwaniu lub zmianie rozmiaru."
|
|
|
|
#: lazarusidestrconsts.dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Pokaż wszystko"
|
|
|
|
#: lazarusidestrconsts.dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Pokaż informacje wykonywalne (tylko Win32)"
|
|
|
|
#: lazarusidestrconsts.dlgshowfilenameincaption
|
|
msgid "Show file name in caption"
|
|
msgstr "Pokaż nazwę pliku w nagłówku"
|
|
|
|
#: lazarusidestrconsts.dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Pokaż ogólne informacje"
|
|
|
|
#: lazarusidestrconsts.dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Pokaż podpowiedzi marginesu ikon"
|
|
|
|
#: lazarusidestrconsts.dlgshowhint
|
|
msgctxt "lazarusidestrconsts.dlgshowhint"
|
|
msgid "Show hints"
|
|
msgstr "Pokaż wskazówki"
|
|
|
|
#: lazarusidestrconsts.dlgshowingwindows
|
|
msgid "Showing Windows"
|
|
msgstr "Wyświetlanie okien"
|
|
|
|
#: lazarusidestrconsts.dlgshowlinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Wyświetlaj numery wierszy"
|
|
|
|
#: lazarusidestrconsts.dlgshowmessagesicons
|
|
msgid "Show Messages Icons"
|
|
msgstr "Pokazuj ikony komunikatów"
|
|
|
|
#: lazarusidestrconsts.dlgshownotes
|
|
msgid "Show notes"
|
|
msgstr "Pokaż uwagi"
|
|
|
|
#: lazarusidestrconsts.dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Pokaż sprawdzane pliki"
|
|
|
|
#: lazarusidestrconsts.dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Pokaż pliki w użyciu"
|
|
|
|
#: lazarusidestrconsts.dlgshowwarnings
|
|
msgid "Show warnings"
|
|
msgstr "Pokaż ostrzeżenia"
|
|
|
|
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
|
msgid "Show single button in TaskBar"
|
|
msgstr "Pojedynczy przycisk na pasku zadań"
|
|
|
|
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
|
#, fuzzy
|
|
msgid "Skip forward class declarations"
|
|
msgstr "Brak klasy zadeklarowanej jako Forward: %s"
|
|
|
|
#: lazarusidestrconsts.dlgslashcommenttab
|
|
msgid "Slash //"
|
|
msgstr "Ukośnik //"
|
|
|
|
#: lazarusidestrconsts.dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr "Sprytne zakładki"
|
|
|
|
#: lazarusidestrconsts.dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Przyrostek (.pp~)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Licznik (.pp;1)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Przedrostek (~.pp)"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "Przyciągaj do linii naprowadzających"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelineshint
|
|
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
|
msgid "Multiline tabs"
|
|
msgstr "Wielolinijkowe zakładki"
|
|
|
|
#: lazarusidestrconsts.dlgspacenotcosmos
|
|
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
|
msgid "Space"
|
|
msgstr "Odstęp"
|
|
|
|
#: lazarusidestrconsts.dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Podpowiedzi dla głównych przycisków (otwórz, zapisz...)"
|
|
|
|
#: lazarusidestrconsts.dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Rozpocznij"
|
|
|
|
#: lazarusidestrconsts.dlgstacksize
|
|
msgid "Stack size"
|
|
msgstr "Rozmiar stosu"
|
|
|
|
#: lazarusidestrconsts.dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Zatrzymuj po liczbie błędów:"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoappend
|
|
msgid "Append text to close string"
|
|
msgstr "Dołącz tekst aby zamknąć łańcuch znaków"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoprefix
|
|
msgid "Prefix string on new line"
|
|
msgstr "Poprzedź łańcuch w nowym wierszu"
|
|
|
|
#: lazarusidestrconsts.dlgstringbreakindenttab
|
|
msgid "String ''"
|
|
msgstr "Łańcuch znaków \""
|
|
|
|
#: lazarusidestrconsts.dlgstringenableautocontinue
|
|
#, fuzzy
|
|
msgid "Extend strings on linebreak"
|
|
msgstr "Stałe łańcuchowe o tej samej wartości:"
|
|
|
|
#: lazarusidestrconsts.dlgsubpropcolor
|
|
msgid "SubProperties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Opcje składni"
|
|
|
|
#: lazarusidestrconsts.dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tabulator wcina blokowo"
|
|
|
|
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
|
msgid "Show tab numbers in notebook"
|
|
msgstr "Pokaż numer karty w zakładce"
|
|
|
|
#: lazarusidestrconsts.dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Tab na spacje"
|
|
|
|
#: lazarusidestrconsts.dlgtabwidths
|
|
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
|
msgid "Tab widths"
|
|
msgstr "Szerokość tabulatora"
|
|
|
|
#: lazarusidestrconsts.dlgtargetcpufamily
|
|
msgid "Target CPU family"
|
|
msgstr "Docelowa rodzina procesora"
|
|
|
|
#: lazarusidestrconsts.dlgtargetos
|
|
msgctxt "lazarusidestrconsts.dlgtargetos"
|
|
msgid "Target OS"
|
|
msgstr "Docelowy system operacyjny"
|
|
|
|
#: lazarusidestrconsts.dlgtargetplatform
|
|
msgid "Target platform"
|
|
msgstr "Docelowa platforma"
|
|
|
|
#: lazarusidestrconsts.dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr "Docelowy procesor"
|
|
|
|
#: lazarusidestrconsts.dlgtargetspecificoptions
|
|
msgid "Target-specific options"
|
|
msgstr "Opcje zależne od platformy docelowej"
|
|
|
|
#: lazarusidestrconsts.dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Katalog do budowania testowych projektów"
|
|
|
|
#: lazarusidestrconsts.dlgtextstyle
|
|
msgid "Text-Style"
|
|
msgstr "Styl tekstu"
|
|
|
|
#: lazarusidestrconsts.dlgtexttofind
|
|
#, fuzzy
|
|
#| msgid "&Text to find"
|
|
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
|
msgid "Search s&tring"
|
|
msgstr "&Tekst"
|
|
|
|
#: lazarusidestrconsts.dlgthiselementusescolor
|
|
msgid "The element uses (and edits) the schemes:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr "Przełącz jako pulpit odpluskwiania"
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr "Przełącz jako pulpit odpluskwiania"
|
|
|
|
#: lazarusidestrconsts.dlgtopinfohint
|
|
#, fuzzy
|
|
msgid "Current Class/Proc Hint"
|
|
msgstr ". Wskazówka: procedura zaczyna się przy "
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
|
msgid "Trim spaces style"
|
|
msgstr "Styl usuwania spacji"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
|
#, fuzzy
|
|
msgid "Caret or Edit"
|
|
msgstr "Kursor"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
|
msgid "Line Edited"
|
|
msgstr "Wiersz edytowany"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
|
msgid "Leave line"
|
|
msgstr "Opuść wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
|
msgid "Position Only"
|
|
msgstr "Tylko pozycja"
|
|
|
|
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Obetnij spacje końcowe"
|
|
|
|
#: lazarusidestrconsts.dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Cofnij po zapisaniu"
|
|
|
|
#: lazarusidestrconsts.dlgundogroupoptions
|
|
msgid "Undo / Redo"
|
|
msgstr "Cofnij / Przywróć"
|
|
|
|
#: lazarusidestrconsts.dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Limit cofania"
|
|
|
|
#: lazarusidestrconsts.dlgunitdeprefresh
|
|
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
|
msgid "Refresh"
|
|
msgstr "Odśwież"
|
|
|
|
#: lazarusidestrconsts.dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr "Katalog wyjściowy modułów (-FU):"
|
|
|
|
#: lazarusidestrconsts.dlgunsavedlinecolor
|
|
msgid "Unsaved line"
|
|
msgstr "Niezapisany wiersz"
|
|
|
|
#: lazarusidestrconsts.dlgusecodefolding
|
|
msgid "Code Folding"
|
|
msgstr "Zwijanie kodu"
|
|
|
|
#: lazarusidestrconsts.dlgusecustomconfig
|
|
msgid "Use additional compiler config file"
|
|
msgstr "Użyj dodatkowego pliku konfiguracji kompilatora"
|
|
|
|
#: lazarusidestrconsts.dlgusedividerdraw
|
|
msgid "Divider Drawing"
|
|
msgstr "Kreślenie oddzielające"
|
|
|
|
#: lazarusidestrconsts.dlgusefpccfg
|
|
msgid "Use standard compiler config file (fpc.cfg)"
|
|
msgstr "Użyj standardowego pliku konfiguracji kompilatora (fpc.cfg)"
|
|
|
|
#: lazarusidestrconsts.dlgusehighlight
|
|
msgid "Use Highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseiconsincompletionbox
|
|
msgid "Icons in code completion box"
|
|
msgstr "Ikony w ramce podpowiedzi i uzupełnień"
|
|
|
|
#: lazarusidestrconsts.dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Użyj programu ładującego"
|
|
|
|
#: lazarusidestrconsts.dlguseminimumime
|
|
msgid "IME handled by System"
|
|
msgstr "IME obsługiwane przez system"
|
|
|
|
#: lazarusidestrconsts.dlguserschemeerror
|
|
#, object-pascal-format
|
|
msgid "Failed to load user-scheme file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseschemedefaults
|
|
msgid "- Scheme globals -"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseschemelocal
|
|
#, fuzzy
|
|
#| msgid "Use local scheme settings"
|
|
msgid "selected language"
|
|
msgstr "Użyj schematu predefiniowanego"
|
|
|
|
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Podświetlaj składnię"
|
|
|
|
#: lazarusidestrconsts.dlgusetabshistory
|
|
msgid "Use tab history when closing tabs"
|
|
msgstr "Przy zamykaniu zakładek korzystaj z historii"
|
|
|
|
#: lazarusidestrconsts.dlguseunitcaption
|
|
msgid "Add unit to Uses section"
|
|
msgstr "Dodaj moduł do sekcji Uses"
|
|
|
|
#: lazarusidestrconsts.dlgvaluecolor
|
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
|
msgid "Value"
|
|
msgstr "Wartość"
|
|
|
|
#: lazarusidestrconsts.dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Gadatliwość podczas kompilacji:"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Pokazuj margines ikon"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Pokazuj prawy margines"
|
|
|
|
#: lazarusidestrconsts.dlgwholewordsonly
|
|
msgid "&Whole words only"
|
|
msgstr "Tylko całe &wyrazy"
|
|
|
|
#: lazarusidestrconsts.dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Szerokość:"
|
|
|
|
#: lazarusidestrconsts.dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr "Aplikacja graficzna win32"
|
|
|
|
#: lazarusidestrconsts.dlgwindow
|
|
msgctxt "lazarusidestrconsts.dlgwindow"
|
|
msgid "Window"
|
|
msgstr "Okno"
|
|
|
|
#: lazarusidestrconsts.dlgwordexceptions
|
|
msgid "Exceptions"
|
|
msgstr "Wyjątki"
|
|
|
|
#: lazarusidestrconsts.dlgwordspolicies
|
|
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
|
msgid "Words"
|
|
msgstr "Wielkość liter"
|
|
|
|
#: lazarusidestrconsts.dlgwrdpreview
|
|
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
|
msgid "Preview"
|
|
msgstr "Podgląd"
|
|
|
|
#: lazarusidestrconsts.dlgwritefpclogo
|
|
msgid "Write FPC logo"
|
|
msgstr "Wypisz logo FPC"
|
|
|
|
#: lazarusidestrconsts.drsignoringprojectdebuggersettings
|
|
msgid " (Ignoring project settings below)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoreconverterconfiginses
|
|
msgid "Store converter config in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
|
|
msgid "Store project debugger configs in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthedebuggerbackendselecti
|
|
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
|
|
msgid "This only affects the list of converters below. The options setting which list to use are always stored in the session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheidegloballistofconv
|
|
msgid "Use the IDE-Global list of converters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheprojectlistofconver
|
|
msgid "Use the project list of converters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusingidedefaultdebuggerse
|
|
msgid "Using IDE default debugger settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusingselectedidedebuggers
|
|
msgid "Using selected IDE debugger settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Wybrane komponenty muszą być na tym samym formularzu."
|
|
|
|
#: lazarusidestrconsts.fdmalignmenu
|
|
msgid "Align ..."
|
|
msgstr "Wyrównaj ..."
|
|
|
|
#: lazarusidestrconsts.fdmdeleteselection
|
|
msgid "Delete Selection"
|
|
msgstr "Usuń zaznaczone"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorhorizontal
|
|
msgid "Mirror Horizontal"
|
|
msgstr "Poziome odbicie lustrzane"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorvertical
|
|
msgid "Mirror Vertical"
|
|
msgstr "Pionowe odbicie lustrzane"
|
|
|
|
#: lazarusidestrconsts.fdmorderbackone
|
|
msgid "Back One"
|
|
msgstr "O jeden na spód"
|
|
|
|
#: lazarusidestrconsts.fdmorderforwardone
|
|
msgid "Forward One"
|
|
msgstr "O jeden na wierzch"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetoback
|
|
msgid "Move to Back"
|
|
msgstr "Przenieś na spód"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetofront
|
|
msgid "Move to Front"
|
|
msgstr "Przenieś na wierzch"
|
|
|
|
#: lazarusidestrconsts.fdmresetmenu
|
|
#, fuzzy
|
|
msgid "Reset ..."
|
|
msgstr "Przywróć powiększenie"
|
|
|
|
#: lazarusidestrconsts.fdmsaveformasxml
|
|
msgid "Save Form as XML"
|
|
msgstr "Zapisz formularz jako XML"
|
|
|
|
#: lazarusidestrconsts.fdmscalemenu
|
|
msgid "Scale ..."
|
|
msgstr "Skaluj ..."
|
|
|
|
#: lazarusidestrconsts.fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Skala"
|
|
|
|
#: lazarusidestrconsts.fdmselectall
|
|
msgctxt "lazarusidestrconsts.fdmselectall"
|
|
msgid "Select All"
|
|
msgstr "Zaznacz wszystko"
|
|
|
|
#: lazarusidestrconsts.fdmsizemenu
|
|
msgid "Size ..."
|
|
msgstr "Rozmiar ..."
|
|
|
|
#: lazarusidestrconsts.fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Rozmiar"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Opcja: Równaj do siatki"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Opcja: Równaj do linii naprowadzających"
|
|
|
|
#: lazarusidestrconsts.fdmzorder
|
|
msgid "Z-order"
|
|
msgstr "Kolejność nakładania komponentów"
|
|
|
|
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
|
msgid "On Both Sides"
|
|
msgstr "Po obu stronach"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugchangepath
|
|
msgid "Change path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
|
|
msgid "Error: The backend is not configured."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
|
|
msgid "(The configured backend's package is not installed.)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
|
|
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
|
|
msgid "Hint: The backend type is OK, but not the recommended type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
|
|
msgid "Create a new recommended backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugcurrent
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
|
|
msgid "Current"
|
|
msgstr "Bieżący"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
|
|
msgid "The selected backend uses the external executable:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
|
|
#, object-pascal-format
|
|
msgid "The selected backend requires an external executable: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
|
|
#, object-pascal-format
|
|
msgid "Default for your OS/Arch is: \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugignore
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.initdlgdebugignore"
|
|
msgid "Ignore"
|
|
msgstr "Ignoruj"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugkeepbackend
|
|
msgid "Keep backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugnew
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.initdlgdebugnew"
|
|
msgid "New"
|
|
msgstr "Nowy"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
|
|
msgid "Error: External executable is a directory, not a file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
|
|
msgid "Error: External executable not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
|
|
msgid "Error: External file is not executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
|
|
msgid "Error: No default for external executable found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
|
|
msgid "Error: No external executable specified."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpopupinformation
|
|
#, object-pascal-format
|
|
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
|
|
msgid "Select an existing backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
|
|
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
|
|
#, object-pascal-format
|
|
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackages
|
|
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
|
|
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
|
|
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatesetupok
|
|
msgid "Setup is OK."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstateupdatebackend
|
|
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
|
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
|
msgstr "0 = nie, 1 = rysuj linie oddzielające tylko dla najwyższego poziomu, 2 = rysuj linie oddzielające dla pierwszych dwóch poziomów, ..."
|
|
|
|
#: lazarusidestrconsts.lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Dodaj pliki"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Dwuznaczny typ przodka"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Dwuznaczna nazwa klasy"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Dwuznaczna nazwa modułu"
|
|
|
|
#: lazarusidestrconsts.lisa2pancestortype
|
|
msgid "Ancestor type"
|
|
msgstr "Typ przodka"
|
|
|
|
#: lazarusidestrconsts.lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Zerwane zależności"
|
|
|
|
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Jest już klasa o tej nazwie"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
|
msgid "Create New Component"
|
|
msgstr "Twórz nowy komponent"
|
|
|
|
#: lazarusidestrconsts.lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Zależność"
|
|
|
|
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
|
|
msgid "Directory for unit file:"
|
|
msgstr "Katalog pliku modułu:"
|
|
|
|
#: lazarusidestrconsts.lisa2pexistingfile2
|
|
#, object-pascal-format
|
|
msgid "Existing file: \"%s\""
|
|
msgstr "Istniejący plik: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "Plik już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" already exists in the package."
|
|
msgstr "Plik \"%s\" już jest w pakiecie."
|
|
|
|
#: lazarusidestrconsts.lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "Plik jest w użyciu"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename2
|
|
msgid "Filename/URL"
|
|
msgstr "Nazwa pliku/URL"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "Plik nie jest modułem"
|
|
|
|
#: lazarusidestrconsts.lisa2picon24x24
|
|
msgid "Icon 24x24:"
|
|
msgstr "Ikona 24x24:"
|
|
|
|
#: lazarusidestrconsts.lisa2picon36x36
|
|
msgid "Icon 36x36:"
|
|
msgstr "Ikona 36x36:"
|
|
|
|
#: lazarusidestrconsts.lisa2picon48x48
|
|
msgid "Icon 48x48:"
|
|
msgstr "Ikona 48x48:"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Nieprawidłowy typ przodka"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
|
msgid "Invalid Circular Dependency"
|
|
msgstr "Nieprawidłowa zapętlona zależność"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Nieprawidłowa nazwa klasy"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "Nieprawidłowy plik"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Błędna nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Błędna nazwa modułu"
|
|
|
|
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is not a valid unit name."
|
|
msgstr "\"%s\" nie jest prawidłową nazwą modułu."
|
|
|
|
#: lazarusidestrconsts.lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Nazwa nowej klasy:"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "Nowy plik"
|
|
|
|
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
#, object-pascal-format
|
|
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
|
msgstr "Nie znaleziono pakietu dla zależności \"%s\".%sWybierz istniejący pakiet."
|
|
|
|
#: lazarusidestrconsts.lisa2ppackageorproject
|
|
msgid "Package/Project"
|
|
msgstr "Pakiet/Projekt"
|
|
|
|
#: lazarusidestrconsts.lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Nazwa zakładki jest zbyt długa"
|
|
|
|
#: lazarusidestrconsts.lisa2ppalettepage
|
|
msgid "Palette page:"
|
|
msgstr "Zakładka palet:"
|
|
|
|
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr "Skracanie lub rozwijanie nazwy pliku"
|
|
|
|
#: lazarusidestrconsts.lisa2pshowall
|
|
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Pokaż wszystko"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
|
#, object-pascal-format
|
|
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Typ przodka \"%s\" ma taką samą nazwę jak%smoduł \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
#, object-pascal-format
|
|
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Typ przodka \"%s\" nie jest poprawnym identyfikatorem pascala."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
|
msgstr "Nazwa klasy \"%s\" i typ przodka \"%s\" są jednakowe."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
|
msgstr "Klasa o nazwie \"%s\" istnieje już w%spakiecie %s%sPlik: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Klasa \"%s\" ma taką samą nazwę jak%smoduł \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Nazwa klasy \"%s\" nie jest prawidłowym identyfikatorem Pascala."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "Plik \"%s\" należy już do bieżącego projektu.%sDzielenie pliku pomiędzy projektami i pakietami nie jest dobrym pomysłem."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
#, object-pascal-format
|
|
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maksymalny numer wersji jest mniejszy niż minimalny."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
|
#, object-pascal-format
|
|
msgid "The package already has a dependency on the package \"%s\"."
|
|
msgstr "Pakiet jest już zależny od pakietu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
|
#, object-pascal-format
|
|
msgid "The page name \"%s\" is too long (max 100 chars)."
|
|
msgstr "Nazwa zakładki \"%s\" jest zbyt długa (maks. 100 znaków)."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
|
#, object-pascal-format
|
|
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
|
msgstr "Moduł o nazwie \"%s\" już należy do pakietu:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
|
#, object-pascal-format
|
|
msgid "The unitname \"%s\" already exists in this package."
|
|
msgstr "W tym pakiecie jest już moduł o nazwie \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
|
msgstr "Nazwa modułu \"%s\"%s nie odpowiada nazwie pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgstr "Nazwa modułu \"%s\" jest taka sama jak nazwa zainstalowanego komponentu.%sJej użycie może spowodować nieokreślone błędy."
|
|
|
|
#: lazarusidestrconsts.lisa2punitname
|
|
msgid "Unit name:"
|
|
msgstr "Nazwa modułu:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Moduł o tej nazwie już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr "Porzucić zmiany?"
|
|
|
|
#: lazarusidestrconsts.lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr "Przerwij wczytywanie wszystkiego"
|
|
|
|
#: lazarusidestrconsts.lisaborted
|
|
msgid "Aborted"
|
|
msgstr "Przerwany"
|
|
|
|
#: lazarusidestrconsts.lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Przerwij ładowanie projektu"
|
|
|
|
#: lazarusidestrconsts.lisabout
|
|
msgctxt "lazarusidestrconsts.lisabout"
|
|
msgid "About"
|
|
msgstr "Informacja"
|
|
|
|
#: lazarusidestrconsts.lisabout2
|
|
#, object-pascal-format
|
|
msgid "About %s"
|
|
msgstr "Informacja o %s"
|
|
|
|
#: lazarusidestrconsts.lisaboutdocumentation
|
|
msgid "Documentation:"
|
|
msgstr "Dokumentacja:"
|
|
|
|
#: lazarusidestrconsts.lisaboutide
|
|
msgid "About IDE"
|
|
msgstr "O IDE"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "O programie Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarusmsg
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgctxt "lazarusidestrconsts.lisaboutlazarusmsg"
|
|
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
|
|
msgstr "Licencja: GPL/LGPL. Sprawdź licencje w plikach źródłowych .%sLazarus jest darmowym środowiskiem programistycznym, przeznaczonym do tworzenia aplikacji graficznych i konsolowych. Program napisany w środowisku %sLazarus można bez żadnych zmian skompilować dla dowolnego obsługiwanego procesora, systemu operacyjnego i interfejsu okienek. Jeśli jesteś zainteresowany rozwojem %sLazarusa , to dołącz do nas."
|
|
|
|
#: lazarusidestrconsts.lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Nie można znaleźć listy współautorów."
|
|
|
|
#: lazarusidestrconsts.lisaboutofficial
|
|
msgid "Official:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
#, object-pascal-format
|
|
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr "Podziękowania"
|
|
|
|
#: lazarusidestrconsts.lisaction
|
|
msgid "Action:"
|
|
msgstr "Akcja:"
|
|
|
|
#: lazarusidestrconsts.lisactivate
|
|
msgid "Activate"
|
|
msgstr "Aktywuj"
|
|
|
|
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivateselected
|
|
msgid "Activate Selected"
|
|
msgstr "Aktywuj zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lisactive
|
|
msgid "Active"
|
|
msgstr "Aktywny"
|
|
|
|
#: lazarusidestrconsts.lisactivefilter
|
|
msgid "Active Filter"
|
|
msgstr "Aktywny filtr"
|
|
|
|
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
|
|
msgid "Add a new separator above selected item"
|
|
msgstr "Dodaj nowy separator powyżej zaznaczonego elementu"
|
|
|
|
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
|
|
msgid "Add a new separator below selected item"
|
|
msgstr "Dodaj nowy separator poniżej zaznaczonego elementu"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefine
|
|
msgid "Add defines simulating Delphi7"
|
|
msgstr "Dodanie symboli symulujących Delphi7"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefinehint
|
|
msgid "Useful when the code has checks for supported compiler versions"
|
|
msgstr "Użyteczne gdy kod zawiera sprawdzenia zgodnych wersji kompilatora"
|
|
|
|
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
|
#, object-pascal-format
|
|
msgid "Added missing object \"%s\" to pascal source."
|
|
msgstr "Dodano brakujący obiekt \"%s\" do źródła Pascala."
|
|
|
|
#: lazarusidestrconsts.lisaddedpropertysfors
|
|
#, object-pascal-format
|
|
msgid "Added property \"%s\" for %s."
|
|
msgstr "Dodano właściwość \"%s\" do %s."
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8
|
|
msgid "Add -FcUTF8"
|
|
msgstr "Dodaj -FcUTF8"
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8hint
|
|
msgid "May be needed if source files have non-ansistring literals."
|
|
msgstr "Może być potrzebne jeżeli źródło zawiera znaki nie należące do ansistring."
|
|
|
|
#: lazarusidestrconsts.lisaddfilter
|
|
msgid "Add Filter ..."
|
|
msgstr "Dodaj filtr ..."
|
|
|
|
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
|
msgid "Addition does not fit the current message"
|
|
msgstr "Dodatek nie pasuje do bieżącego komunikatu"
|
|
|
|
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
|
msgid "Addition fits the current message"
|
|
msgstr "Dodatek pasuje do bieżącego komunikatu"
|
|
|
|
#: lazarusidestrconsts.lisadditions
|
|
msgid "Additions"
|
|
msgstr "Dodatki"
|
|
|
|
#: lazarusidestrconsts.lisaddkeyworddo
|
|
msgid "Add keyword \"do\""
|
|
msgstr "Dodaj słowo kluczowe \"do\""
|
|
|
|
#: lazarusidestrconsts.lisaddmodifieroverload
|
|
msgid "Add modifier \"overload\""
|
|
msgstr "Dodaj modyfikator \"overload\""
|
|
|
|
#: lazarusidestrconsts.lisaddmodifieroverride
|
|
msgid "Add modifier \"override\""
|
|
msgstr "Dodaj modyfikator \"override\""
|
|
|
|
#: lazarusidestrconsts.lisaddmodifierreintroduce
|
|
msgid "Add modifier \"reintroduce\""
|
|
msgstr "Dodaj modyfikator \"reintroduce\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
|
#, object-pascal-format
|
|
msgid "Add new build mode, copying settings from \"%s\""
|
|
msgstr "Dodaj nowy tryb budowania, kopia ustawień z \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewmacro
|
|
msgid "Add new macro"
|
|
msgstr "Dodaj nowe makro"
|
|
|
|
#: lazarusidestrconsts.lisaddnewset
|
|
msgid "Add new set"
|
|
msgstr "Dodaj nowy zestaw"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagerequirement
|
|
msgid "Add package requirement?"
|
|
msgstr "Dodać wymaganie pakietu?"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
|
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject2
|
|
msgid "Add package to project"
|
|
msgstr "Dodanie pakietu do projektu"
|
|
|
|
#: lazarusidestrconsts.lisaddparameterbrackets
|
|
msgid "Add parameter brackets"
|
|
msgstr "Dodaj nawiasy parametrów funkcji"
|
|
|
|
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
|
#, fuzzy
|
|
msgid "Add to include search path?"
|
|
msgstr "Dodać do katalogów modułów?"
|
|
|
|
#: lazarusidestrconsts.lisaddtoproject
|
|
#, object-pascal-format
|
|
msgid "Add %s to project?"
|
|
msgstr "Chcesz dodać %s do projektu?"
|
|
|
|
#: lazarusidestrconsts.lisaddtostartupcomponents
|
|
#, fuzzy
|
|
msgid "Add to startup components?"
|
|
msgstr "&Komponenty"
|
|
|
|
#: lazarusidestrconsts.lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr "Dodać do katalogów modułów?"
|
|
|
|
#: lazarusidestrconsts.lisaddunitinterfaces
|
|
#, fuzzy
|
|
msgid "Add unit interfaces"
|
|
msgstr "Dodaj moduł pakietu do sekcji uses"
|
|
|
|
#: lazarusidestrconsts.lisaddunitnotrecommended
|
|
msgid "Add unit (not recommended)"
|
|
msgstr "Dodaj moduł (nie zalecane)"
|
|
|
|
#: lazarusidestrconsts.lisaddvaluetomacro
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Add value to macro %s"
|
|
msgstr "Makro %s"
|
|
|
|
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
|
msgid "Add File to Package"
|
|
msgstr "Dodaj plik do pakietu"
|
|
|
|
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
|
msgid "Destination package"
|
|
msgstr "Pakiet docelowy"
|
|
|
|
#: lazarusidestrconsts.lisaf2pfiletype
|
|
msgid "File type"
|
|
msgstr "Typ pliku"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Błędny pakiet"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
|
#, object-pascal-format
|
|
msgid "Invalid package ID: \"%s\""
|
|
msgstr "Błędny identyfikator pakietu: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Pakiet jest dostępny tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" not found."
|
|
msgstr "Nie znaleziono pakietu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisaf2pshowall
|
|
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Pokaż wszystko"
|
|
|
|
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
|
#, object-pascal-format
|
|
msgid "The package %s is read only."
|
|
msgstr "Pakiet %s jest dostępny tylko do odczytu."
|
|
|
|
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
|
#, object-pascal-format
|
|
msgid "A file \"%s\" already exists.%sReplace it?"
|
|
msgstr "Plik \"%s\" już istnieje.%sCzy chcesz go zastąpić?"
|
|
|
|
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
|
#, object-pascal-format, fuzzy
|
|
msgid "A filter with the name \"%s\" already exists."
|
|
msgstr "Nazwa zakładki \"%s\" już istnieje. Nie dodano."
|
|
|
|
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
|
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
|
msgstr "Po wyczyszczeniu (opcje wszystko lub wspólne pliki) przełącz na czyszczenie automatyczne"
|
|
|
|
#: lazarusidestrconsts.lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Wyrównanie"
|
|
|
|
#: lazarusidestrconsts.lisallblockslooksok
|
|
msgid "All blocks look ok."
|
|
msgstr "Wszystkie bloki wyglądają dobrze."
|
|
|
|
#: lazarusidestrconsts.lisallbuildmodes
|
|
msgid "<All build modes>"
|
|
msgstr "<Wszystkie tryby budowania>"
|
|
|
|
#: lazarusidestrconsts.lisallinheritedoptions
|
|
msgid "All inherited options"
|
|
msgstr "Wszystkie dziedziczone opcje"
|
|
|
|
#: lazarusidestrconsts.lisalloptions
|
|
msgid "All Options"
|
|
msgstr "Wszystkie opcje"
|
|
|
|
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
|
#, fuzzy
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr "nie dopuszczaj wielu instancji"
|
|
|
|
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
|
msgid "All parameters of this function are already set at this call. Nothing to add."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
|
#, object-pascal-format
|
|
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalpha
|
|
msgid "Alpha"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr "Alternatywny klawisz"
|
|
|
|
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr "Alternatywny klawisz (lub sekwencja dwóch)"
|
|
|
|
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
|
msgid "Always convert suggested default file name to lowercase"
|
|
msgstr "Zawsze konwertuj sugerowaną domyślną nazwę pliku do małych liter"
|
|
|
|
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
|
msgid "Always draw selected items focused"
|
|
msgstr "Zawsze rysuj zaznaczenie wybranych elementów"
|
|
|
|
#: lazarusidestrconsts.lisalwaysignore
|
|
msgid "Always ignore"
|
|
msgstr "Zawsze ignoruj"
|
|
|
|
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
|
msgid "A macro with this name already exists."
|
|
msgstr "Makro o tej nazwie już istnieje."
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "Znaleziono dwuznaczny plik"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
#, object-pascal-format
|
|
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
|
msgstr "Znaleziono dwuznaczną nazwę pliku: \"%s\"%sTen plik może być pomylony z \"%s\"%sCzy chcesz usunąć dwuznaczy plik?"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilesfound
|
|
msgid "Ambiguous files found"
|
|
msgstr "Znaleziono dwuznaczny plik"
|
|
|
|
#: lazarusidestrconsts.lisambiguousunitfound
|
|
msgid "Ambiguous unit found"
|
|
msgstr "Znaleziono dwuznaczny moduł"
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
|
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtotopside
|
|
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr "Edytor zakotwiczeń - nie zaznaczono kontrolki"
|
|
|
|
#: lazarusidestrconsts.lisanchorenabledhint
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr "nie ma pliku include \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttoleftside
|
|
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttorightside
|
|
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttoleftside
|
|
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttorightside
|
|
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorsof
|
|
#, object-pascal-format
|
|
msgid "Anchors of %s"
|
|
msgstr "Zakotwiczenia %s"
|
|
|
|
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
|
#, fuzzy
|
|
msgid "Anchors of selected controls"
|
|
msgstr "Zaznaczony obszar"
|
|
|
|
#: lazarusidestrconsts.lisanchortoptobottomside
|
|
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortoptotopside
|
|
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
|
|
#, object-pascal-format
|
|
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisappearance
|
|
msgid "Appearance"
|
|
msgstr "Wygląd"
|
|
|
|
#: lazarusidestrconsts.lisapplicationclassname
|
|
msgid "&Application class name"
|
|
msgstr "Nazwa klasy &aplikacji"
|
|
|
|
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
|
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
|
msgstr "Graficzna aplikacja Free Pascala używająca wieloplatformowego LCL do GUI."
|
|
|
|
#: lazarusidestrconsts.lisapply
|
|
msgctxt "lazarusidestrconsts.lisapply"
|
|
msgid "Apply"
|
|
msgstr "Zastosuj"
|
|
|
|
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
|
msgid "apply build flags (-B) to dependencies too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplyconventions
|
|
msgid "Apply conventions"
|
|
msgstr "Trzymaj się konwencji"
|
|
|
|
#: lazarusidestrconsts.lisapplyconventionshint
|
|
msgid "Adjust name extension and character case for platform and file type."
|
|
msgstr "Dostosuj rozszerzenie nazwy i wielkość znaków do platformy i typu pliku."
|
|
|
|
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
|
msgid "A project unit can not be used by other packages/projects"
|
|
msgstr "Moduł projektu nie może być użyty przez inne pakiety/projekty"
|
|
|
|
#: lazarusidestrconsts.lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr "Pytaj przed zamienieniem każdego znalezionego tekstu"
|
|
|
|
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
|
msgid "Ask before saving project's session"
|
|
msgstr "Pytaj przed zapisem sesji projektu"
|
|
|
|
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
|
msgid "Ask for component name after putting it on a designer form."
|
|
msgstr "Pytaj o nazwę komponentu po położeniu go na formularzu."
|
|
|
|
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
|
msgid "Ask for file name on new file"
|
|
msgstr "Pytaj o nazwę pliku gdy nowy"
|
|
|
|
#: lazarusidestrconsts.lisasknameoncreate
|
|
msgid "Ask name on create"
|
|
msgstr "Pytaj o nazwę przy tworzeniu"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheight
|
|
msgid "Automatically adjust IDE main window height"
|
|
msgstr "Automatycznie dopasuj wysokość głównego okna IDE"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
|
msgid "Show complete component palette"
|
|
msgstr "Pokaż kompletną paletę komponentów"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
|
msgid "If component palette spans over more lines, show them all and not only one."
|
|
msgstr "Jeżeli paleta komponentów zajmuje więcej wierszy, pokaż je wszystkie, a nie tylko jedną."
|
|
|
|
#: lazarusidestrconsts.lisautocompletionoff
|
|
msgid "Auto completion: off"
|
|
msgstr "Automatyczne wypełnienie: wyłączone"
|
|
|
|
#: lazarusidestrconsts.lisautocompletionon
|
|
msgid "Auto completion: on"
|
|
msgstr "Automatyczne wypełnienie: włączone"
|
|
|
|
#: lazarusidestrconsts.lisautomarkup
|
|
msgid "Markup and Matches"
|
|
msgstr "Zaznaczenie i dopasowania"
|
|
|
|
#: lazarusidestrconsts.lisautomatic
|
|
msgctxt "lazarusidestrconsts.lisautomatic"
|
|
msgid "Automatic"
|
|
msgstr "Automatycznie"
|
|
|
|
#: lazarusidestrconsts.lisautomatically
|
|
msgid "Automatically"
|
|
msgstr "Automatycznie"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
|
msgid "Automatically convert .lfm files to .lrs resource files"
|
|
msgstr "Automatycznie konwertuj pliki .lfm na pliki zasobów .lrs"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
|
#, fuzzy
|
|
msgid "do not complete selection"
|
|
msgstr "Zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
|
msgid "Automatically invoke after point"
|
|
msgstr "Automatycznie wywołaj po kropce"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontype
|
|
msgid "Automatically invoke on typing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
|
|
msgid "Only complete if word is longer or equal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
|
|
msgid "Only complete when at end of word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
|
|
msgid "Use completion box delay"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
|
#, fuzzy
|
|
msgid "line break"
|
|
msgstr "Zawiń wiersz i pozostaw kursor"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr "spacja"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyontab
|
|
#, fuzzy
|
|
msgid "tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr "koniec słowa"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr "nie dodaj znaku"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
|
msgid "Automatically use single possible identifier"
|
|
msgstr "Automatycznie użyj jedyny możliwy identyfikator"
|
|
|
|
#: lazarusidestrconsts.lisautomaticfeatures
|
|
msgid "Completion and Hints"
|
|
msgstr "Uzupełnienia i podpowiedzi"
|
|
|
|
#: lazarusidestrconsts.lisautoshowobjectinspector
|
|
msgid "Auto show"
|
|
msgstr "Automatycznie pokaż"
|
|
|
|
#: lazarusidestrconsts.lisavailableforinstallation
|
|
msgid "Available for installation"
|
|
msgstr "Pakiety do zainstalowania"
|
|
|
|
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
|
msgid "Available project build modes:"
|
|
msgstr "Dostępne tryby budowania:"
|
|
|
|
#: lazarusidestrconsts.lisbackupchangedfiles
|
|
msgid "Make backup of changed files"
|
|
msgstr "Twórz zapasowę kopie zmienianych plików"
|
|
|
|
#: lazarusidestrconsts.lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Nie można utworzyć kopii zapasowej pliku"
|
|
|
|
#: lazarusidestrconsts.lisbackuphint
|
|
msgid "Creates a Backup directory under project directory"
|
|
msgstr "Tworzy katalog kopii zapasowej w katalogu projektu"
|
|
|
|
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
|
#, object-pascal-format
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Zmiana nazwy pakietu lub wersji łamie zależności. Czy te zależności powinny także zostać zmienione? %sWybierz Tak aby zmienić wszystkie podane zależności.%sWybierz Ignoruj aby złamać zależności i kontynuować."
|
|
|
|
#: lazarusidestrconsts.lisbegins
|
|
msgid "begins"
|
|
msgstr "rozpoczyna"
|
|
|
|
#: lazarusidestrconsts.lisbehindrelated
|
|
msgid "Behind related"
|
|
msgstr "Za spokrewnionym"
|
|
|
|
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
|
msgid "be less verbose, can be given multiple times"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
|
msgid "be more verbose, can be given multiple times"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
|
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
|
msgstr "Najlepiej wygląda po zainstalowaniu kontrolki HTML takiej jak turbopoweriprodsgn"
|
|
|
|
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
|
msgid "Always build before run"
|
|
msgstr "Zawsze buduj przed uruchomieniem"
|
|
|
|
#: lazarusidestrconsts.lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr "Polecenie budowania"
|
|
|
|
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr "Przy budowaniu projektu wykonaj polecenie Build File"
|
|
|
|
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr "Przy uruchamianiu projektu wykonaj polecenie Run File"
|
|
|
|
#: lazarusidestrconsts.lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr "Polecenie uruchomienia"
|
|
|
|
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
|
msgid "When this file is active in source editor"
|
|
msgstr "Gdy ten plik jest aktywny w edytorze"
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
|
msgid "Working directory (leave empty for file path)"
|
|
msgstr "Katalog roboczy (pusty oznacza ścieżkę pliku)"
|
|
|
|
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
|
msgid "Bold non default values"
|
|
msgstr "Pogrub wartości nie domyślne"
|
|
|
|
#: lazarusidestrconsts.lisborderspace
|
|
msgid "Border space"
|
|
msgstr "Odstęp"
|
|
|
|
#: lazarusidestrconsts.lisbottom
|
|
msgctxt "lazarusidestrconsts.lisbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dół"
|
|
|
|
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr "Dolny odstęp obramowania. Wartość dodawana do odstępu podstawowego poniżej kontrolki."
|
|
|
|
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Dolne umocowanie"
|
|
|
|
#: lazarusidestrconsts.lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr "Wyrównaj dolne krawędzie"
|
|
|
|
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr "Rozmieść dolne krawędzie równomiernie"
|
|
|
|
#: lazarusidestrconsts.lisbrowseandselectacompiler
|
|
msgid "Browse and select a compiler (e.g. ppcx64"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnapply
|
|
msgid "&Apply"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnclose
|
|
msgctxt "lazarusidestrconsts.lisbtnclose"
|
|
msgid "&Close"
|
|
msgstr "&Zamknij"
|
|
|
|
#: lazarusidestrconsts.lisbtndlgreplace
|
|
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
|
msgid "&Replace ..."
|
|
msgstr "Z&amień..."
|
|
|
|
#: lazarusidestrconsts.lisbtnfind
|
|
msgid "&Find"
|
|
msgstr "&Znajdź"
|
|
|
|
#: lazarusidestrconsts.lisbtnquit
|
|
msgctxt "lazarusidestrconsts.lisbtnquit"
|
|
msgid "&Quit"
|
|
msgstr "Wyjdź"
|
|
|
|
#: lazarusidestrconsts.lisbtnremove
|
|
msgctxt "lazarusidestrconsts.lisbtnremove"
|
|
msgid "&Remove"
|
|
msgstr "&Usuń"
|
|
|
|
#: lazarusidestrconsts.lisbtnrename
|
|
msgid "&Rename"
|
|
msgstr "Zmień nazwę"
|
|
|
|
#: lazarusidestrconsts.lisbtnreplace
|
|
msgid "&Replace"
|
|
msgstr "Zamień"
|
|
|
|
#: lazarusidestrconsts.lisbuild
|
|
msgctxt "lazarusidestrconsts.lisbuild"
|
|
msgid "Build"
|
|
msgstr "Buduj"
|
|
|
|
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
|
msgid "build all files of project/package/IDE"
|
|
msgstr "buduj wszystkie pliki projektu/pakietu/IDE"
|
|
|
|
#: lazarusidestrconsts.lisbuildcaption
|
|
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
|
msgid "Build"
|
|
msgstr "Buduj"
|
|
|
|
#: lazarusidestrconsts.lisbuildide
|
|
msgid "Build IDE"
|
|
msgstr "Buduj IDE"
|
|
|
|
#: lazarusidestrconsts.lisbuildidewithpackages
|
|
msgid "build IDE with packages"
|
|
msgstr "buduj IDE z pakietami"
|
|
|
|
#: lazarusidestrconsts.lisbuilding
|
|
msgid "Building"
|
|
msgstr "Budowanie"
|
|
|
|
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
|
msgid "Building Lazarus failed"
|
|
msgstr "Budowanie Lazarusa nie powiodło się"
|
|
|
|
#: lazarusidestrconsts.lisbuildmode
|
|
#, object-pascal-format
|
|
msgid "Build Mode: %s"
|
|
msgstr "Tryb budowania: %s"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
|
msgid "Differences between build modes"
|
|
msgstr "Różnice między trybami budowania"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
|
msgid "Differences from other build modes"
|
|
msgstr "Różnice między różnymi trybami budowania"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffmode
|
|
msgid "Mode:"
|
|
msgstr "Tryb:"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodeintitleinexample
|
|
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodes
|
|
msgid "Build modes"
|
|
msgstr "Tryby budowania"
|
|
|
|
#: lazarusidestrconsts.lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Utwórz nowy projekt"
|
|
|
|
#: lazarusidestrconsts.lisbuildnumber
|
|
msgid "Build number"
|
|
msgstr "Numer kompilacji"
|
|
|
|
#: lazarusidestrconsts.lisbuildstage
|
|
msgctxt "lazarusidestrconsts.lisbuildstage"
|
|
msgid "Build"
|
|
msgstr "Buduj"
|
|
|
|
#: lazarusidestrconsts.lisbusy
|
|
msgid "Busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbyte
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%s byte"
|
|
msgstr "%s nie istnieje: %s"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr "Pomiń ładowanie tego komponentu"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Pomiń ładowanie modułu"
|
|
|
|
#: lazarusidestrconsts.liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr "Anuluj zmiany nazw"
|
|
|
|
#: lazarusidestrconsts.liscannotcompileproject
|
|
msgid "Cannot compile project"
|
|
msgstr "Nie można skompilować projektu"
|
|
|
|
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
|
msgid "Cannot copy top level component."
|
|
msgstr "Nie można skopiować komponentu najwyższego poziomu."
|
|
|
|
#: lazarusidestrconsts.liscannotcreatefile
|
|
#, object-pascal-format
|
|
msgid "Cannot create file \"%s\""
|
|
msgstr "Nie można utworzyć pliku \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotdeletelastmode
|
|
msgid "Cannot delete last mode."
|
|
msgstr "Nie można usunąć ostatniego trybu."
|
|
|
|
#: lazarusidestrconsts.liscannotexecute
|
|
#, object-pascal-format
|
|
msgid "cannot execute \"%s\""
|
|
msgstr "nie można uruchomić \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotfind
|
|
#, object-pascal-format
|
|
msgid "Cannot find %s"
|
|
msgstr "Nie można znaleźć %s"
|
|
|
|
#: lazarusidestrconsts.liscannotfindexecutable
|
|
#, object-pascal-format
|
|
msgid "cannot find executable \"%s\""
|
|
msgstr "nie można znaleźć pliku uruchomieniowego\"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
|
#, object-pascal-format
|
|
msgid "Cannot find Lazarus starter:%s%s"
|
|
msgstr "Nie można znaleźć startera Lazarusa:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscannotopenform
|
|
#, object-pascal-format
|
|
msgid "Cannot open form \"%s\"."
|
|
msgstr "Nie można otworzyć formularza \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscannotsaveform
|
|
#, object-pascal-format
|
|
msgid "Cannot save form \"%s\"."
|
|
msgstr "Nie można zapisać formularza \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscannotsubstitutemacros
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Cannot substitute macro \"%s\"."
|
|
msgstr "Makro IDE %s:=%s"
|
|
|
|
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
|
msgid "Cannot test the compiler while debugging or compiling."
|
|
msgstr "Nie można przetestować kompilatora w czasie odpluskwiania i kompilacji."
|
|
|
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr "Można tylko zmienić klasę TComponents."
|
|
|
|
#: lazarusidestrconsts.liscantfindavalidppu
|
|
#, object-pascal-format
|
|
msgid "Can't find a valid %s.ppu"
|
|
msgstr "Nie można znaleźć prawidłowego %s.ppu"
|
|
|
|
#: lazarusidestrconsts.liscaptioncomparefiles
|
|
msgid "Compare files (not for creating patches)"
|
|
msgstr "Porównaj pliki (nie nadaje się do tworzenia łat)"
|
|
|
|
#: lazarusidestrconsts.liscbpfiles
|
|
#, object-pascal-format
|
|
msgid "%s (%s files)"
|
|
msgstr "%s (%s pliki)"
|
|
|
|
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
|
#, object-pascal-format
|
|
msgid "Really delete %s source files%s%s"
|
|
msgstr "Czy na pewno chcesz usunąć %s pliki źródłowe%s%s"
|
|
|
|
#: lazarusidestrconsts.lisccdchangeclassof
|
|
#, object-pascal-format
|
|
msgid "Change Class of %s"
|
|
msgstr "Zmień klasę %s"
|
|
|
|
#: lazarusidestrconsts.lisccdnoclass
|
|
msgid "no class"
|
|
msgstr "bez klasy"
|
|
|
|
#: lazarusidestrconsts.lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr "Niejednoznaczny kompilator"
|
|
|
|
#: lazarusidestrconsts.lisccochecktestdir
|
|
#, object-pascal-format
|
|
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocompilernotanexe
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr "Plik wykonywalny kompilatora (%s)"
|
|
|
|
#: lazarusidestrconsts.lisccocontains
|
|
msgid "contains "
|
|
msgstr "zawiera "
|
|
|
|
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr "Kopiuj wszystkie komunikaty do schowka"
|
|
|
|
#: lazarusidestrconsts.lisccodatesdiffer
|
|
#, object-pascal-format
|
|
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoerrorcaption
|
|
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
|
msgid "Error"
|
|
msgstr "Błąd"
|
|
|
|
#: lazarusidestrconsts.lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr "BŁĄD: "
|
|
|
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr "symbole nowego wiersza"
|
|
|
|
#: lazarusidestrconsts.lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr "WSKAZÓWKA: "
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr "Nieprawidłowy kompilator"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr "Nieprawidłowa ścieżka wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr "Nieprawidłowy katalog testowy"
|
|
|
|
#: lazarusidestrconsts.lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr "Brakujące moduły"
|
|
|
|
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
|
|
#, object-pascal-format
|
|
msgid "RTL unit not found: %s"
|
|
msgstr "Nie znaleziono modułu RTL: %s"
|
|
|
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr "znaleziono wiele konfiguracji kompilatora: "
|
|
|
|
#: lazarusidestrconsts.liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr "nie znaleziono fpc.cfg"
|
|
|
|
#: lazarusidestrconsts.lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr "nie ASCII"
|
|
|
|
#: lazarusidestrconsts.lisccoppuexiststwice
|
|
#, object-pascal-format
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr "ppu występuje dwa razy: %s, %s"
|
|
|
|
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
|
#, object-pascal-format
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr "Plik .ppu jest starszy niż kompilator:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
|
|
#, object-pascal-format
|
|
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoseveralcompilers
|
|
#, object-pascal-format
|
|
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr "Kilka kompilatorów Free Pascala jest dostępnych w ścieżce.%s%s%sMoże nie skasowano starego kompilatora?"
|
|
|
|
#: lazarusidestrconsts.lisccoskip
|
|
msgctxt "lazarusidestrconsts.lisccoskip"
|
|
msgid "Skip"
|
|
msgstr "Pomiń"
|
|
|
|
#: lazarusidestrconsts.lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr "znaki spacjalne"
|
|
|
|
#: lazarusidestrconsts.lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr "Wszystkie testy pozytywne."
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
|
#, fuzzy
|
|
msgid "Unable to create Test File"
|
|
msgstr "Nie można utworzyć pliku \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
|
#, object-pascal-format
|
|
msgid "Unable to create Test Pascal file \"%s\"."
|
|
msgstr "Nie można utworzyć pliku testowego Pascala \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr "znaki nietypowe"
|
|
|
|
#: lazarusidestrconsts.lisccowarningcaption
|
|
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
|
msgid "Warning"
|
|
msgstr "Ostrzeżenie"
|
|
|
|
#: lazarusidestrconsts.lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr "OSTRZEŻENIE: "
|
|
|
|
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr "nieprawidłowy separator ścieżki"
|
|
|
|
#: lazarusidestrconsts.liscecategories
|
|
msgid "Categories"
|
|
msgstr "Kategorie"
|
|
|
|
#: lazarusidestrconsts.liscecomplexitygroup
|
|
msgid "Complexity"
|
|
msgstr "Złożoność"
|
|
|
|
#: lazarusidestrconsts.lisceconstants
|
|
msgid "Constants"
|
|
msgstr "Stałe"
|
|
|
|
#: lazarusidestrconsts.lisceemptyblocks
|
|
msgid "Empty blocks"
|
|
msgstr "Puste bloki"
|
|
|
|
#: lazarusidestrconsts.lisceemptyclasssections
|
|
msgid "Empty class sections"
|
|
msgstr "Puste sekcje klas"
|
|
|
|
#: lazarusidestrconsts.lisceemptygroup
|
|
msgid "Empty constructs"
|
|
msgstr "Puste konstruktory"
|
|
|
|
#: lazarusidestrconsts.lisceemptyprocedures
|
|
msgid "Empty procedures"
|
|
msgstr "Puste procedury"
|
|
|
|
#: lazarusidestrconsts.liscefilter
|
|
msgid "(filter)"
|
|
msgstr "(filtr)"
|
|
|
|
#: lazarusidestrconsts.liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr "Podążaj za kursorem"
|
|
|
|
#: lazarusidestrconsts.liscein
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.liscein"
|
|
msgid "%s in %s"
|
|
msgstr "%s w %s"
|
|
|
|
#: lazarusidestrconsts.lisceisarootcontrol
|
|
#, fuzzy
|
|
msgid "Is a root control"
|
|
msgstr "Katalog główny"
|
|
|
|
#: lazarusidestrconsts.liscelongparamlistcount
|
|
msgid "Parameters count treated as \"many\""
|
|
msgstr "Liczba parametrów traktowana jako \"dużo\""
|
|
|
|
#: lazarusidestrconsts.liscelongprocedures
|
|
msgid "Long procedures"
|
|
msgstr "Długie procedury"
|
|
|
|
#: lazarusidestrconsts.liscelongproclinecount
|
|
msgid "Line count of procedure treated as \"long\""
|
|
msgstr "Liczba linii, powyżej której procedura uznawana jest za \"długą\""
|
|
|
|
#: lazarusidestrconsts.liscemanynestedprocedures
|
|
msgid "Many nested procedures"
|
|
msgstr "Zbyt dużo poziomów zagnieżdżeń procedur"
|
|
|
|
#: lazarusidestrconsts.liscemanyparameters
|
|
msgid "Many parameters"
|
|
msgstr "Zbyt duża liczba parametrów"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr "Pokaż kategorie"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
|
#, fuzzy
|
|
msgid "Show Source Nodes"
|
|
msgstr "Zwiń wszystkie węzły"
|
|
|
|
#: lazarusidestrconsts.liscenestedproccount
|
|
msgid "Nested procedures count treated as \"many\""
|
|
msgstr "Poziomy zagnieżdżeń procedur traktowane jako \"dużo\""
|
|
|
|
#: lazarusidestrconsts.liscenteralostwindow
|
|
msgid "Center a lost window"
|
|
msgstr "Wyśrodkuj zagubione okno"
|
|
|
|
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
|
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
|
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenterform
|
|
msgid "Center Form"
|
|
msgstr "Wyśrodkuj formularz"
|
|
|
|
#: lazarusidestrconsts.liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Wyśrodkuj w oknie"
|
|
|
|
#: lazarusidestrconsts.liscenters
|
|
msgid "Centers"
|
|
msgstr "Środki"
|
|
|
|
#: lazarusidestrconsts.lisceomode
|
|
msgid "Preferred exhibition mode"
|
|
msgstr "Preferowany tryp pokazywania"
|
|
|
|
#: lazarusidestrconsts.lisceomodecategory
|
|
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
|
msgid "Category"
|
|
msgstr "Kategoria"
|
|
|
|
#: lazarusidestrconsts.lisceomodesource
|
|
msgctxt "lazarusidestrconsts.lisceomodesource"
|
|
msgid "Source"
|
|
msgstr "Źródło"
|
|
|
|
#: lazarusidestrconsts.lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Nigdy, tylko ręcznie"
|
|
|
|
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr "Wykorzystywane tylko w trybie kategorii"
|
|
|
|
#: lazarusidestrconsts.lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "Podczas działania"
|
|
|
|
#: lazarusidestrconsts.lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Automatycznie odświeżaj"
|
|
|
|
#: lazarusidestrconsts.lisceothergroup
|
|
msgctxt "lazarusidestrconsts.lisceothergroup"
|
|
msgid "Other"
|
|
msgstr "Inne"
|
|
|
|
#: lazarusidestrconsts.lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Aktualizacja"
|
|
|
|
#: lazarusidestrconsts.lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Przy przełączeniu pliku w edytorze"
|
|
|
|
#: lazarusidestrconsts.lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr "Procedury"
|
|
|
|
#: lazarusidestrconsts.lisceproperties
|
|
msgctxt "lazarusidestrconsts.lisceproperties"
|
|
msgid "Properties"
|
|
msgstr "Właściwości"
|
|
|
|
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
|
msgid "Published properties without default"
|
|
msgstr "Puplikowane właścowości bez wartości domyślnej"
|
|
|
|
#: lazarusidestrconsts.lisceshowcodeobserver
|
|
msgid "Show observations about"
|
|
msgstr "Pokaż obserwacje o"
|
|
|
|
#: lazarusidestrconsts.liscestylegroup
|
|
msgctxt "lazarusidestrconsts.liscestylegroup"
|
|
msgid "Style"
|
|
msgstr "Styl"
|
|
|
|
#: lazarusidestrconsts.liscesurrounding
|
|
msgid "Surrounding"
|
|
msgstr "Otaczanie"
|
|
|
|
#: lazarusidestrconsts.liscetodos
|
|
msgid "ToDos"
|
|
msgstr "Do zrobienia"
|
|
|
|
#: lazarusidestrconsts.liscetypes
|
|
msgid "Types"
|
|
msgstr "Typy"
|
|
|
|
#: lazarusidestrconsts.lisceunnamedconstants
|
|
msgid "Unnamed constants"
|
|
msgstr "Nienazwane stałe"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedmembers
|
|
msgid "Unsorted members"
|
|
msgstr "Nieposortowane składowe klas"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedvisibility
|
|
msgid "Unsorted visibility"
|
|
msgstr "Nieposortowane sekcje widoczności klas"
|
|
|
|
#: lazarusidestrconsts.lisceuses
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisceuses"
|
|
msgid "Uses"
|
|
msgstr "Wstaw do sekcji Uses"
|
|
|
|
#: lazarusidestrconsts.liscevariables
|
|
msgid "Variables"
|
|
msgstr "Zmienne"
|
|
|
|
#: lazarusidestrconsts.liscewrongindentation
|
|
msgid "Wrong indentation"
|
|
msgstr "Błędne wcięcia"
|
|
|
|
#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
|
|
#, object-pascal-format
|
|
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
|
msgstr "Wystąpił wyjątek podczas kasowania %s\"%s:%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
|
msgid "Do not know how to copy this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
|
msgid "Do not know how to cut this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
|
msgid "Do not know how to delete this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
|
msgid "Error creating component"
|
|
msgstr "Błąd tworzenia komponentu"
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
|
#, object-pascal-format
|
|
msgid "Error creating component: %s%s%s"
|
|
msgstr "Błąd przy tworzeniu komponentu: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
|
msgid "Error destroying component"
|
|
msgstr "Błąd zwalniania komponentu"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
|
#, object-pascal-format
|
|
msgid "Error destroying component of type %s of unit %s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
|
#, fuzzy
|
|
msgid "Error destroying mediator"
|
|
msgstr "Wiersz błędu"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
|
#, object-pascal-format
|
|
msgid "Error destroying mediator %s of unit %s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeinfile
|
|
#, object-pascal-format
|
|
msgid "In file %s"
|
|
msgstr "W pliku %s"
|
|
|
|
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
|
msgid "Invalid component owner"
|
|
msgstr "Nieprawidłowy właściciel komponentu"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
|
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
|
msgstr "TCustomFormEditor.CreateNonFormForm już istnieje"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
|
#, object-pascal-format
|
|
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
|
msgstr "TCustomFormEditor.CreateNonFormForm nieznanego typu %s"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
|
#, object-pascal-format
|
|
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
|
#, object-pascal-format, fuzzy
|
|
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
|
msgstr "Identyfikator %s jest już zdefiniowany"
|
|
|
|
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
|
msgstr "Edytor komponentu klasy \"%s\"wywołał błąd:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
|
#, object-pascal-format
|
|
msgid "The component of type %s failed to set its owner to %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
|
#, object-pascal-format
|
|
msgid "Unable to clear the form editing selection%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischange
|
|
msgctxt "lazarusidestrconsts.lischange"
|
|
msgid "Change"
|
|
msgstr "Zmień"
|
|
|
|
#: lazarusidestrconsts.lischangebuildmode
|
|
msgid "Change build mode"
|
|
msgstr "Zmień tryb budowania"
|
|
|
|
#: lazarusidestrconsts.lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Zmień klasę"
|
|
|
|
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
|
#, object-pascal-format
|
|
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr "Zmień kodowanie"
|
|
|
|
#: lazarusidestrconsts.lischangefile
|
|
msgid "Change file"
|
|
msgstr "Zmień plik"
|
|
|
|
#: lazarusidestrconsts.lischangeparent
|
|
msgid "Change Parent"
|
|
msgstr "Zmień rodzica"
|
|
|
|
#: lazarusidestrconsts.lischangeswerenotsaved
|
|
msgid "Changes were not saved"
|
|
msgstr "Nie zapisano zmian"
|
|
|
|
#: lazarusidestrconsts.lischangetounix
|
|
msgid "Change to Unix /"
|
|
msgstr "Konwertuj do formatu Unix /"
|
|
|
|
#: lazarusidestrconsts.lischangetowindows
|
|
msgid "Change to Windows \\"
|
|
msgstr "Konwertuj do formatu Windows \\"
|
|
|
|
#: lazarusidestrconsts.lischeckall
|
|
msgid "Check All"
|
|
msgstr "Zaznacz wszystkie"
|
|
|
|
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
|
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
|
|
msgid "Check for disk file changes via content rather than timestamp"
|
|
msgstr "Sprawdzanie zmian pliku na dysku na podstawie zawartości a nie znacznika czasu"
|
|
|
|
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
|
#, object-pascal-format
|
|
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
|
|
msgid ". Check if package %s is in the dependencies"
|
|
msgstr ". Sprawdź czy pakiet %s jest w zależnościach"
|
|
|
|
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
|
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckoptions
|
|
msgid "Check options"
|
|
msgstr "Sprawdzenie opcji"
|
|
|
|
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
|
|
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
|
|
msgid "Check the next token in source and add a semicolon if needed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
|
#, object-pascal-format
|
|
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckuncheckall
|
|
msgid "Check/uncheck all"
|
|
msgstr "Zaznacz/odznacz wszystkie"
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname
|
|
msgid "Choose a different name"
|
|
msgstr "Wybierz inną nazwę"
|
|
|
|
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
|
msgid "Choose a file with CodeTools templates"
|
|
msgstr "Wybierz plik z szablonami CodeTools"
|
|
|
|
#: lazarusidestrconsts.lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr "Wybierz łącze do FPDoc"
|
|
|
|
#: lazarusidestrconsts.lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr "Wybierz klawisz..."
|
|
|
|
#: lazarusidestrconsts.lischooseanameforthecomponent
|
|
msgid "Choose a name for the component"
|
|
msgstr "Wybierz nazwę komponentu"
|
|
|
|
#: lazarusidestrconsts.lischooseanexamplefile
|
|
msgid "Choose an example file"
|
|
msgstr "Wybierz przykładowy plik"
|
|
|
|
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
|
msgid "Choose an FPC message file"
|
|
msgstr "Wybierz plik z komunikatami dla FPC"
|
|
|
|
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
|
msgid "Choose a Pascal file for indentation examples"
|
|
msgstr "Wybierz plik Pascala dla przykładu wcięć"
|
|
|
|
#: lazarusidestrconsts.lischoosecompilerexecutable
|
|
#, object-pascal-format
|
|
msgid "Choose compiler executable (%s)"
|
|
msgstr "Wybierz plik wykonywalny kompilatora (%s)"
|
|
|
|
#: lazarusidestrconsts.lischoosecompilermessages
|
|
msgid "Choose compiler messages file"
|
|
msgstr "Wybierz plik z komunikatami kompilatora"
|
|
|
|
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
|
msgid "Choose debugger executable"
|
|
msgstr "Wybierz plik wykonywalny odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr "Wybierz pakiet Delphi (*.dpk)"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr "Wybierz projekt Delphi (*.dpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Wybierz moduł Delphi (*.pas)"
|
|
|
|
#: lazarusidestrconsts.lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Wybierz katalog"
|
|
|
|
#: lazarusidestrconsts.lischooseexecutable
|
|
msgid "Choose an executable"
|
|
msgstr "Wybierz plik wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "Wybierz katalog źródeł FPC"
|
|
|
|
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Wybierz katalog Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lischoosemakeexecutable
|
|
msgid "Choose \"make\" executable"
|
|
msgstr "Wybierz plik wykonywalny \"make\""
|
|
|
|
#: lazarusidestrconsts.lischoosenameandtext
|
|
msgid "Choose name and text"
|
|
msgstr "Wybierz nazwę i tekst"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr "Wybierz jeden z tych elementów aby utworzyć nowy plik"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr "Wybierz jeden z tych elementów aby utworzyć nowy pakiet"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr "Wybierz jeden z tych elementów aby utworzyć nowy projekt"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr "Wybierz jeden z tych elementów aby dziedziczyć z istniejącego"
|
|
|
|
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Wybierz źródło programu (*.pp,*.pas,*.lpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Wybierz strukturę do zamknięcia zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr "Wybierz katalog do testów"
|
|
|
|
#: lazarusidestrconsts.liscirculardependencydetected
|
|
msgid "Circular dependency detected"
|
|
msgstr "Wykryto cykliczną zależność"
|
|
|
|
#: lazarusidestrconsts.lisclass
|
|
msgid "&Class"
|
|
msgstr "Klasa"
|
|
|
|
#: lazarusidestrconsts.lisclasscompletion
|
|
msgid "Class Completion"
|
|
msgstr "Wypełnianie klas"
|
|
|
|
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
|
msgid "Classes and properties exist. Values were not checked."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
|
#, object-pascal-format
|
|
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Klasa nie została znaleziona"
|
|
|
|
#: lazarusidestrconsts.lisclassnotfoundat
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Class %s not found at %s(%s,%s)"
|
|
msgstr "Nie znaleziono obiektu klasy \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisclassofmethodnotfound
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Class \"%s\" of method \"%s\" not found."
|
|
msgstr "Nie znaleziono klasy \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscldirclean
|
|
msgid "Clean"
|
|
msgstr "Wyczyść"
|
|
|
|
#: lazarusidestrconsts.liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr "Wyczyść katalogi"
|
|
|
|
#: lazarusidestrconsts.liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Czyść podkatalogi"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Zachowaj wszystkie pliki tekstowe"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Zachowaj wybrane pliki"
|
|
|
|
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Usuń wyselekcjonowane pliki"
|
|
|
|
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Uproszczona składnia (np. * zamiast .*)"
|
|
|
|
#: lazarusidestrconsts.liscleanall
|
|
msgid "Clean all"
|
|
msgstr "Wyczyść wszystko"
|
|
|
|
#: lazarusidestrconsts.liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Czyść źródła Lazarusa (clean)"
|
|
|
|
#: lazarusidestrconsts.liscleanonlyonce
|
|
msgid "Switch after building to automatically"
|
|
msgstr "Po budowaniu przełącz na automatyczne"
|
|
|
|
#: lazarusidestrconsts.liscleanup
|
|
msgid "Clean up"
|
|
msgstr "Czyszczenie"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Wyczyść i buduj"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuildproject
|
|
msgid "Clean up and build project"
|
|
msgstr "Wyczyść i buduj projekt"
|
|
|
|
#: lazarusidestrconsts.liscleanuplazbuild
|
|
msgid "Clean up + lazbuild"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanuppackage
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Clean up package \"%s\"."
|
|
msgstr "Wyczyść zależności pakietu"
|
|
|
|
#: lazarusidestrconsts.liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr "Wyczyścić ścieżkę modułów?"
|
|
|
|
#: lazarusidestrconsts.lisclear
|
|
msgctxt "lazarusidestrconsts.lisclear"
|
|
msgid "Clear"
|
|
msgstr "Czyść"
|
|
|
|
#: lazarusidestrconsts.liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr "Wyczyścić katalog?"
|
|
|
|
#: lazarusidestrconsts.lisclearfilter
|
|
msgid "Clear filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclearthefilterforoptions
|
|
msgid "Clear the filter for options"
|
|
msgstr "Wyczyść filtr opcji"
|
|
|
|
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr "Kliknij tutaj aby przeglądać plik"
|
|
|
|
#: lazarusidestrconsts.lisclicktoseethechoices
|
|
msgid "Click to see the choices"
|
|
msgstr "Kliknij aby zobaczyć możliwości wyboru"
|
|
|
|
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
|
msgid "Click to Select Palette Page"
|
|
msgstr "Kliknij aby wybrać stronę palety"
|
|
|
|
#: lazarusidestrconsts.lisclone
|
|
msgid "Clone"
|
|
msgstr "Klonuj"
|
|
|
|
#: lazarusidestrconsts.lisclose
|
|
msgctxt "lazarusidestrconsts.lisclose"
|
|
msgid "Close"
|
|
msgstr "Zamknij"
|
|
|
|
#: lazarusidestrconsts.liscloseall
|
|
msgctxt "lazarusidestrconsts.liscloseall"
|
|
msgid "Close All"
|
|
msgstr "Zamknij wszystko"
|
|
|
|
#: lazarusidestrconsts.liscloseallchecked
|
|
msgid "Close All Checked"
|
|
msgstr "Zamknij zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsclose
|
|
msgid "Close files"
|
|
msgstr "Zamknij pliki"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabshide
|
|
msgctxt "lazarusidestrconsts.lisclosealltabshide"
|
|
msgid "Hide window"
|
|
msgstr "Ukryj okno"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsquestion
|
|
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabstitle
|
|
msgid "Close Source Editor Window"
|
|
msgstr "Zamknij okno edytora"
|
|
|
|
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "Opcje interfejsu LCL:"
|
|
|
|
#: lazarusidestrconsts.liscmparameter
|
|
msgid "Parameter"
|
|
msgstr "Parametr"
|
|
|
|
#: lazarusidestrconsts.liscmplstcomponents
|
|
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
|
msgid "Components"
|
|
msgstr "Komponenty"
|
|
|
|
#: lazarusidestrconsts.liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr "Dziedziczenie"
|
|
|
|
#: lazarusidestrconsts.liscmplstlist
|
|
msgid "List"
|
|
msgstr "Lista"
|
|
|
|
#: lazarusidestrconsts.liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr "Paleta"
|
|
|
|
#: lazarusidestrconsts.liscmppages
|
|
msgid "Pages"
|
|
msgstr "Strony"
|
|
|
|
#: lazarusidestrconsts.liscmppalettevisible
|
|
msgid "Palette is &visible"
|
|
msgstr "Paleta jest &widoczna"
|
|
|
|
#: lazarusidestrconsts.liscmprestoredefaults
|
|
msgid "&Restore defaults"
|
|
msgstr "Przywróć domyślne"
|
|
|
|
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr "Niejednoznaczny dodatkowy plik konfiguracji kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Wykonaj:"
|
|
|
|
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
|
#, object-pascal-format
|
|
msgid "%s%sClick OK if you definitely want to do that."
|
|
msgstr "%s%sKliknij OK jeżeli na pewno chcesz to zrobić."
|
|
|
|
#: lazarusidestrconsts.liscocommand
|
|
msgctxt "lazarusidestrconsts.liscocommand"
|
|
msgid "Command:"
|
|
msgstr "Polecenie:"
|
|
|
|
#: lazarusidestrconsts.liscode
|
|
msgid "Code"
|
|
msgstr "Kod"
|
|
|
|
#: lazarusidestrconsts.liscodebrowser
|
|
msgctxt "lazarusidestrconsts.liscodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Inspektor kodu"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogcaption
|
|
msgid "Code creation options"
|
|
msgstr "Opcje tworzenia źródła"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogclasssection
|
|
#, fuzzy
|
|
msgid "Class section"
|
|
msgstr "brakuje sekcji typu klasy "
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialoglocation
|
|
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
|
|
msgid "Location"
|
|
msgstr "Położenie"
|
|
|
|
#: lazarusidestrconsts.liscodegenerationoptions
|
|
msgid "Code generation options"
|
|
msgstr "Opcje generowania kodu"
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Dodaj ścieżkę"
|
|
|
|
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
|
msgid "Browse"
|
|
msgstr "Przeglądaj"
|
|
|
|
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr "Potwierdź zamianę"
|
|
|
|
#: lazarusidestrconsts.liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr "Utwórz element pomocy"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Usuń ścieżkę"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdescrtag
|
|
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
|
msgid "Description"
|
|
msgstr "Opis"
|
|
|
|
#: lazarusidestrconsts.liscodehelperrorstag
|
|
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
|
msgid "Errors"
|
|
msgstr "Błędy"
|
|
|
|
#: lazarusidestrconsts.liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Przykład"
|
|
|
|
#: lazarusidestrconsts.liscodehelpgroupbox
|
|
msgid "FPDoc settings"
|
|
msgstr "Ustawienia FPDoc"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr "Wstaw znacznik pogrubienia"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr "Wstaw znacznik formatowania kodu"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr "Wstaw znacznik pochylenia"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr "Wstaw znacznik komentarza"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr "Wstaw znacznik podkreślenia"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintvartag
|
|
#, fuzzy
|
|
msgid "Insert var formatting tag"
|
|
msgstr "Wstaw znacznik pogrubienia"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinherited
|
|
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
|
msgid "Inherited"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr "Wstaw odnośnik ..."
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr "Wstaw znacznik formatowania akapitu"
|
|
|
|
#: lazarusidestrconsts.liscodehelpmainformcaption
|
|
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
|
msgid "FPDoc Editor"
|
|
msgstr "Edytor FPDoc"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
|
#, fuzzy
|
|
msgid "(no inherited description found)"
|
|
msgstr "Opis"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<brak>"
|
|
|
|
#: lazarusidestrconsts.liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Zobacz także"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr "Krótki opis"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshorttag
|
|
#, fuzzy
|
|
msgid "Short"
|
|
msgstr "Wybierz skrót klawiszowy"
|
|
|
|
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
|
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
|
msgid "Ignore constants in next functions"
|
|
msgstr "Ignoruj stałe w następujących funkcjach"
|
|
|
|
#: lazarusidestrconsts.liscodeobscharconst
|
|
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
|
msgid "Search for unnamed char constants"
|
|
msgstr "Szukaj nienazwanych stałych znakowych"
|
|
|
|
#: lazarusidestrconsts.liscodeobserver
|
|
msgid "Code Observer"
|
|
msgstr "Obserwator kodu"
|
|
|
|
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
|
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
|
msgid "Ignore next unnamed constants"
|
|
msgstr "Ignoruj następujące nienazwane stałe"
|
|
|
|
#: lazarusidestrconsts.liscodetempladd
|
|
msgctxt "lazarusidestrconsts.liscodetempladd"
|
|
msgid "Add template"
|
|
msgstr "Dodaj szablon"
|
|
|
|
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Dodaj szablon kodu"
|
|
|
|
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
|
#, object-pascal-format
|
|
msgid " A token \"%s\" already exists! "
|
|
msgstr " Token \"%s\" już istnieje! "
|
|
|
|
#: lazarusidestrconsts.liscodetemplautocompleteon
|
|
msgid "Auto complete on"
|
|
msgstr "Autouzupełnianie gdy"
|
|
|
|
#: lazarusidestrconsts.liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Komentarz:"
|
|
|
|
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Edytuj szablon kodu"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerror
|
|
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
|
msgid "Error"
|
|
msgstr "Błąd"
|
|
|
|
#: lazarusidestrconsts.liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Token:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsaction
|
|
#, object-pascal-format
|
|
msgid "Action: %s"
|
|
msgstr "Akcja: %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
|
#, object-pascal-format
|
|
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Węzły utworzone automatycznie nie mogą być zmieniane %si nie można dodawać ręcznie węzłów potomnych."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
|
#, object-pascal-format
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, utworzony automatycznie"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
|
msgid "Auto generated nodes cannot be edited."
|
|
msgstr "Węzły utworzone automatycznie nie mogą być zmieniane."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Blok"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "Edytor symboli CodeTools"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
|
msgid "Compiler path"
|
|
msgstr "Ścieżka do kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Konwertuj"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
|
#, object-pascal-format
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Utwórz Symbole dla %s katalogu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Utwórz Symbole dla Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
#, fuzzy
|
|
#| msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgid "Create Defines for Free Pascal Git Sources"
|
|
msgstr "Utwórz Symbole dla Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
|
#, object-pascal-format
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Utwórz Symbole dla projektu %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "Utwórz makra FPC i ścieżki dla katalogu z projektem fpc"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Symbol"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Rekursywne \"Define\""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Usuń element"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Katalog główny %s,%sgdzie Borland instalował wszystkie źródła %s.%sNa przykład: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Główny katalog %s,%sgdzie Borland instalował %s wszystkie źródła,%sktóre są używane przez projekt %s.%sNa przykład: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Opis:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
|
#, object-pascal-format
|
|
msgid "%s directory"
|
|
msgstr "%s katalog"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr "Else"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr "ElseIf"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
|
#, fuzzy
|
|
#| msgid "FPC SVN source directory"
|
|
msgid "FPC Git source directory"
|
|
msgstr "Katalog źródeł FPC SVN"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr "If"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr "IfNDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Katalog"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Kompilator Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Katalog Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Projekt Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Kompilator Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Katalog Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Projekt Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Wstaw szablon kompilatora dla Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Wstaw szablon katalogów dla Delhi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Wstaw szablon projektu Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Projekt Free Pascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
|
#, fuzzy
|
|
#| msgid "Insert Free Pascal SVN Source Template"
|
|
msgid "Insert Free Pascal Git Source Template"
|
|
msgstr "Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Wstaw szablon kompilatora dla Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Wstaw szablon katalogu Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Wstaw szablon projektu Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Wstaw jako potomny"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Wstaw poniżej"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Wstaw szablon"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Błędny rodzic"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Błędny element rodzica"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Błądny poprzedni element"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s katalog główny,%sgdzie Borland Zainstalował wszystkie %s źródła.%sNp: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s główny katalog ,%sgdzie Borland zainstalował %s wszystkie źródła,%sktóre są używane przez projekt %s.%snp: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Przesuń w dół"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Przesuń o poziom niżej"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Przesuń o poziom wyżej"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Przesuń w górę"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsname
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
|
msgid "Name:"
|
|
msgstr "Nazwa:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "Nowy element"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Element tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "nie wybrano elementu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
|
msgid "Parent node cannot contain child nodes."
|
|
msgstr "Przodek nie może zawierać potomnych."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Poprzedni element nie może zawierać potomnych."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Katalog projektu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
|
#, object-pascal-format
|
|
msgid "%s project directory"
|
|
msgstr "katalog projektu %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
|
msgid "Read error"
|
|
msgstr "Błąd odczytu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Wybrany element:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "Katalog projektu Free Pascal."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
|
#, fuzzy
|
|
#| msgid "The Free Pascal SVN source directory."
|
|
msgid "The Free Pascal Git source directory."
|
|
msgstr "Katalog SVN źródeł Free Pascala."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
#, object-pascal-format
|
|
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
|
#, object-pascal-format
|
|
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
|
#, object-pascal-format
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "%s katalog projektu,%sktóry zawiera plik .dpr, dpk."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "\"Undefine\""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "\"Undefine All\""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Rekursywne \"Undefine\""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
|
#, fuzzy
|
|
msgid "Value as File Paths"
|
|
msgstr "Wartość"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Wartość jako tekst"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%s:%svalue \"%s\" is invalid."
|
|
msgstr "niedozwolony znak \"%s\" w %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Zmienna:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
|
msgid "Write error"
|
|
msgstr "Błąd zapisu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr "Na"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
|
msgid "Bracket"
|
|
msgstr "Nawias"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscaret
|
|
msgid "Caret (^)"
|
|
msgstr "Daszek (^)"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Dwukropek"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Przecinek"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Identyfikator"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
|
msgid "Keyword"
|
|
msgstr "Słowo kluczowe"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Nowa linia"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnone
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Liczba"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Kropka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Średnik"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsspace
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
|
msgid "Space"
|
|
msgstr "Odstęp"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "Stała łańcuchowa"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Symbol"
|
|
|
|
#: lazarusidestrconsts.liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Wykonaj po"
|
|
|
|
#: lazarusidestrconsts.liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Wykonaj przed"
|
|
|
|
#: lazarusidestrconsts.liscollapse
|
|
msgid "Collapse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseall
|
|
#, fuzzy
|
|
#| msgid "Collapse All (/)"
|
|
msgid "Collapse All [Ctrl+Minus]"
|
|
msgstr "Zwiń wszystko (/)"
|
|
|
|
#: lazarusidestrconsts.liscollapseall2
|
|
msgid "Collapse All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr "Zwiń wszystkie klazy"
|
|
|
|
#: lazarusidestrconsts.liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr "Zwiń wszystkie pakiety"
|
|
|
|
#: lazarusidestrconsts.liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr "Zwiń wszystkie moduły"
|
|
|
|
#: lazarusidestrconsts.liscomboboxes
|
|
msgid "Combo Boxes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandlineparameters
|
|
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
|
msgid "Command line parameters"
|
|
msgstr "Parametry linii poleceń"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Parametry wiersza poleceń programu"
|
|
|
|
#: lazarusidestrconsts.liscompile
|
|
msgctxt "lazarusidestrconsts.liscompile"
|
|
msgid "Compile"
|
|
msgstr "Kompiluj"
|
|
|
|
#: lazarusidestrconsts.liscompileanddonotaskagain
|
|
msgid "Compile and do not ask again"
|
|
msgstr "Kompiluj i nie pytaj więcej"
|
|
|
|
#: lazarusidestrconsts.liscompilefollowingmodes
|
|
msgid "Compile the following modes"
|
|
msgstr "Buduj następujące tryby"
|
|
|
|
#: lazarusidestrconsts.liscompilenormally
|
|
msgid "Compile normally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompileproject
|
|
msgid "Compile Project"
|
|
msgstr "Kompilowany projekt"
|
|
|
|
#: lazarusidestrconsts.liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Kompilator"
|
|
|
|
#: lazarusidestrconsts.liscompilercfgismissing
|
|
#, object-pascal-format
|
|
msgid "%s is missing."
|
|
msgstr "brak %s."
|
|
|
|
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
|
#, object-pascal-format
|
|
msgid "Compiler \"%s\" does not support target %s-%s"
|
|
msgstr "Kompilator \"%s\" nie obsługuje celu %s-%s"
|
|
|
|
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
|
#, object-pascal-format
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Błąd: nieprawidłowy kompilator: %s"
|
|
|
|
#: lazarusidestrconsts.liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Nazwa pliku kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
|
#, fuzzy
|
|
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler PathHint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgstr "Porada: możesz ustawić ścieżkę kompilatora w Środowisko->Opcje środowiska->Pliki->Ścieżka kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
|
#, object-pascal-format
|
|
msgid "Compiler messages file not found:%s%s"
|
|
msgstr "Nie znaleziono pliku komunikatów kompilatora:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "UWAGA: brak plik konfiguracji codetools - użyję opcji domyślnych"
|
|
|
|
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "UWAGA: ładuję stary plik opcji codetools: "
|
|
|
|
#: lazarusidestrconsts.liscompilestage
|
|
msgctxt "lazarusidestrconsts.liscompilestage"
|
|
msgid "Compile"
|
|
msgstr "Kompiluj"
|
|
|
|
#: lazarusidestrconsts.liscompilewithprojectsettings
|
|
msgid "Compile with project settings"
|
|
msgstr "Kompiluj z ustawieniami projektu"
|
|
|
|
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
|
msgid "Compile with -vd for more details. Check for duplicates."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompiling
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.liscompiling"
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (kompilacja ...)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
|
msgid "Show long line hints"
|
|
msgstr "Pokaż podpowiedzi przy długich liniach"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
|
msgid "Extend far left"
|
|
msgstr "Rozciągnij daleko w lewo"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
|
msgid "Extend some left"
|
|
msgstr "Rozciągnij trochę w lewo"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
|
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
|
msgid "Never"
|
|
msgstr "Nigdy"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
|
msgid "Extend right only"
|
|
msgstr "Rozciągnij tylko w prawo"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
|
#, object-pascal-format
|
|
msgid "Component name \"%s\" is a Pascal keyword."
|
|
msgstr "Nazwa komponentu \"%s\" jest słowem kluczowym Pascala."
|
|
|
|
#: lazarusidestrconsts.liscomponentnameiskeyword
|
|
#, object-pascal-format
|
|
msgid "Component name \"%s\" is keyword"
|
|
msgstr "Próbujesz użyć nazwy komponentu \"%s\" będącej słowem kluczowym"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
|
#, object-pascal-format
|
|
msgid "Component name \"%s\" is not a valid identifier"
|
|
msgstr "Nazwa komponentu \"%s\" nie jest prawidłowym identyfikatorem"
|
|
|
|
#: lazarusidestrconsts.liscomppalcomponentlist
|
|
msgid "View All"
|
|
msgstr "Pokaż wszystko"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Otwórz pakiet"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Otwórz moduł"
|
|
|
|
#: lazarusidestrconsts.liscompress
|
|
msgid "Compress"
|
|
msgstr "Kompresja"
|
|
|
|
#: lazarusidestrconsts.liscompresshint
|
|
msgid "The resulting directory will be compressed into a ZIP file."
|
|
msgstr "Katalog wynikowy będzie skompresowany do pliku ZIP."
|
|
|
|
#: lazarusidestrconsts.liscomptest
|
|
msgctxt "lazarusidestrconsts.liscomptest"
|
|
msgid "&Test"
|
|
msgstr "&Test"
|
|
|
|
#: lazarusidestrconsts.liscondition
|
|
msgid "Condition"
|
|
msgstr "Warunek"
|
|
|
|
#: lazarusidestrconsts.lisconditionals
|
|
msgctxt "lazarusidestrconsts.lisconditionals"
|
|
msgid "Conditionals"
|
|
msgstr "Warunki"
|
|
|
|
#: lazarusidestrconsts.lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Katalog z konfiguracją Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lisconfigfileofadditions
|
|
#, fuzzy
|
|
msgid "Config file of additions:"
|
|
msgstr "konfiguruj \"buduj plik\""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuild
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Configure Build %s"
|
|
msgstr "Konfiguracja \"Buduj Lazarusa\""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\""
|
|
msgstr "Konfiguracja \"Build Lazarus\""
|
|
|
|
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
|
msgid "Configure Toolbar"
|
|
msgstr "Konfiguracja paska narzędziowego"
|
|
|
|
#: lazarusidestrconsts.lisconfigurelazaruside
|
|
msgid "Configure Lazarus IDE"
|
|
msgstr "Konfiguruj IDE Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lisconfirm
|
|
msgid "Confirm"
|
|
msgstr "Potwierdź"
|
|
|
|
#: lazarusidestrconsts.lisconfirmation
|
|
msgid "Confirmation"
|
|
msgstr "Potwierdzenie"
|
|
|
|
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
|
#, object-pascal-format
|
|
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
|
msgstr "Lazarus zostanie przebudowany z następującym profilem:%sKontynuować?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr "Potwierdź zmiany"
|
|
|
|
#: lazarusidestrconsts.lisconfirmdelete
|
|
msgid "Confirm delete"
|
|
msgstr "Potwierdź usunięcie"
|
|
|
|
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
|
#, object-pascal-format
|
|
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
|
msgstr "Chcesz przebudować Lazarusa według profilu: %s?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr "Potwierdź nowy zestaw pakietów dla IDE"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageaction
|
|
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
|
msgid "Action"
|
|
msgstr "Działanie"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
|
msgid "New package set"
|
|
msgstr "Nowy zestaw pakietów"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
|
msgid "Old package set"
|
|
msgstr "Stary zestaw pakietów"
|
|
|
|
#: lazarusidestrconsts.lisconflict
|
|
msgid "Conflict"
|
|
msgstr "Konflikt"
|
|
|
|
#: lazarusidestrconsts.lisconflictdetected
|
|
msgid "Conflict detected"
|
|
msgstr "Wykryty konflikt"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr "Aplikacja konsolowa"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
|
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
|
msgstr "Program Free Pascala działający w linii poleceń zawierający TCustomApplication w celu łatwego sprawdzania opcji w linii poleceń, obsługi wyjątków itp."
|
|
|
|
#: lazarusidestrconsts.lisconstructorcode
|
|
msgid "Constructor code"
|
|
msgstr "Kod konstruktora"
|
|
|
|
#: lazarusidestrconsts.liscontains
|
|
msgid "contains"
|
|
msgstr "zawiera"
|
|
|
|
#: lazarusidestrconsts.liscontents
|
|
msgctxt "lazarusidestrconsts.liscontents"
|
|
msgid "Contents"
|
|
msgstr "Zawartość"
|
|
|
|
#: lazarusidestrconsts.liscontextsensitive
|
|
msgid "Context sensitive"
|
|
msgstr "Uwzględniaj kontekst"
|
|
|
|
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
|
msgid "Continue and do not ask again"
|
|
msgstr "Kontynuuj i nie pytaj więcej"
|
|
|
|
#: lazarusidestrconsts.liscontinuebuilding
|
|
msgid "Continue building"
|
|
msgstr "Kontynuuj budowanie"
|
|
|
|
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr "Kontynuuj bez wczytywania formularza"
|
|
|
|
#: lazarusidestrconsts.liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Współautorzy"
|
|
|
|
#: lazarusidestrconsts.liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr "Kontrolka wymaga rodzica"
|
|
|
|
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
|
msgid "Add comment after replacement"
|
|
msgstr "Dodaj komentarz po zamianie"
|
|
|
|
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
|
|
msgid "Added MODE Delphi syntax modifier after unit name."
|
|
msgstr "Dodano modyfikator składni MODE Delphi po nazwie modułu."
|
|
|
|
#: lazarusidestrconsts.lisconvaddingflagforregister
|
|
#, object-pascal-format
|
|
msgid "Adding flag for \"Register\" procedure in unit %s."
|
|
msgstr "Dodano znacznik dla procedury \"Register\" w module %s."
|
|
|
|
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
|
#, object-pascal-format
|
|
msgid "\")\" is missing from replacement function: %s"
|
|
msgstr "Brakuje \")\" w zmienianej funkcji: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvbracketnotfound
|
|
msgid "Bracket not found"
|
|
msgstr "Nie znaleziono nawiasu"
|
|
|
|
#: lazarusidestrconsts.lisconvconvertedfrom
|
|
#, object-pascal-format
|
|
msgid " { *Converted from %s* }"
|
|
msgstr " { *Converted from %s* }"
|
|
|
|
#: lazarusidestrconsts.lisconvcoordhint
|
|
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
|
msgstr "Przesunięcie jest dodawane do współrzędnej Top kontrolki wewnątrz wizualnych kontenerów"
|
|
|
|
#: lazarusidestrconsts.lisconvcoordoffs
|
|
msgid "Coordinate offsets"
|
|
msgstr "Przesunięcia współrzędnych"
|
|
|
|
#: lazarusidestrconsts.lisconvdeletedfile
|
|
#, object-pascal-format
|
|
msgid "Deleted file %s"
|
|
msgstr "Skasowano plik %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
|
#, object-pascal-format
|
|
msgid "Added defines %s in custom options"
|
|
msgstr "Dodano symbole %s we własnych opcjach"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
|
#, object-pascal-format
|
|
msgid "Added Package %s as a dependency."
|
|
msgstr "Dodano pakiet %s jako zależność."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
|
|
#, object-pascal-format
|
|
msgid "Added unit \"%s\" to uses section."
|
|
msgstr "Dodano moduł \"%s\" do sekcji uses."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
|
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
|
msgid "All sub-directories will be scanned for unit files"
|
|
msgstr "Wszystkie podkatalogi będą przeszukane w celu wyszukania plików modułów"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
|
#, fuzzy
|
|
msgid "BeginCodeTools failed!"
|
|
msgstr "Nie można utworzyć kopii zapasowej pliku"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphicategories
|
|
msgid "Categories:"
|
|
msgstr "Kategorie:"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
|
#, object-pascal-format
|
|
msgid "Changed encoding from %s to UTF-8"
|
|
msgstr "Zmieniono kodowanie z %s na UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
|
msgid "Conversion Aborted."
|
|
msgstr "Konwersja przerwana."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionready
|
|
msgid "Conversion Ready."
|
|
msgstr "Konwersja zakończona."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
|
#, object-pascal-format
|
|
msgid "Conversion took: %s"
|
|
msgstr "Konwersja zajęła: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
|
msgid "Convert Delphi package"
|
|
msgstr "Konwertuj pakiet Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
|
msgid "Convert Delphi project"
|
|
msgstr "Konwertuj projekt Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
|
msgid "Convert Delphi unit"
|
|
msgstr "Konwertuj moduł Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
|
msgid "*** Converting unit files found during conversion ***"
|
|
msgstr "*** Konwersja plików znalezionych podczas konwersji ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
|
msgid "*** Converting unit files belonging to project/package ***"
|
|
msgstr "*** Konwersja plików należących do projektu/pakietu ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphierror
|
|
#, object-pascal-format
|
|
msgid "Error=\"%s\""
|
|
msgstr "Błąd= \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
|
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
|
msgstr "Nastąpił wyjątek podczas konwersji modułu. Kontynuacja pracy z formularzami dotychczas przekonwertowanych modułów..."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
|
msgid "Failed converting unit"
|
|
msgstr "Błąd podczas konwersji modułu"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
|
#, object-pascal-format
|
|
msgid "Failed to convert unit \"%s\""
|
|
msgstr "Błąd konwersji modułu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
|
#, object-pascal-format
|
|
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
|
msgstr "Poprawiono wielkość znaków w module \"%s\" na \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
|
msgid "Found all unit files"
|
|
msgstr "Znaleziono wszystkie pliki modułów"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifunc
|
|
msgid "Delphi Function"
|
|
msgstr "Funkcja Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
|
#, object-pascal-format
|
|
msgid "%s(%s,%s) missing include file"
|
|
msgstr "%s(%s,%s) nie ma pliku include"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiname
|
|
msgid "Delphi Name"
|
|
msgstr "Nazwa Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
|
msgid "Package name exists"
|
|
msgstr "Nazwa pakietu istnieje"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
|
#, object-pascal-format
|
|
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
|
msgstr "Pakiet %s jest wymagany ale niezainstalowany w Lazarusie! Proszę zainstalować go później."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
|
#, object-pascal-format
|
|
msgid "Omitted unit %s from project"
|
|
msgstr "Pominięto moduł %s w projekcie"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
|
|
#, object-pascal-format
|
|
msgid "Removed unit \"%s\" from uses section."
|
|
msgstr "Usunięto moduł \"%s\" z sekcji uses."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
|
msgid "*** Fixing used units and Repairing form files ***"
|
|
msgstr "*** Poprawa użytych modułów (uses) i naprawa plików formularzy ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
|
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
|
msgstr "W sekcji uses zamieniono moduł \"%s\" na \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
|
#, object-pascal-format
|
|
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
|
msgstr "Istnieje już pakiet o nazwie \"%s\"%sProszę najpierw zamknąć ten pakiet."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
|
msgid "Unitname exists in LCL"
|
|
msgstr "Moduł o tej nazwie już istnieje w LCL"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
|
#, object-pascal-format
|
|
msgid "Units to replace in %s"
|
|
msgstr "Moduły do zamiany w %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
|
#, object-pascal-format
|
|
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
|
msgstr "LCL już zawiera moduł o nazwie %s. Usunąć lokalny plik %s?"
|
|
|
|
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
|
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
|
msgstr "Plik .dproj nie jest jeszcze obsługiwany. Plik ten jest używany przez Delphi 2007 i nowsze. Proszę wybrać plik .dpr dla projektu lub .dpk dla pakietu."
|
|
|
|
#: lazarusidestrconsts.lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr "Błąd konwersji"
|
|
|
|
#: lazarusidestrconsts.lisconvert
|
|
msgid "Convert"
|
|
msgstr "Konwertuj"
|
|
|
|
#: lazarusidestrconsts.lisconvertencoding
|
|
msgid "Convert Encoding"
|
|
msgstr "Zmień kodowanie"
|
|
|
|
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
|
msgid "Convert encoding of projects/packages"
|
|
msgstr "Konwersja kodowania projektów/pakietów"
|
|
|
|
#: lazarusidestrconsts.lisconvertotherhint
|
|
msgid "Other options affecting the conversion"
|
|
msgstr "Inne opcje wpływające na konwersję"
|
|
|
|
#: lazarusidestrconsts.lisconvertprojectorpackage
|
|
msgid "Convert project or package"
|
|
msgstr "Zmień kodowanie projektu lub pakietu"
|
|
|
|
#: lazarusidestrconsts.lisconverttarget
|
|
msgid "Target"
|
|
msgstr "Obiekt docelowy"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
|
msgid "Cross-platform"
|
|
msgstr "Wieloplatformowy"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
|
msgid "Cross-platform versus Windows-only"
|
|
msgstr "Wieloplatformowy czy tylko Windows"
|
|
|
|
#: lazarusidestrconsts.lisconverttargethint
|
|
msgid "Converter adds conditional compilation to support different targets"
|
|
msgstr "Konwerter dodaje warunki kompilacji aby zapewnić różne platformy docelowe"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
|
msgid "Use the same DFM form file"
|
|
msgstr "Użycie tego samego pliku DFM"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
|
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
|
msgstr "Ten sam plik DFM dla Lazarusa i Delphi zamiast kopiowania go do LFM"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
|
msgid "Support Delphi"
|
|
msgstr "Obsługa Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
|
msgid "Use conditional compilation to support Delphi"
|
|
msgstr "Użyj kompilacji warunkowej aby zachować zgodność z Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvfixedunitname
|
|
#, object-pascal-format
|
|
msgid "Fixed unit name from %s to %s."
|
|
msgstr "Poprawiono nazwą modułu z %s na %s."
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplacements
|
|
msgid "Function Replacements"
|
|
msgstr "Zamiany funkcji"
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplhint
|
|
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
|
msgid "Some Delphi functions can be replaced with LCL function"
|
|
msgstr "Niektóre funkcje Delphi mogą być zastąpione funkcjami LCL"
|
|
|
|
#: lazarusidestrconsts.lisconvfuncstoreplace
|
|
msgid "Functions / procedures to replace"
|
|
msgstr "Funkcje / procedury do zamiany"
|
|
|
|
#: lazarusidestrconsts.lisconvleftoff
|
|
msgid "Left offset"
|
|
msgstr "Od lewej"
|
|
|
|
#: lazarusidestrconsts.lisconvnewname
|
|
msgid "New Name"
|
|
msgstr "Nowa nazwa"
|
|
|
|
#: lazarusidestrconsts.lisconvparentcontainer
|
|
msgid "Parent Container"
|
|
msgstr "Kontener nadrzędny"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
|
#, object-pascal-format
|
|
msgid "Problems when trying to find all units from project file %s"
|
|
msgstr "Problemy przy wyszukiwaniu wszystkich modułów pliku projektu %s"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
|
#, object-pascal-format
|
|
msgid "Problems when fixing include files in file %s"
|
|
msgstr "Problemy przy naprawie dołączanych plików w pliku %s"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
|
#, object-pascal-format
|
|
msgid "Problems when repairing form file %s"
|
|
msgstr "Problemy przy naprawie pliku formularza %s"
|
|
|
|
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
|
msgid "Repairing include files : "
|
|
msgstr "Naprawa dołączanych plików: "
|
|
|
|
#: lazarusidestrconsts.lisconvreplacedcall
|
|
#, object-pascal-format
|
|
msgid "Replaced call %s with %s"
|
|
msgstr "Zamieniono wywołanie %s na %s"
|
|
|
|
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
|
#, object-pascal-format
|
|
msgid "Replacement function parameter number should be >= 1: %s"
|
|
msgstr "Liczba parametrów funkcji wstawianej po zmianie powinna być >=1: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
|
#, object-pascal-format
|
|
msgid "\"$\" should be followed by a number: %s"
|
|
msgstr "Po \"$\" powinna nastąpić liczba: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
|
msgid "Stopped because there already is a package with the same name"
|
|
msgstr "Zatrzymano ponieważ już istnieje pakiet o tej nazwie"
|
|
|
|
#: lazarusidestrconsts.lisconvthislogwassaved
|
|
#, object-pascal-format
|
|
msgid "This log was saved to %s"
|
|
msgstr "Log został zapisany do %s"
|
|
|
|
#: lazarusidestrconsts.lisconvtopoff
|
|
msgid "Top offset"
|
|
msgstr "Od góry"
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplacements
|
|
msgid "Type Replacements"
|
|
msgstr "Zamiany typów"
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplhint
|
|
msgid "Unknown types in form file (DFM/LFM)"
|
|
msgstr "Nieznane typy w pliku formularza (DFM/LFM)"
|
|
|
|
#: lazarusidestrconsts.lisconvtypestoreplace
|
|
msgid "Types to replace"
|
|
msgstr "Typy do zamiany"
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplacements
|
|
msgid "Unit Replacements"
|
|
msgstr "Zamiany modułów"
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplhint
|
|
msgid "Unit names in uses section of a source unit"
|
|
msgstr "Nazwy modułów w sekcji uses modułu źródłowego"
|
|
|
|
#: lazarusidestrconsts.lisconvunitstoreplace
|
|
msgid "Units to replace"
|
|
msgstr "Moduł do zamiany"
|
|
|
|
#: lazarusidestrconsts.lisconvunknownprops
|
|
msgid "Unknown properties"
|
|
msgstr "Nieznane właściwości"
|
|
|
|
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
|
#, object-pascal-format
|
|
msgid "User selected to end conversion with file %s"
|
|
msgstr "Użytkownik wybrał zakończenie konwersji pliku %s"
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
|
msgid "Add/Config/Delete Toolbar(s)"
|
|
msgstr "Dodaj/Konfiguruj/Usuń pasek narzędziowy"
|
|
|
|
#: lazarusidestrconsts.liscoolbaradddivider
|
|
msgid "Add Divider"
|
|
msgstr "Dodaj linię oddzielającą"
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddselected
|
|
msgid "Add selected item to toolbar"
|
|
msgstr "Dodaj zaznaczony element do paska narzędzi"
|
|
|
|
#: lazarusidestrconsts.liscoolbaravailablecommands
|
|
msgid "Available commands"
|
|
msgstr "Dostępne polecenia"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyle
|
|
msgid "Toolbars border style"
|
|
msgstr "Styl krawędzi pasków narzędzi"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
|
msgid "Single"
|
|
msgstr "Pojedyncze"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Przeglądarka źródeł"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodetemplates
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
|
msgid "Code Templates"
|
|
msgstr "Szablony źródeł"
|
|
|
|
#: lazarusidestrconsts.liscoolbarconfigure
|
|
msgid "&Configure"
|
|
msgstr "&Konfiguracja"
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
|
msgid "Are you sure you want to delete the selected toolbar?"
|
|
msgstr "Na pewno chcesz skasować zaznaczony pasek narzędzi?"
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletewarning
|
|
msgid "There must be at least one toolbar!"
|
|
msgstr "Musi być przynajmniej jeden pasek narzędzi!"
|
|
|
|
#: lazarusidestrconsts.liscoolbardesigner
|
|
msgid "Designer"
|
|
msgstr "Edytor"
|
|
|
|
#: lazarusidestrconsts.liscoolbargeneralsettings
|
|
msgid "General Coolbar Settings"
|
|
msgstr "Ogólne ustawienia paska narzędzi"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyle
|
|
msgid "Toolbars grab style"
|
|
msgstr "Styl uchwytu paska narzędziowego"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
|
msgid "Simple"
|
|
msgstr "Prosty"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
|
msgid "Double"
|
|
msgstr "Podwójne"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
|
msgid "HorLines"
|
|
msgstr "Poziome kreski"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
|
msgid "VerLines"
|
|
msgstr "Pionowe kreski"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
|
msgid "Gripper"
|
|
msgstr "Uchwyt"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
|
msgid "Button"
|
|
msgstr "Przycisk"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabwidth
|
|
msgid "Grab width"
|
|
msgstr "Szerokość chwytu"
|
|
|
|
#: lazarusidestrconsts.liscoolbaridemainmenu
|
|
msgid "IDE Main Menu"
|
|
msgstr "Menu główne IDE"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmessages
|
|
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
|
msgid "Messages"
|
|
msgstr "Komunikaty"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
|
msgid "Move selected toolbar item down"
|
|
msgstr "Przesuń zaznaczony element paska w dół"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
|
msgid "Move selected toolbar item up"
|
|
msgstr "Przesuń zaznaczony element paska w górę"
|
|
|
|
#: lazarusidestrconsts.liscoolbaroptions
|
|
msgid "IDE CoolBar"
|
|
msgstr "IDE CoolBar"
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditor
|
|
msgid "Package Editor"
|
|
msgstr "Edytor pakietu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
|
msgid "Package Editor Files"
|
|
msgstr "Pliki edytora pakietu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarremoveselected
|
|
msgid "Remove selected item from toolbar"
|
|
msgstr "Usuń wybrany element z paska narzędzi"
|
|
|
|
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
|
msgid "Restore defaults"
|
|
msgstr "Przywróć domyślne"
|
|
|
|
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
|
msgid "Please select a toolbar first!"
|
|
msgstr "Proszę najpierw wybrać pasek narzędzi!"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourceeditor
|
|
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Edytor źródeł"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourcetab
|
|
#, fuzzy
|
|
msgid "Source Tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
|
msgid "Toolbar commands"
|
|
msgstr "Polecenia paska narzędzi"
|
|
|
|
#: lazarusidestrconsts.liscoolbarvisible
|
|
msgid "Coolbar is &visible"
|
|
msgstr "Pasek jest &widoczny"
|
|
|
|
#: lazarusidestrconsts.liscoolbarwidth
|
|
msgid "Coolbar width"
|
|
msgstr "Szerokość paska"
|
|
|
|
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
|
msgid "Copy All Items to Clipboard"
|
|
msgstr "Kopiuj wszystkie elementy do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
|
msgid "Copy All/Original Messages to Clipboard"
|
|
msgstr "Kopiuj wszystkie/oryginalne komunikaty do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
|
msgid "Copy All Shown Messages to Clipboard"
|
|
msgstr "Kopiuj wszystkie komunikaty do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopydescription
|
|
msgid "Copy description to clipboard"
|
|
msgstr "Kopiuj opis do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Błąd kopiowania"
|
|
|
|
#: lazarusidestrconsts.liscopyfilename
|
|
#, object-pascal-format
|
|
msgid "Copy Filename %s"
|
|
msgstr "Kopiuj nazwę pliku %s"
|
|
|
|
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
|
msgid "Copy File Name to Clipboard"
|
|
msgstr "Kopiuj do schowka nazwę pliku"
|
|
|
|
#: lazarusidestrconsts.liscopyfilesfailed
|
|
msgid "Copying files failed."
|
|
msgstr "Niepowodzenie kopiowania plików."
|
|
|
|
#: lazarusidestrconsts.liscopyidentifier
|
|
#, object-pascal-format
|
|
msgid "Copy \"%s\" to clipboard"
|
|
msgstr "Kopiuj \"%s\" do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyitemtoclipboard
|
|
msgid "Copy Item to Clipboard"
|
|
msgstr "Kopiuj element do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopymovefiletodirectory
|
|
msgid "Copy/Move File to Directory"
|
|
msgstr "Przenieś/kopiuj plik do katalogu"
|
|
|
|
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
|
msgid "Copy Selected Items to Clipboard"
|
|
msgstr "Kopiuj zaznaczone elementy do schowka"
|
|
|
|
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
|
msgid "Copy Selected Messages to Clipboard"
|
|
msgstr "Kopiuj wybrane komunikaty do schowka"
|
|
|
|
#: lazarusidestrconsts.liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Przeszukuj komunikaty z FPC"
|
|
|
|
#: lazarusidestrconsts.liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Przeszukuj komunikaty z Make"
|
|
|
|
#: lazarusidestrconsts.liscoskipcallingcompiler
|
|
msgid "Skip calling compiler"
|
|
msgstr "Pomiń wywołanie kompilatora"
|
|
|
|
#: lazarusidestrconsts.liscouldnotadditomainsource
|
|
#, object-pascal-format
|
|
msgid "Could not add \"{$I %s}\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
|
#, object-pascal-format
|
|
msgid "Could not add \"{$R %s}\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
|
#, object-pascal-format
|
|
msgid "Could not add \"%s\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
|
#, object-pascal-format
|
|
msgid "Could not remove \"{$I %s}\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
|
#, object-pascal-format
|
|
msgid "Could not remove \"{$R %s}\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscpopenpackage
|
|
#, object-pascal-format
|
|
msgid "Open Package %s"
|
|
msgstr "Otwórz pakiet %s"
|
|
|
|
#: lazarusidestrconsts.liscpopenunit
|
|
#, object-pascal-format
|
|
msgid "Open Unit %s"
|
|
msgstr "Otwórz moduł %s"
|
|
|
|
#: lazarusidestrconsts.liscpu
|
|
#, object-pascal-format
|
|
msgid ", CPU: %s"
|
|
msgstr ", CPU: %s"
|
|
|
|
#: lazarusidestrconsts.liscreateandedit
|
|
msgid "Create and edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Najpierw utwórz projekt!"
|
|
|
|
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
|
msgid "Create Debug and Release modes"
|
|
msgstr "Utwórz tryby Debug i Release"
|
|
|
|
#: lazarusidestrconsts.liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr "Utworzyć katalog?"
|
|
|
|
#: lazarusidestrconsts.liscreatefilter
|
|
msgid "Create Filter"
|
|
msgstr "Tworzenie fitra"
|
|
|
|
#: lazarusidestrconsts.liscreatefppkgconfig
|
|
msgid "Restore Fppkg configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefunction
|
|
msgid "Create function"
|
|
msgstr "Tworzenie funkcji"
|
|
|
|
#: lazarusidestrconsts.liscreatehelpnode
|
|
msgid "Create Help node"
|
|
msgstr "Utwórz element pomocy"
|
|
|
|
#: lazarusidestrconsts.liscreateit
|
|
msgid "Create it"
|
|
msgstr "Utworzenie"
|
|
|
|
#: lazarusidestrconsts.liscreatelocalvariable
|
|
#, object-pascal-format
|
|
msgid "Create local variable \"%s\""
|
|
msgstr "Utwórz zmienną lokalną \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscreatenewaddition
|
|
msgid "Create new addition"
|
|
msgstr "Twórz nowy dodatek"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackage
|
|
msgid "(Create new package)"
|
|
msgstr "(Utwórz nowy pakiet)"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
|
msgid "Create new package component"
|
|
msgstr "Twórz nowy składnik pakietu"
|
|
|
|
#: lazarusidestrconsts.liscreateproject
|
|
msgid "Create project"
|
|
msgstr "Utwórz projekt"
|
|
|
|
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
|
msgid "Create/update .po file when saving a lfm file"
|
|
msgstr "Utwórz/aktualizuj pliki .po podczas zapisu plików lfm"
|
|
|
|
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
|
#, object-pascal-format
|
|
msgid "Creating file index of FPC sources %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Wybierz katalog"
|
|
|
|
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "Wartości katalogu Code Tools"
|
|
|
|
#: lazarusidestrconsts.lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Definiuj szablon"
|
|
|
|
#: lazarusidestrconsts.lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<nie wybrano zmiennej>"
|
|
|
|
#: lazarusidestrconsts.lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Pokaż podgląd"
|
|
|
|
#: lazarusidestrconsts.lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Narzędzia"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariable
|
|
#, object-pascal-format
|
|
msgid "Variable: %s"
|
|
msgstr "Zmienna: %s"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Nazwa zmiennej"
|
|
|
|
#: lazarusidestrconsts.lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Szablony"
|
|
|
|
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
|
msgid "Update all method signatures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
|
msgid "Update multiple procedure signatures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctpleaseselectamacro
|
|
#, fuzzy
|
|
msgid "please select a macro"
|
|
msgstr "[wybierz pakiet]"
|
|
|
|
#: lazarusidestrconsts.lisctselectcodemacro
|
|
#, fuzzy
|
|
msgid "Select Code Macro"
|
|
msgstr "Zaznacz blok"
|
|
|
|
#: lazarusidestrconsts.liscurrentlclwidgetset
|
|
#, object-pascal-format
|
|
msgid "Current LCL widgetset: \"%s\""
|
|
msgstr "Bieżący zestaw kontrolek LCL: :%s\""
|
|
|
|
#: lazarusidestrconsts.liscurrentstate
|
|
msgid "Current state: "
|
|
msgstr "Obecny status: "
|
|
|
|
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Kolumna w miejscu kursora"
|
|
|
|
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Wiersz w miejscu kursora"
|
|
|
|
#: lazarusidestrconsts.liscustomopthint
|
|
msgid "These options are passed to the compiler after macros are replaced."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "opcje niestandardowe"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Opcje niestandardowe"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions3
|
|
msgid "Custom Options"
|
|
msgstr "Opcje dodatkowe"
|
|
|
|
#: lazarusidestrconsts.liscustomprogram
|
|
#, fuzzy
|
|
msgid "Custom Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
|
#, fuzzy
|
|
msgid "A Custom Free Pascal program."
|
|
msgstr "Free Pascal Component Library"
|
|
|
|
#: lazarusidestrconsts.lisdatamodule
|
|
msgid "Data Module"
|
|
msgstr "Moduł danych"
|
|
|
|
#: lazarusidestrconsts.lisdate
|
|
msgid "Date"
|
|
msgstr "Data"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
|
msgid "Breakpoint Evaluation"
|
|
msgstr "Wyliczenie wartości pułapki"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
|
msgid "Breakpoint Hit"
|
|
msgstr "Zatrzymanie w pułapce"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
|
msgid "Breakpoint Message"
|
|
msgstr "Komunikat pułapki"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
|
#, fuzzy
|
|
msgid "Breakpoint Stack Dump"
|
|
msgstr "Zrzut pamięci"
|
|
|
|
#: lazarusidestrconsts.lisdbgendefaultcolor
|
|
msgid "Default Color"
|
|
msgstr "Kolor domyślny"
|
|
|
|
#: lazarusidestrconsts.lisdbgenexceptionraised
|
|
msgid "Exception Raised"
|
|
msgstr "Rzucono wyjątkiem"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleload
|
|
msgid "Module Load"
|
|
msgstr "Ładowanie modułu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleunload
|
|
msgid "Module Unload"
|
|
msgstr "Porzucenie modułu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
|
#, fuzzy
|
|
msgid "Output Debug String"
|
|
msgstr "Wyjście odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessexit
|
|
msgid "Process Exit"
|
|
msgstr "Wyjście z procesu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessstart
|
|
msgid "Process Start"
|
|
msgstr "Początek procesu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadexit
|
|
msgid "Thread Exit"
|
|
msgstr "Koniec wątku"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadstart
|
|
msgid "Thread Start"
|
|
msgstr "Początek wątku"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
|
#, fuzzy
|
|
msgid "Windows Message Posted"
|
|
msgstr "Komunikat"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
|
#, fuzzy
|
|
msgid "Windows Message Sent"
|
|
msgstr "Komunikat"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Odpluskwiacz nie wybrany"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr "Ustaw pułapkę mimo wszystko"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
#, object-pascal-format
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebug
|
|
msgctxt "lazarusidestrconsts.lisdebug"
|
|
msgid "Debug"
|
|
msgstr "Odpluskwanie"
|
|
|
|
#: lazarusidestrconsts.lisdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Odpluskiwacz"
|
|
|
|
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
|
|
msgstr "Błąd odpluskwiacza%sOoops, odpluskwiacz wszedł w stan błędu%sZapisz teraz swoją pracę !%sWciśnij zatrzymaj, i miejmy nadzieję że wszystko będzie dobrze."
|
|
|
|
#: lazarusidestrconsts.lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Niewłaściwy odpluskwiacz"
|
|
|
|
#: lazarusidestrconsts.lisdebugging
|
|
#, object-pascal-format
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (odpluskwianie...)"
|
|
|
|
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
|
msgid "Automatic typecast for objects"
|
|
msgstr "Automatyczne rzutowanie dla obiektów"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
|
msgid "Add Exception"
|
|
msgstr "Dodaj wyjątek"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Dodatkowa ścieżka wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
|
|
msgid "BETA: Allow function calls in watches (if supported by backend)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
|
|
msgid "Automatically close the assembler window, after source not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
|
|
msgid "Automatically set \"use instance class type\" for new watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbackend
|
|
msgid "Debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Pułapka"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "Czyść dziennik przy uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Odpluskiwacz"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
|
|
msgid "Debugger Backend:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Główne opcje odpluskiwacza"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Specyficzne opcje odpluskiwacza (zależne od typu odpluskiwacza)"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
|
msgid "Duplicate Exception name"
|
|
msgstr "Zdublowana nazwa wyjątku"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
|
|
msgid "Change type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
|
|
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
|
msgid "Enter the name of the exception"
|
|
msgstr "Wprowadź nazwę wyjątku"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
|
msgid "Event Log"
|
|
msgstr "Dziennik zdarzeń"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr "Przejęty przez"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr "Przejęty przez odpluskiwacza"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr "Przejęty przez program"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Ignoruj te wyjątki"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Wyjątki językowe"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
|
msgid "Limit line count to"
|
|
msgstr "Ogranicz ilość linii do"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
|
msgid "Module"
|
|
msgstr "Moduł"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmname
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
|
|
msgid "Name:"
|
|
msgstr "Nazwa:"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
|
msgid "Notify on Exceptions"
|
|
msgstr "Informuj o wyjątkach"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr "Wyjątki systemowe"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr "Wyjście"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Proces"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
|
msgid "Reset Debugger after each run"
|
|
msgstr "Zresetuj odpluskwiacz po każdym uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
|
|
msgid "Show message on stop with Error (Exit-code <> 0)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Pokaż komunikat przy zatrzymaniu"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Sygnały"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Wątek"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
|
|
#, object-pascal-format
|
|
msgid "Unknown Debugger backend \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
|
msgid "Use event log colors"
|
|
msgstr "Użyj kolorów w logu zdarzeń"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
|
|
msgid "-- Use IDE default Debugger --"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
|
|
msgid "-- Use project Debugger --"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
|
msgid "Windows"
|
|
msgstr "Okna"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Nie można załadować pliku"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
|
#, object-pascal-format
|
|
msgid "Unable to load file \"%s\"."
|
|
msgstr "Nie można załadować pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisdefault
|
|
msgctxt "lazarusidestrconsts.lisdefault"
|
|
msgid "Default"
|
|
msgstr "Domyślnie"
|
|
|
|
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
|
|
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
|
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultplaceholder
|
|
msgid "(default)"
|
|
msgstr "(domyślne)"
|
|
|
|
#: lazarusidestrconsts.lisdefaultsectionofmethods
|
|
msgid "Default section of methods"
|
|
msgstr "Domyślna sekcja metod"
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionbox
|
|
msgid "Delay for completion box"
|
|
msgstr "Opóźnienie pojawienia się ramki uzupełnień"
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
|
msgid "Delay for long line hints in completion box"
|
|
msgstr "Opóźnienie pojawienia się ramki podpowiedzi i uzupełnień przy długich liniachOpóźnienie pojawienia się ramki podpowiedzi i uzupełnień przy długich liniach"
|
|
|
|
#: lazarusidestrconsts.lisdelayforhints
|
|
msgid "Delay for hints"
|
|
msgstr "Opóźnienie pojawienia się podpowiedzi"
|
|
|
|
#: lazarusidestrconsts.lisdelete2
|
|
msgid "Delete?"
|
|
msgstr "Skasować?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteaddition
|
|
#, object-pascal-format
|
|
msgid "Delete addition \"%s\"?"
|
|
msgstr "Usunąć dodatek \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr "Usuń &wszystko"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Czy usunąć wszystkie pliki?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Czy chcesz usunąć dwuznaczny plik?"
|
|
|
|
#: lazarusidestrconsts.lisdeletefilefailed
|
|
msgid "Delete file failed"
|
|
msgstr "Nie można usunąć pliku"
|
|
|
|
#: lazarusidestrconsts.lisdeletemacro
|
|
#, object-pascal-format
|
|
msgid "Delete macro \"%s\"?"
|
|
msgstr "Czy chcesz usunąć macro \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeletemode
|
|
#, object-pascal-format
|
|
msgid "Delete mode \"%s\""
|
|
msgstr "Usuń tryb \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile
|
|
#, object-pascal-format
|
|
msgid "Delete old file \"%s\"?"
|
|
msgstr "Czy chcesz usunąć poprzedni plik \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile2
|
|
msgid "Delete old file?"
|
|
msgstr "Usunąć poprzedni plik?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedmacro
|
|
msgid "Delete selected macro?"
|
|
msgstr "Usunąć zaznaczone makro?"
|
|
|
|
#: lazarusidestrconsts.lisdeletethisaddition
|
|
msgid "Delete this addition"
|
|
msgstr "Usuń ten dodatek"
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue
|
|
#, object-pascal-format
|
|
msgid "Delete value \"%s\"?"
|
|
msgstr "Czy chcesz usunąć wartość \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue2
|
|
#, object-pascal-format
|
|
msgid "Delete value %s"
|
|
msgstr "Usuń wartość %s"
|
|
|
|
#: lazarusidestrconsts.lisdeletingoffilefailed
|
|
#, object-pascal-format
|
|
msgid "Deleting of file \"%s\" failed."
|
|
msgstr "Nie można usunąć pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisdelimiterissemicolon
|
|
msgid "Delimiter is semicolon."
|
|
msgstr "Separatorem jest średnik."
|
|
|
|
#: lazarusidestrconsts.lisdelphicompatibleresources
|
|
msgid "Delphi compatible resources. Recommended."
|
|
msgstr "Zasoby zgodne z Delphi. Zalecane."
|
|
|
|
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
|
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdesktops
|
|
msgid "Desktops ..."
|
|
msgstr "Pulpity ..."
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Katalog docelowy"
|
|
|
|
#: lazarusidestrconsts.lisdestructorcode
|
|
msgid "Destructor code"
|
|
msgstr "Kod destruktora"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Bez rozróżniania wielkości liter"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile1
|
|
msgid "File1"
|
|
msgstr "Plik1"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile2
|
|
msgid "File2"
|
|
msgstr "Plik2"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Ignoruj dodane lub usunięte puste linie"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Ignoruj różne znaki końca wiersza (np. #10 = #13#10)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Ignoruj ilość znaków odstępu"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Ignoruj odstępy (ale nie znaki końca linii)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Ignoruj spacje na końcu wiersza"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Ignoruj spacje na początku wiersza"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Tylko zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
|
msgid "Open difference in editor"
|
|
msgstr "Otwórz różnice w edytorze"
|
|
|
|
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
|
#, object-pascal-format
|
|
msgid "different unit %s found at new position \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectives
|
|
msgid "Directives"
|
|
msgstr "Dyrektywy"
|
|
|
|
#: lazarusidestrconsts.lisdirectivesfornewunit
|
|
msgid "Directives for new unit"
|
|
msgstr "Dyrektywy dla nowego modułu"
|
|
|
|
#: lazarusidestrconsts.lisdirectories
|
|
msgid "Directories"
|
|
msgstr "Katalogi"
|
|
|
|
#: lazarusidestrconsts.lisdirectory
|
|
msgid "Directory: "
|
|
msgstr "Katalog: "
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound
|
|
#, object-pascal-format
|
|
msgid "Directory \"%s\" not found."
|
|
msgstr "Nie znaleziono katalogu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound2
|
|
#, object-pascal-format
|
|
msgid "directory %s not found"
|
|
msgstr "nie znaleziono katalogu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotwritable
|
|
msgid "Directory not writable"
|
|
msgstr "Brak prawa zapisu w katalogu"
|
|
|
|
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
|
msgid "Directory where the IDE puts the .po files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablei18nforlfm
|
|
msgid "Disable I18N for LFM"
|
|
msgstr "Wyłącz i18n dla LFM"
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg
|
|
msgid "Disable Option -Xg?"
|
|
msgstr "Wyłączyć opcję -Xg?"
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg2
|
|
msgid "Disable option -Xg"
|
|
msgstr "Wyłącz opcję -Xg"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Porzuć zmiany"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesall
|
|
msgid "Discard all changes"
|
|
msgstr "Porzuć wszystkie zmiany"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
|
msgid "Discard changes and open project"
|
|
msgstr "Porzuć zmiany i otwórz projekt"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandquit
|
|
msgid "Discard changes and quit"
|
|
msgstr "Porzuć zmiany i wyjdź"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
|
msgid "Discard changes, create new project"
|
|
msgstr "Porzuć zmiany i utwórz nowy projekt"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Kliknij na jeden z powyższych elementów aby zobaczyć diff"
|
|
|
|
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
|
#, object-pascal-format
|
|
msgid "Error reading file: %s"
|
|
msgstr "Błąd podczas odczytu pliku: %s"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
|
|
msgid "Ignore all disk changes"
|
|
msgstr "Ignoruj zmiany na dysku"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
|
|
msgid "Reload checked files from disk"
|
|
msgstr "Przeładuj zaznaczone pliki z dysku"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Niektóre pliki na dysku uległy zmianie:"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
|
|
msgid "Some files have local changes. Either local or external changes will be overwritten."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr "Rozróżniaj wielkie i małe litery np. A i a"
|
|
|
|
#: lazarusidestrconsts.lisdlgalloptions
|
|
msgid "All options ..."
|
|
msgstr "Wszystkie opcje ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgchangeclass
|
|
msgid "Change Class ..."
|
|
msgstr "Zmień klasę..."
|
|
|
|
#: lazarusidestrconsts.lisdlgdefines
|
|
msgid "Defines ..."
|
|
msgstr "Symbole ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgedit
|
|
msgctxt "lazarusidestrconsts.lisdlgedit"
|
|
msgid "Edit ..."
|
|
msgstr "Edytuj..."
|
|
|
|
#: lazarusidestrconsts.lisdlgexport
|
|
msgctxt "lazarusidestrconsts.lisdlgexport"
|
|
msgid "Export ..."
|
|
msgstr "Eksportuj ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgimport
|
|
msgctxt "lazarusidestrconsts.lisdlgimport"
|
|
msgid "Import ..."
|
|
msgstr "Importuj ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgmore
|
|
msgctxt "lazarusidestrconsts.lisdlgmore"
|
|
msgid "More ..."
|
|
msgstr "Więcej ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgopen
|
|
msgctxt "lazarusidestrconsts.lisdlgopen"
|
|
msgid "Open ..."
|
|
msgstr "Otwórz ..."
|
|
|
|
#: lazarusidestrconsts.lisdoesnotexists
|
|
#, object-pascal-format
|
|
msgid "%s does not exist: %s"
|
|
msgstr "%s nie istnieje: %s"
|
|
|
|
#: lazarusidestrconsts.lisdonotchange
|
|
msgid "Do not change"
|
|
msgstr "Nie zmieniaj"
|
|
|
|
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
|
#, object-pascal-format
|
|
msgid "%sDo not check if another IDE instance is already running"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr "Nie zamykaj projektu"
|
|
|
|
#: lazarusidestrconsts.lisdonotcompiledependencies
|
|
msgid "do not compile dependencies"
|
|
msgstr "nie kompiluj zależnych"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen"
|
|
msgstr "Nie pokazuj okna startowego"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
|
msgid "Do not show this dialog for this project"
|
|
msgstr "Nie pokazuj tego komunikatu dla tego projektu"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
|
msgid "Do not show this message again"
|
|
msgstr "Nie pokazuj więcej tego komunikatu"
|
|
|
|
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
|
|
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonwloadonlinepackages
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"The following package(s) are not available locally: %s.\n"
|
|
"In order to install it, you must download them first. Download now?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdown
|
|
msgctxt "lazarusidestrconsts.lisdown"
|
|
msgid "Down"
|
|
msgstr "W dół"
|
|
|
|
#: lazarusidestrconsts.lisdowngrade
|
|
msgid "Downgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdowngradeconfiguration
|
|
#, fuzzy
|
|
msgid "Downgrade configuration"
|
|
msgstr "Konfiguracja paska narzędzi"
|
|
|
|
#: lazarusidestrconsts.lisdownload
|
|
msgid "Download"
|
|
msgstr "Pobierz"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
|
msgid "Do you still want to create the new project?"
|
|
msgstr "Czy nadal chcesz utworzyć nowy projekt?"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
|
msgid "Do you still want to open another project?"
|
|
msgstr "Czy nadal chcesz otworzyć inny projekt?"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
|
msgid "Do you still want to quit?"
|
|
msgstr "Czy nadal chcesz wyjść?"
|
|
|
|
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
|
msgid "Draw grid lines"
|
|
msgstr "Rysuj linie siatki"
|
|
|
|
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
|
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdropdowncount
|
|
msgid "Drop Down Count"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdropdowncounthint
|
|
msgid "Used for all ComboBoxes in IDE dialogs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Kopiuj wybrane komponenty do schowka"
|
|
|
|
#: lazarusidestrconsts.lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Wytnij wybrane komponenty do schowka"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr "Przenieś na spód"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr "O jeden na wierzch"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr "Przenieś komponent na spód"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr "Przenieś na wierzch"
|
|
|
|
#: lazarusidestrconsts.lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Wklej wybrane komponenty ze schowka"
|
|
|
|
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Wybierz komponent-rodzica"
|
|
|
|
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
|
|
msgid "Show nonvisual components"
|
|
msgstr "Pokaż niewizualne komponenty"
|
|
|
|
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
|
|
msgid "Toggle showing nonvisual components"
|
|
msgstr "Przełącz pokazywanie niewizualnych komponentów"
|
|
|
|
#: lazarusidestrconsts.lisduplicate
|
|
msgid "Duplicate"
|
|
msgstr "Powiel"
|
|
|
|
#: lazarusidestrconsts.lisduplicateentry
|
|
msgid "Duplicate entry"
|
|
msgstr "Zdublowany wpis"
|
|
|
|
#: lazarusidestrconsts.lisduplicatefilename
|
|
msgid "Duplicate File Name"
|
|
msgstr "Zdublowana nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
|
#, object-pascal-format
|
|
msgid "Duplicate found of value \"%s\"."
|
|
msgstr "Zdublowany identyfikator: %s."
|
|
|
|
#: lazarusidestrconsts.lisduplicatemodename
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Mode \"%s\" is already present in the list."
|
|
msgstr "Pakiet %s jest już na liście"
|
|
|
|
#: lazarusidestrconsts.lisduplicatename
|
|
msgid "Duplicate Name"
|
|
msgstr "Zdublowana nazwa"
|
|
|
|
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
#, object-pascal-format
|
|
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
|
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatesearchpath
|
|
#, fuzzy
|
|
msgid "Duplicate search path"
|
|
msgstr "Dodatkowa ścieżka wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
|
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateunit
|
|
msgid "Duplicate Unit"
|
|
msgstr "Zdublowane moduł"
|
|
|
|
#: lazarusidestrconsts.lisduplicateunitin
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Duplicate unit \"%s\" in \"%s\""
|
|
msgstr "zdublowany identyfikator: %s"
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollin
|
|
msgid "Amount to scroll in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
|
|
msgid "Amount to scroll in (%)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
|
|
msgid "Amount to scroll in (Max)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
|
|
msgid "Auto Scroll on delete past left border"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
|
|
msgid "Auto Scroll on type past right border"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
|
|
msgid "Trigger on min chars (% of width)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
|
|
msgid "Trigger on min chars visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedit
|
|
msgctxt "lazarusidestrconsts.lisedit"
|
|
msgid "Edit"
|
|
msgstr "Edytuj"
|
|
|
|
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
|
#, fuzzy
|
|
msgid "Edit additional help for messages"
|
|
msgstr "Edycja pomocy kontekstowej"
|
|
|
|
#: lazarusidestrconsts.liseditcontexthelp
|
|
msgid "Edit context help"
|
|
msgstr "Edycja pomocy kontekstowej"
|
|
|
|
#: lazarusidestrconsts.lisedithelp
|
|
msgid "Edit help"
|
|
msgstr "Edycja pomocy"
|
|
|
|
#: lazarusidestrconsts.liseditkey
|
|
msgid "Edit Key"
|
|
msgstr "Edytuj klucz"
|
|
|
|
#: lazarusidestrconsts.liseditorcolors
|
|
#, fuzzy
|
|
msgid "Editor Colors"
|
|
msgstr "Kolory"
|
|
|
|
#: lazarusidestrconsts.liseditormacros
|
|
msgctxt "lazarusidestrconsts.liseditormacros"
|
|
msgid "Editor Macros"
|
|
msgstr "Edytor makr"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbar
|
|
msgid "Editor ToolBar"
|
|
msgstr "Pasek narzędzi edytora"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarsettings
|
|
msgid "Editor Toolbar Settings"
|
|
msgstr "Ustawienia paska narzędzi edytora"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarvisible
|
|
msgid "Editor Toolbar is &visible"
|
|
msgstr "Pasek narzędzi edytora jest &widoczny"
|
|
|
|
#: lazarusidestrconsts.lisedoptsloadascheme
|
|
msgid "Load a scheme"
|
|
msgstr "Wczytaj schemat"
|
|
|
|
#: lazarusidestrconsts.lisedtdefallpackages
|
|
msgid "All packages"
|
|
msgstr "Wszystkie pakiety"
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Bieżący projekt"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsallprojects
|
|
msgid "All projects"
|
|
msgstr "Wszystkie projekty"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
|
msgid "set FPC mode to DELPHI"
|
|
msgstr "ustaw tryb FPC na DELPHI"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
|
msgid "set FPC mode to FPC"
|
|
msgstr "ustaw tryb FPC na FPC"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
|
msgid "set FPC mode to GPC"
|
|
msgstr "ustaw tryb FPC na GPC"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
|
msgid "set FPC mode to MacPas"
|
|
msgstr "ustaw tryb FPC na MacPas"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
|
msgid "set FPC mode to TP"
|
|
msgstr "ustaw tryb FPC na TP"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
|
msgid "set IOCHECKS on"
|
|
msgstr "włącz IOCHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
|
msgid "set OVERFLOWCHECKS on"
|
|
msgstr "włącz OVERFLOWCHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
|
msgid "set RANGECHECKS on"
|
|
msgstr "włącz RANGECHECKS"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
|
msgid "use HeapTrc unit"
|
|
msgstr "użyj modułu HeapTrc"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
|
msgid "use LineInfo unit"
|
|
msgstr "użyj modułu LineInfo"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Poprawny wois narzędzia wymaga przynajmniej nazwy i nazwy pliku."
|
|
|
|
#: lazarusidestrconsts.lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Edycja narzędzi"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolkey
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
|
msgid "Key"
|
|
msgstr "Klawisz"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolmacros
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
|
msgid "Macros"
|
|
msgstr "Makra"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parametry:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr "Nazwa pliku programu:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
msgid "Scan output for FPC messages"
|
|
msgstr "Przeszukuj komunikaty z FPC"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
|
msgid "Scan output for \"make\" messages"
|
|
msgstr "Przeszukuj wyjście komunikatów make"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Wymagana nazwa i nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Katalog roboczy:"
|
|
|
|
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
|
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdall
|
|
msgctxt "lazarusidestrconsts.lisemdall"
|
|
msgid "All"
|
|
msgstr "Wszystko"
|
|
|
|
#: lazarusidestrconsts.lisemdemptymethods
|
|
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
|
msgid "Empty Methods"
|
|
msgstr "Puste metody"
|
|
|
|
#: lazarusidestrconsts.lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr "Znaleziono puste metody:"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclass
|
|
msgid "No class"
|
|
msgstr "Bez klasy"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclassat
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "No class at %s(%s,%s)"
|
|
msgstr "Nie znaleziono klasy \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr "Tylko publikowane właściwości"
|
|
|
|
#: lazarusidestrconsts.lisemdpublic
|
|
msgid "Public"
|
|
msgstr "Publiczne"
|
|
|
|
#: lazarusidestrconsts.lisemdpublished
|
|
msgid "Published"
|
|
msgstr "Publikowane"
|
|
|
|
#: lazarusidestrconsts.lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr "Usuń metody"
|
|
|
|
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr "Szukaj w tych sekcjach klasy:"
|
|
|
|
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
|
#, object-pascal-format
|
|
msgid "Unable to show empty methods of the current class, because%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisempty
|
|
msgid "Empty"
|
|
msgstr "Puste"
|
|
|
|
#: lazarusidestrconsts.lisemptydestinationforpublishing
|
|
msgid "Destination directory for publishing is either a relative path or empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenabledonlyforpackages
|
|
msgid "Enabled only for packages."
|
|
msgstr "Włączony tylko dla pakietów."
|
|
|
|
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
|
#, object-pascal-format
|
|
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablei18nforlfm
|
|
msgid "Enable I18N for LFM"
|
|
msgstr "Włącz i18n dla LFM"
|
|
|
|
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
|
msgid "Enable internationalization and translation support"
|
|
msgstr "Włącz obsługę internacjonalizacji i tłumaczenie"
|
|
|
|
#: lazarusidestrconsts.lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Włącz makra"
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf2
|
|
msgid "Enable Dwarf 2 (-gw)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf2sets
|
|
msgid "Enable Dwarf 2 with sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf3
|
|
msgid "Enable Dwarf 3 (-gw3)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableoptionxg
|
|
msgid "Enable Option -Xg?"
|
|
msgstr "Włączyć opcję -Xg?"
|
|
|
|
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
|
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencloseinifdef
|
|
msgid "Enclose in $IFDEF"
|
|
msgstr "Otocz w $IFDEF"
|
|
|
|
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
|
#, object-pascal-format
|
|
msgid "Number of files failed to convert: %d"
|
|
msgstr "Liczba plików do konwersji: %d"
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
|
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
|
msgstr "Kodowanie pliku \"%s\"%sna dysku to %s. Nowe kodowanie to %s."
|
|
|
|
#: lazarusidestrconsts.lisendlessloopinmacros
|
|
msgid "Endless loop in macros"
|
|
msgstr "Nieskończona pętla w makrach"
|
|
|
|
#: lazarusidestrconsts.lisenternewnameformacros
|
|
#, object-pascal-format
|
|
msgid "Enter new name for Macro \"%s\""
|
|
msgstr "Wpisz nową nazwę makra \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
|
msgid "Environment variable, name as parameter"
|
|
msgstr "Zmienna środowiskowa, nazwa jako parametr"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
|
msgid "Directory not found"
|
|
msgstr "Nie znaleziono katalogu"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Błędna nazwa pliku odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
|
#, object-pascal-format
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "Plik odpluskwiacza \"%s\" nie jest wykonywalny."
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
|
#, object-pascal-format
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Nie znaleziono katalogu testowego \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liserrinvalidoption
|
|
#, object-pascal-format
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrnooptionallowed
|
|
#, object-pascal-format
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserroptionneeded
|
|
#, object-pascal-format
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserror
|
|
msgid "Error: "
|
|
msgstr "Błąd: "
|
|
|
|
#: lazarusidestrconsts.liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Błąd przy tworzeniu pliku"
|
|
|
|
#: lazarusidestrconsts.liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Błąd podczas usuwania pliku"
|
|
|
|
#: lazarusidestrconsts.liserrorin
|
|
#, object-pascal-format
|
|
msgid "Error in %s"
|
|
msgstr "Błąd w %s"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
|
msgid "Error in the compiler file name:"
|
|
msgstr "Błędna nazwa pliku kompilatora:"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
|
msgid "Error in the custom compiler options (Other):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
|
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
|
msgid "Error in the \"Debugger path addition\":"
|
|
msgstr "Błąd w \"Dodatkowe ścieżki dla odpluskwiacza\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
|
msgid "Error in the search path for \"Include files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
|
#, fuzzy
|
|
msgid "Error in the search path for \"Libraries\":"
|
|
msgstr "Błąd w \"Dodatkowe ścieżki dla odpluskwiacza\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
|
msgid "Error in the search path for \"Object files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
|
msgid "Error in the search path for \"Other sources\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
|
msgid "Error in the search path for \"Other unit files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
|
#, fuzzy
|
|
msgid "Error in the \"unit output directory\":"
|
|
msgstr "Katalog wyjściowy modułów"
|
|
|
|
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
|
#, object-pascal-format
|
|
msgid "Error: (lazarus) invalid build mode \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr "Błąd ładowania pliku"
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile2
|
|
#, object-pascal-format
|
|
msgid "Error loading file \"%s\":"
|
|
msgstr "Błąd ładowania pliku \"%s\":"
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfrom
|
|
#, object-pascal-format
|
|
msgid "Error loading %s from%s%s%s%s"
|
|
msgstr "Błąd ładowania %s z%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr "Błąd przenoszenia komponentu"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent2
|
|
#, object-pascal-format
|
|
msgid "Error moving component %s:%s"
|
|
msgstr "Błąd przenoszenia komponentu %s:%s"
|
|
|
|
#: lazarusidestrconsts.liserrornamingcomponent
|
|
msgid "Error naming component"
|
|
msgstr "Błąd przy nazywaniu komponentu"
|
|
|
|
#: lazarusidestrconsts.liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr "Błąd przy otwieraniu komponentu"
|
|
|
|
#: lazarusidestrconsts.liserroropeningform
|
|
msgid "Error opening form"
|
|
msgstr "Błąd przy otwieraniu formularza"
|
|
|
|
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
|
#, object-pascal-format
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr "Błąd odczytu XML"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxmlfile
|
|
#, object-pascal-format
|
|
msgid "Error reading xml file \"%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Błąd w trakcie zmiany nazwy pliku"
|
|
|
|
#: lazarusidestrconsts.liserrors
|
|
msgctxt "lazarusidestrconsts.liserrors"
|
|
msgid "Errors"
|
|
msgstr "Błędy"
|
|
|
|
#: lazarusidestrconsts.liserrors2
|
|
#, object-pascal-format
|
|
msgid ", Errors: %s"
|
|
msgstr ", Błędy: %s"
|
|
|
|
#: lazarusidestrconsts.liserrorsavingform
|
|
msgid "Error saving form"
|
|
msgstr "Błąd podczas zapisu formularza"
|
|
|
|
#: lazarusidestrconsts.liserrorsavingto
|
|
#, object-pascal-format
|
|
msgid "Error saving %s to%s%s%s%s"
|
|
msgstr "Błąd zapisu %s do%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
|
#, object-pascal-format
|
|
msgid "Error setting the name of a component %s to %s"
|
|
msgstr "Błąd podczas nadawania komponentowi %s nazwy %s"
|
|
|
|
#: lazarusidestrconsts.liserrorwritingfile
|
|
#, object-pascal-format
|
|
msgid "Error writing file \"%s\""
|
|
msgstr "Błąd podczas zapisu do pliku \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
|
#, object-pascal-format
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseverynthlinenumber
|
|
msgid "Every n-th line number"
|
|
msgstr "Każdy n-ty numer linii"
|
|
|
|
#: lazarusidestrconsts.lisexamplefile
|
|
msgid "Example file:"
|
|
msgstr "Przykładowy plik:"
|
|
|
|
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
#, object-pascal-format
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexclude
|
|
msgid "Exclude"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludedatruntime
|
|
#, object-pascal-format
|
|
msgid "%s excluded at run time"
|
|
msgstr "%s wykluczony podczas wykonywania"
|
|
|
|
#: lazarusidestrconsts.lisexecutableisadirectory
|
|
#, object-pascal-format, fuzzy
|
|
msgid "executable \"%s\" is a directory"
|
|
msgstr "Wybierz plik wykonywalny kompilatora (%s)"
|
|
|
|
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
|
#, object-pascal-format
|
|
msgid "executable \"%s\" lacks the permission to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandafter
|
|
#, fuzzy
|
|
msgid "Executing command after"
|
|
msgstr "Polecenie po module publikacji"
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandbefore
|
|
#, fuzzy
|
|
msgid "Executing command before"
|
|
msgstr "Wykonaj przed"
|
|
|
|
#: lazarusidestrconsts.lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Wykonanie zatrzymane"
|
|
|
|
#: lazarusidestrconsts.lisexecutionstoppedexitcode
|
|
#, object-pascal-format
|
|
msgid "Execution stopped with exit-code %1:d ($%2:s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexit
|
|
msgctxt "lazarusidestrconsts.lisexit"
|
|
msgid "Exit"
|
|
msgstr "Wyjdź"
|
|
|
|
#: lazarusidestrconsts.lisexitcode
|
|
#, object-pascal-format
|
|
msgid "Exit code %s"
|
|
msgstr "Kod wyjścia %s"
|
|
|
|
#: lazarusidestrconsts.lisexpand
|
|
msgid "Expand"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandall
|
|
#, fuzzy
|
|
#| msgid "Expand All (*)"
|
|
msgid "Expand All [Ctrl+Plus]"
|
|
msgstr "Rozwiń wszystko (*)"
|
|
|
|
#: lazarusidestrconsts.lisexpandall2
|
|
msgid "Expand All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr "Rozwiń wszystkie klasy"
|
|
|
|
#: lazarusidestrconsts.lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr "Rozwiń wszystkie pakiety"
|
|
|
|
#: lazarusidestrconsts.lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr "Rozwiń wszystkie moduły"
|
|
|
|
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Rozszerzona nazwa bieżącego pliku w edytorze"
|
|
|
|
#: lazarusidestrconsts.lisexport
|
|
msgctxt "lazarusidestrconsts.lisexport"
|
|
msgid "Export"
|
|
msgstr "Eksport"
|
|
|
|
#: lazarusidestrconsts.lisexportall
|
|
msgid "Export all"
|
|
msgstr "Eksportuj wszystko"
|
|
|
|
#: lazarusidestrconsts.lisexportallitemstofile
|
|
msgid "Export All Items to File"
|
|
msgstr "Eksportuj wszystkie elementy do pliku"
|
|
|
|
#: lazarusidestrconsts.lisexportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
|
msgid "Export environment options"
|
|
msgstr "Eksportuj opcje środowiska"
|
|
|
|
#: lazarusidestrconsts.lisexporthtml
|
|
msgid "Export as HTML"
|
|
msgstr "Eksportuj jako HTML"
|
|
|
|
#: lazarusidestrconsts.lisexportimport
|
|
msgid "Export / Import"
|
|
msgstr "Eksport / Import"
|
|
|
|
#: lazarusidestrconsts.lisexportlist
|
|
msgid "Export list"
|
|
msgstr "Eksportuj listę"
|
|
|
|
#: lazarusidestrconsts.lisexportpackagelistxml
|
|
msgid "Export package list (*.xml)"
|
|
msgstr "Eksportuj listę pakietów (*.xml)"
|
|
|
|
#: lazarusidestrconsts.lisexportselected
|
|
msgid "Export selected"
|
|
msgstr "Eksportuj zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lisexportsub
|
|
msgid "Export >>"
|
|
msgstr "Eksportuj >>"
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
|
|
#, object-pascal-format
|
|
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
|
|
#, object-pascal-format
|
|
msgid "Extend include files search path of project with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludepath
|
|
#, fuzzy
|
|
msgid "Extend include path?"
|
|
msgstr "Ścieżka dołączanych plików projektu"
|
|
|
|
#: lazarusidestrconsts.lisextendunitpath
|
|
#, fuzzy
|
|
msgid "Extend unit path?"
|
|
msgstr "Dodać do katalogów modułów?"
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
|
|
#, object-pascal-format
|
|
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
|
|
#, object-pascal-format
|
|
msgid "Extend unit search path of project with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextract
|
|
msgid "Extract"
|
|
msgstr "Wyodrębnij"
|
|
|
|
#: lazarusidestrconsts.lisextractprocedure
|
|
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
|
msgid "Extract Procedure"
|
|
msgstr "Zaznacz i wydziel procedurę"
|
|
|
|
#: lazarusidestrconsts.lisextremelyverbose
|
|
msgid "Extremely Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolexternaltools
|
|
msgid "External Tools"
|
|
msgstr "Zewnętrzne narzędzia"
|
|
|
|
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Osiągnięto maksymalną liczbę narzędzi"
|
|
|
|
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
|
#, object-pascal-format
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Może być maksymalnie %s narzędzi."
|
|
|
|
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
|
#, object-pascal-format
|
|
msgid "Failed to add %d not unique resource(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Failed to create Application Bundle for \"%s\""
|
|
msgstr "Utwórz Zestaw Aplikacji"
|
|
|
|
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
|
msgid "Failed to load fold state"
|
|
msgstr "Nie można wczytać stanu zwinięć"
|
|
|
|
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
|
#, fuzzy
|
|
msgid "failed to resolve macros"
|
|
msgstr "Makra"
|
|
|
|
#: lazarusidestrconsts.lisfailedtosavefile
|
|
msgid "Failed to save file."
|
|
msgstr "Błąd podczas zapisu pliku."
|
|
|
|
#: lazarusidestrconsts.lisfatal
|
|
msgctxt "lazarusidestrconsts.lisfatal"
|
|
msgid "Fatal"
|
|
msgstr "Błąd krytyczny"
|
|
|
|
#: lazarusidestrconsts.lisfile
|
|
msgctxt "lazarusidestrconsts.lisfile"
|
|
msgid "File"
|
|
msgstr "Plik"
|
|
|
|
#: lazarusidestrconsts.lisfile2
|
|
msgid "File: "
|
|
msgstr "Plik: "
|
|
|
|
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
|
#, object-pascal-format
|
|
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr "Plik \"%s\"%snie wygląda na tekstowy.%sCzy pomimo tego chcesz go otworzyć?"
|
|
|
|
#: lazarusidestrconsts.lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr "Rozszerzenie nazwy pliku dla programów"
|
|
|
|
#: lazarusidestrconsts.lisfilefilter
|
|
msgid "File filter"
|
|
msgstr "Filtr plików"
|
|
|
|
#: lazarusidestrconsts.lisfilefilters
|
|
msgid "File Filters"
|
|
msgstr "Filtry plików"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersaddrow
|
|
msgid "Add Row"
|
|
msgstr "Dodaj wiersz"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
|
msgid "Delete Row"
|
|
msgstr "Usuń wiersz"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
|
msgid "Insert Row"
|
|
msgstr "Wstaw wiersz"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersmask
|
|
msgid "File mask"
|
|
msgstr "Maska pliku"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
|
msgid "Set defaults"
|
|
msgstr "Ustaw domyślne"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterstitle
|
|
msgid "These are file filters that will appear in all File Open dialogs"
|
|
msgstr "Filtry plików stosowane w oknie dialogowym \"Otwórz plik\""
|
|
|
|
#: lazarusidestrconsts.lisfilefound
|
|
msgid "File found"
|
|
msgstr "Znaleziono plik"
|
|
|
|
#: lazarusidestrconsts.lisfilehaschangedsave
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" has changed. Save?"
|
|
msgstr "Plik \"%s\" został zmieniony. Zapisać?"
|
|
|
|
#: lazarusidestrconsts.lisfilehasnoproject
|
|
msgid "File has no project"
|
|
msgstr "Plik nie ma projektu"
|
|
|
|
#: lazarusidestrconsts.lisfileisdirectory
|
|
msgid "File is directory"
|
|
msgstr "Plik jest katalogiem"
|
|
|
|
#: lazarusidestrconsts.lisfileisnotanexecutable
|
|
msgid "File is not an executable"
|
|
msgstr "Plik nie jest wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lisfileisnotwritable
|
|
msgid "File is not writable"
|
|
msgstr "Nie można zapisywać do pliku"
|
|
|
|
#: lazarusidestrconsts.lisfileissymlink
|
|
msgid "File is symlink"
|
|
msgstr "Plik jest dowiązaniem symbolicznym"
|
|
|
|
#: lazarusidestrconsts.lisfileisvirtual
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" is virtual."
|
|
msgstr "Plik \"%s\" jest plikiem wirtualnym."
|
|
|
|
#: lazarusidestrconsts.lisfilenamestyle
|
|
msgid "Filename Style"
|
|
msgstr "Styl nazwy pliku"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "Nie znaleziono pliku"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound2
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisfilenotfound2"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Nie znaleziono pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound3
|
|
#, object-pascal-format
|
|
msgid "file %s not found"
|
|
msgstr "nie znaleziono pliku %s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound4
|
|
msgid "file not found"
|
|
msgstr "nie znaleziono pliku"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound5
|
|
#, object-pascal-format
|
|
msgid "File not found:%s%s"
|
|
msgstr "Nie znaleziono pliku:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" not found.%sDo you want to create it?"
|
|
msgstr "Nie znaleziono pliku \"%s\" .%sCzy chcesz go utworzyć?"
|
|
|
|
#: lazarusidestrconsts.lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "Nazwa pliku nie jest napisana małymi literami"
|
|
|
|
#: lazarusidestrconsts.lisfilenottext
|
|
msgid "File not text"
|
|
msgstr "To nie jest plik tekstowy"
|
|
|
|
#: lazarusidestrconsts.lisfilescountconvertedtotextformat
|
|
#, object-pascal-format
|
|
msgid "%d files were converted to text format."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesettings
|
|
msgid "File Settings"
|
|
msgstr "Ustawienia pliku"
|
|
|
|
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
|
#, object-pascal-format
|
|
msgid "File %s has incorrect syntax."
|
|
msgstr "Plik %s ma nieprawidłową składnię."
|
|
|
|
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
|
#, object-pascal-format
|
|
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileshaverightencoding
|
|
msgid "*** All found files already have the right encoding ***"
|
|
msgstr "*** Wszystkie znalezione pliki mają już poprawne kodowanie ***"
|
|
|
|
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
|
msgid "Files in ASCII or UTF-8 encoding"
|
|
msgstr "Pliki z kodowaniem ASCII lub UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
|
#, object-pascal-format
|
|
msgid "File %s was converted to text format."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
|
msgid "Files not in ASCII nor UTF-8 encoding"
|
|
msgstr "Pliki z kodowaniem innym niż ASCII i UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
|
msgid "file where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilter
|
|
msgid "Filter"
|
|
msgstr "Filtr"
|
|
|
|
#: lazarusidestrconsts.lisfilter3
|
|
#, object-pascal-format
|
|
msgid "Filter: %s"
|
|
msgstr "Filtr: %s"
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
|
msgid "Filter all messages of certain type"
|
|
msgstr "Filtruj komunikaty określonego typu"
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
|
#, object-pascal-format
|
|
msgid "Filter all messages of type %s"
|
|
msgstr "Filtruj komunikaty typu %s"
|
|
|
|
#: lazarusidestrconsts.lisfilteralreadyexists
|
|
msgid "Filter already exists"
|
|
msgstr "Filtr już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
|
msgid "Filter Debug Messages and below"
|
|
msgstr "Odfiltruj komunikaty Debug i bardziej szczegółowe"
|
|
|
|
#: lazarusidestrconsts.lisfilterhintsandbelow
|
|
msgid "Filter Hints and below"
|
|
msgstr "Odfiltruj podpowiedzi (Hint) i bardziej szczegółowe"
|
|
|
|
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
|
msgid "Filter Hints without Source Position"
|
|
msgstr "Odfiltruj podpowiedzi bez lokalizacji w źródłach"
|
|
|
|
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
|
msgid "Filter None, do not filter by urgency"
|
|
msgstr "Nie filtruj według ważności"
|
|
|
|
#: lazarusidestrconsts.lisfilternonurgentmessages
|
|
msgid "Filter non urgent Messages"
|
|
msgstr "Odfiltruj komunikaty mniej ważne"
|
|
|
|
#: lazarusidestrconsts.lisfilternotesandbelow
|
|
msgid "Filter Notes and below"
|
|
msgstr "Odfiltruj wskazówki (Notes) i bardziej szczegółowe"
|
|
|
|
#: lazarusidestrconsts.lisfiltersets
|
|
msgid "Filter Sets"
|
|
msgstr "Zestawy fitrów"
|
|
|
|
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
|
#, fuzzy
|
|
msgid "Filter the available options list"
|
|
msgstr "Pliki dostępne na liście \"Otwórz poprzedni\"."
|
|
|
|
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
|
msgid "Filter Verbose Messages and below"
|
|
msgstr "Odfiltruj komunikaty Verbose i bardziej szczegółowe"
|
|
|
|
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
|
msgid "Filter Warnings and below"
|
|
msgstr "Odfiltruj ostrzeżenia i bardziej szczegółowe"
|
|
|
|
#: lazarusidestrconsts.lisfind
|
|
msgid "Find ..."
|
|
msgstr "Znajdź..."
|
|
|
|
#: lazarusidestrconsts.lisfinddeclarationof
|
|
#, object-pascal-format
|
|
msgid "Find Declaration of %s"
|
|
msgstr "Znajdź deklarację %s"
|
|
|
|
#: lazarusidestrconsts.lisfindfiledirectories
|
|
msgid "D&irectories"
|
|
msgstr "Katalog&i"
|
|
|
|
#: lazarusidestrconsts.lisfindfilefilemask
|
|
msgid "Fi&le mask"
|
|
msgstr "Wzorz&ec"
|
|
|
|
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
|
msgid "Include &sub directories"
|
|
msgstr "Uwzględnia&j podkatalogi"
|
|
|
|
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr "Wzorzec wielowierszowy"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
|
#, fuzzy
|
|
#| msgid "search all files in &project"
|
|
msgid "all files in &project"
|
|
msgstr "we wszystkich plikach &projektu"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
|
#, fuzzy
|
|
#| msgid "search all &open files"
|
|
msgid "all &open files"
|
|
msgstr "wszystkie &otwarte pliki"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
|
#, fuzzy
|
|
#| msgid "search in &active file"
|
|
msgid "&active file"
|
|
msgstr "w &bieżącym pliku"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
|
#, fuzzy
|
|
#| msgid "search in &directories"
|
|
msgid "&directories"
|
|
msgstr "w katalo&gach"
|
|
|
|
#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
|
|
msgid "project &group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilewhere
|
|
#, fuzzy
|
|
#| msgid "Where"
|
|
msgid "Search location"
|
|
msgstr "Szukaj"
|
|
|
|
#: lazarusidestrconsts.lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr "Znajdź kombinację klawiszy"
|
|
|
|
#: lazarusidestrconsts.lisfindmissingunit
|
|
msgid "Find missing unit"
|
|
msgstr "Znajdź brakujący moduł"
|
|
|
|
#: lazarusidestrconsts.lisfirst
|
|
msgid "First"
|
|
msgstr "Na początku"
|
|
|
|
#: lazarusidestrconsts.lisfirsttest
|
|
msgid "&First test"
|
|
msgstr "Pierwszy &test"
|
|
|
|
#: lazarusidestrconsts.lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr "Naprawa pliku LFM"
|
|
|
|
#: lazarusidestrconsts.lisfocushint
|
|
#, fuzzy
|
|
msgid "Focus hint"
|
|
msgstr "WSKAZÓWKA:"
|
|
|
|
#: lazarusidestrconsts.lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr "Wymuś zmianę nazwy"
|
|
|
|
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
|
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisform
|
|
msgid "Form"
|
|
msgstr "Formatka"
|
|
|
|
#: lazarusidestrconsts.lisformacosdarwin
|
|
msgid "For macOS (Darwin)"
|
|
msgstr "Dla macOS (Darwin)"
|
|
|
|
#: lazarusidestrconsts.lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Błąd formatowania"
|
|
|
|
#: lazarusidestrconsts.lisforwindows
|
|
msgid "For Windows"
|
|
msgstr "Dla Windows"
|
|
|
|
#: lazarusidestrconsts.lisfoundversionexpected
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Found version %s, expected %s"
|
|
msgstr "zamiast końca programu \"end.\" znaleziono %s"
|
|
|
|
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
|
msgid "FPC version as one number (e.g. 20701)"
|
|
msgstr "Wersja FPC jako jedna liczba (np. 20701)"
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagefile2
|
|
msgid "FPC message file:"
|
|
msgstr "Plik z komunikatami FPC:"
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagesappendix
|
|
#, fuzzy
|
|
msgid "FPC messages: Appendix"
|
|
msgstr "Przeszukuj komunikaty z FPC"
|
|
|
|
#: lazarusidestrconsts.lisfpcresources
|
|
msgid "FPC resources (.res)"
|
|
msgstr "zasoby FPC (.res)"
|
|
|
|
#: lazarusidestrconsts.lisfpcsources
|
|
msgid "FPC sources"
|
|
msgstr "źródła FPC"
|
|
|
|
#: lazarusidestrconsts.lisfpctooold
|
|
msgid "FPC too old"
|
|
msgstr "Zbyt stary FPC"
|
|
|
|
#: lazarusidestrconsts.lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr "Wersja FPC: "
|
|
|
|
#: lazarusidestrconsts.lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr "Wersja FPC (np. 2.2.2)"
|
|
|
|
#: lazarusidestrconsts.lisfpdoceditor
|
|
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr "Edytor FPDoc"
|
|
|
|
#: lazarusidestrconsts.lisfpdocerrorwriting
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Error writing \"%s\"%s%s"
|
|
msgstr "Błąd przy zapisie formularza do strumienia \"%s\": %s"
|
|
|
|
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
|
#, fuzzy
|
|
msgid "FPDoc syntax error"
|
|
msgstr "Błąd składniowy w wyrażeniu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagename
|
|
msgid "FPDoc package name:"
|
|
msgstr "Nazwa pakietu FPDoc:"
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
|
msgid "FPDoc package name. Default is project file name."
|
|
msgstr "Nazwa pakietu FPDoc. Domyślnie jest to nazwa pliku projektu."
|
|
|
|
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
|
#, object-pascal-format
|
|
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgcompilernotexecutable
|
|
#, object-pascal-format
|
|
msgid "The compiler [%s] configured for Fppkg is not an executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgcompilernotexists
|
|
#, object-pascal-format
|
|
msgid "The compiler [%s] configured for Fppkg does not exist."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgcompilernotfound
|
|
#, object-pascal-format
|
|
msgid "Could not find the compiler [%s] configured for Fppkg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgcompilerproblem
|
|
msgid "there is a problem with the Free Pascal compiler executable, "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgconfgenproblems
|
|
msgid "Warnings have to be resolved first"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgconfiguration
|
|
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgcreatefilefailed
|
|
#, object-pascal-format
|
|
msgid "Failed to generate the configuration file \"%s\": %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfilestobewritten
|
|
msgid "Files to be written:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfixconfiguration
|
|
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
|
|
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
|
|
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
|
|
msgid "An up-to-date version is needed to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
|
|
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
|
|
msgid "It is probably too old to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
|
|
#, object-pascal-format
|
|
msgid "The fpcmkcfg configuration tool it too old [%s]."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkginstallationpath
|
|
#, object-pascal-format
|
|
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkglibprefix
|
|
#, object-pascal-format
|
|
msgid "Fpc library prefix: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgprefix
|
|
#, object-pascal-format
|
|
msgid "Fpc prefix: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgproblem
|
|
msgid "Problem with Fppkg configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
|
|
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgrtlnotfound
|
|
msgid "Fppkg reports that the RTL is not installed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconfexception
|
|
#, object-pascal-format
|
|
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconffailed
|
|
#, object-pascal-format
|
|
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconfigfile
|
|
msgid "Write new configuration files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisframe
|
|
msgid "Frame"
|
|
msgstr "Ramka"
|
|
|
|
#: lazarusidestrconsts.lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr "W&yszukiwanie w górę"
|
|
|
|
#: lazarusidestrconsts.lisfreeingbufferlines
|
|
#, object-pascal-format
|
|
msgid "freeing buffer lines: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
|
msgid "Free Pascal Compiler messages"
|
|
msgstr "Komunikaty kompilatora Free Pascala"
|
|
|
|
#: lazarusidestrconsts.lisfreepascalprefix
|
|
msgid "Free Pascal compiler prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
|
msgid "Free Pascal source directory"
|
|
msgstr "Katalog ze źródłami Free Pascala"
|
|
|
|
#: lazarusidestrconsts.lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr "Wyszu&kiwanie w dół"
|
|
|
|
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr "Dodatkowe pliki do przeszukania (np. /path/*.pas;/path2/*.pp)"
|
|
|
|
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Znajdź lub zmień nazwę identyfikatora"
|
|
|
|
#: lazarusidestrconsts.lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Znajdź referencje"
|
|
|
|
#: lazarusidestrconsts.lisfriidentifier
|
|
#, object-pascal-format
|
|
msgid "Identifier: %s"
|
|
msgstr "Identyfikator: %s"
|
|
|
|
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr "we wszystkich otwartych pakietach i projektach"
|
|
|
|
#: lazarusidestrconsts.lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "w bieżącym module"
|
|
|
|
#: lazarusidestrconsts.lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "w głównym projekcie"
|
|
|
|
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr "w projekcjie/pakiecie zawierajym bieżący moduł"
|
|
|
|
#: lazarusidestrconsts.lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Błędny identyfikator"
|
|
|
|
#: lazarusidestrconsts.lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr "Zmień wszystkie wystąpienia"
|
|
|
|
#: lazarusidestrconsts.lisfrirenaming
|
|
msgid "Renaming"
|
|
msgstr "Zmiana nazwy"
|
|
|
|
#: lazarusidestrconsts.lisfrisearch
|
|
msgid "Search"
|
|
msgstr "Szukaj"
|
|
|
|
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr "Szukaj też w komentarzach"
|
|
|
|
#: lazarusidestrconsts.lisfull
|
|
msgid "Full"
|
|
msgstr "Pełna nazwa"
|
|
|
|
#: lazarusidestrconsts.lisfunction
|
|
msgctxt "lazarusidestrconsts.lisfunction"
|
|
msgid "Function"
|
|
msgstr "Funkcja"
|
|
|
|
#: lazarusidestrconsts.lisgeneral
|
|
msgctxt "lazarusidestrconsts.lisgeneral"
|
|
msgid "General"
|
|
msgstr "Ogólne"
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgcfg
|
|
#, object-pascal-format
|
|
msgid "Fppkg configuration: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgcompcfg
|
|
#, object-pascal-format
|
|
msgid "Fppkg compiler configuration: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgconfiguration
|
|
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
|
|
msgid "Generate new Fppkg configuration files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
|
msgid "get word at current cursor position"
|
|
msgstr "pobierz słowo z aktualnej pozycji kursora"
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
|
|
msgid "Get word at current cursor position."
|
|
msgstr "Pobierz słowo z aktualnej pozycji kursora."
|
|
|
|
#: lazarusidestrconsts.lisglobalsettings
|
|
msgid "Global settings"
|
|
msgstr "Ustawienia globalne"
|
|
|
|
#: lazarusidestrconsts.lisgotoline
|
|
msgid "Goto Line"
|
|
msgstr "Przeskocz do numeru wiersza"
|
|
|
|
#: lazarusidestrconsts.lisgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
"\n"
|
|
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroup
|
|
msgid "Group"
|
|
msgstr "Grupa"
|
|
|
|
#: lazarusidestrconsts.lisgrouplocalvariables
|
|
msgid "Group automatically defined local variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
|
msgid "Enable or Disable groups of debug output. Valid Options are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr "Powiększ do największego"
|
|
|
|
#: lazarusidestrconsts.lishashelp
|
|
#, fuzzy
|
|
msgid "Has Help"
|
|
msgstr "Pomo&c"
|
|
|
|
#: lazarusidestrconsts.lisheadercolors
|
|
msgid "Header colors"
|
|
msgstr "Kolory nagłówka"
|
|
|
|
#: lazarusidestrconsts.lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Komentarz w nagłówku dla klas"
|
|
|
|
#: lazarusidestrconsts.lishelpentries
|
|
#, fuzzy
|
|
msgid "Help entries"
|
|
msgstr "Pomo&c"
|
|
|
|
#: lazarusidestrconsts.lishelpselectordialog
|
|
#, fuzzy
|
|
msgid "Help selector"
|
|
msgstr "Pomo&c"
|
|
|
|
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
|
#, fuzzy
|
|
msgid "Help for Free Pascal Compiler message"
|
|
msgstr "Startowe makra Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
|
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
|
msgstr "Ukryj wszystkie wskazówki i ostrzeżenia przez wstawienie dyrektywy IDE {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
|
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
|
msgstr "Ukryj komunikat w %s poprzez wstawienie dyrektywy IDE {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
|
msgid "Hide message by inserting IDE directive {%H-}"
|
|
msgstr "Ukryj komunikat poprzez wstawienie dyrektywy IDE {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
|
|
#, object-pascal-format
|
|
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
|
|
msgstr "Ukryj komunikat poprzez wstawienie {$warn %s off} do modułu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lishidesearch
|
|
#, fuzzy
|
|
msgid "Hide Search"
|
|
msgstr "Szukaj"
|
|
|
|
#: lazarusidestrconsts.lishidewindow
|
|
msgctxt "lazarusidestrconsts.lishidewindow"
|
|
msgid "Hide window"
|
|
msgstr "Ukryj okno"
|
|
|
|
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Hide with package option (-vm%s)"
|
|
msgstr "Opcje pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
|
#, object-pascal-format
|
|
msgid "Hide with project option (-vm%s)"
|
|
msgstr "Ukryj za pomocą opcji projektu (-vm%s)"
|
|
|
|
#: lazarusidestrconsts.lishint
|
|
msgctxt "lazarusidestrconsts.lishint"
|
|
msgid "Hint"
|
|
msgstr "Podpowiedź"
|
|
|
|
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
|
msgid "Hint: A default value can be defined in the conditionals."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
|
msgid "A hint at property's name shows its description."
|
|
msgstr "Podpowiedź przy nazwie właściwości pokaże zawarty opis."
|
|
|
|
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
|
|
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishints
|
|
#, object-pascal-format
|
|
msgid ", Hints: %s"
|
|
msgstr ", Podpowiedzi: %s"
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
|
#, object-pascal-format
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr "Porada: Funkcja Make Resourcestring wymaga stałej łańcuchowej.%sWybierz wyrażenie i spróbuj ponownie."
|
|
|
|
#: lazarusidestrconsts.lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Pokaż formularze"
|
|
|
|
#: lazarusidestrconsts.lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Pokaż moduły"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Bazy"
|
|
|
|
#: lazarusidestrconsts.lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Opcje pomocy"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Właściwości:"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Przeglądarki"
|
|
|
|
#: lazarusidestrconsts.lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "Ścieżka FPC Doc HTML"
|
|
|
|
#: lazarusidestrconsts.lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Poziomo"
|
|
|
|
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
|
msgid "Horizontal lines between properties."
|
|
msgstr "Poziome linie pomiędzy właściwościami."
|
|
|
|
#: lazarusidestrconsts.lisid
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisid"
|
|
msgid "ID"
|
|
msgstr "Identyfikator języka Lazarus (np. ep, pl, de)"
|
|
|
|
#: lazarusidestrconsts.lisidcaddition
|
|
msgid "Addition"
|
|
msgstr "Dodawanie"
|
|
|
|
#: lazarusidestrconsts.lisidcopening
|
|
msgid "Opening"
|
|
msgstr "Otwieranie"
|
|
|
|
#: lazarusidestrconsts.liside
|
|
#, fuzzy
|
|
msgid "IDE"
|
|
msgstr "O IDE"
|
|
|
|
#: lazarusidestrconsts.lisidebuildoptions
|
|
msgid "IDE build options"
|
|
msgstr "Opcje budowania IDE"
|
|
|
|
#: lazarusidestrconsts.lisidecompileandrestart
|
|
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
|
msgstr "IDE po instalacji lub usunięciu pakietów zostanie przebudowane i ponownie uruchomione."
|
|
|
|
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
|
#, object-pascal-format
|
|
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
|
#, object-pascal-format
|
|
msgid "Creating Makefile for package %s"
|
|
msgstr "Tworzenie Makefile dla pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
|
msgid "Information about the IDE"
|
|
msgstr "Informacje o IDE"
|
|
|
|
#: lazarusidestrconsts.lisidemacros
|
|
msgid "IDE Macros"
|
|
msgstr "Makra IDE"
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
|
|
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
|
|
msgstr "IDE obsługuje Application.Scaled (Hi-DPI) w głównym module."
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
|
msgid "The IDE maintains the title in main unit."
|
|
msgstr "IDE obsługuje tytuł w głównym module."
|
|
|
|
#: lazarusidestrconsts.lisidentifier
|
|
msgid "identifier"
|
|
msgstr "identyfikator"
|
|
|
|
#: lazarusidestrconsts.lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr "Identyfikator zaczyna się od..."
|
|
|
|
#: lazarusidestrconsts.lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr "Identyfikator zawiera..."
|
|
|
|
#: lazarusidestrconsts.lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "IDE Options:"
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsbuildmode
|
|
msgid "IDE title shows selected build mode"
|
|
msgstr "Tytul IDE zawiera bieżący tryb budowania"
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsprojectdir
|
|
msgid "IDE title shows project directory"
|
|
msgstr "Tytuł IDE zawiera katalog projektu"
|
|
|
|
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
|
msgid "IDE title starts with project name"
|
|
msgstr "Nazwa projektu na początek tytułu okna IDE"
|
|
|
|
#: lazarusidestrconsts.lisiecoallbuildmodes
|
|
msgid "All build modes"
|
|
msgstr "Wszystkie tryby budowania"
|
|
|
|
#: lazarusidestrconsts.lisiecocompileroptionsof
|
|
msgid "Compiler options of"
|
|
msgstr "Opcje kompilatora"
|
|
|
|
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
|
msgid "Current build mode"
|
|
msgstr "Aktualny tryb budowania"
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxml
|
|
msgid "Error opening XML"
|
|
msgstr "Błąd otwarcia XML"
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
|
#, object-pascal-format
|
|
msgid "Error opening XML file \"%s\":%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
|
msgid "Export Compiler Options"
|
|
msgstr "Eksport opcji kompilatora"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr "Plik już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
#, object-pascal-format
|
|
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
|
msgid "Import Compiler Options"
|
|
msgstr "Import opcji kompilatora"
|
|
|
|
#: lazarusidestrconsts.lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Odczytaj z pliku"
|
|
|
|
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" does not contain compiler options."
|
|
msgstr "Plik \"%s\" nie zawiera opcji kompilatora."
|
|
|
|
#: lazarusidestrconsts.lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Zapisz do pliku"
|
|
|
|
#: lazarusidestrconsts.lisifnotchecked
|
|
msgid "If not checked:"
|
|
msgstr "Jeżeli nie zaznaczone:"
|
|
|
|
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
|
msgid "If only the session info changed, ask about saving it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
|
#, object-pascal-format
|
|
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr "Ignoruj wszystko"
|
|
|
|
#: lazarusidestrconsts.lisignoreandcontinue
|
|
msgid "Ignore and continue"
|
|
msgstr "Ignoruj i kontynuuj"
|
|
|
|
#: lazarusidestrconsts.lisignoreuseasancestor
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Ignore, use %s as ancestor"
|
|
msgstr "Nazwa \"%s\" nie jest prawidłowym identyfikatorem pascala."
|
|
|
|
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
|
#, fuzzy
|
|
msgid "Imitate indentation of current unit, project or package"
|
|
msgstr "w projekcjie/pakiecie zawierajym bieżący moduł"
|
|
|
|
#: lazarusidestrconsts.lisimplementationcommentforclass
|
|
#, fuzzy
|
|
msgid "Implementation comment for class"
|
|
msgstr "Komentarz w nagłówku dla klas"
|
|
|
|
#: lazarusidestrconsts.lisimport
|
|
msgctxt "lazarusidestrconsts.lisimport"
|
|
msgid "Import"
|
|
msgstr "Importuj"
|
|
|
|
#: lazarusidestrconsts.lisimportant
|
|
msgctxt "lazarusidestrconsts.lisimportant"
|
|
msgid "Important"
|
|
msgstr "Ważne"
|
|
|
|
#: lazarusidestrconsts.lisimportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
|
msgid "Import environment options"
|
|
msgstr "Import opcji środowiska"
|
|
|
|
#: lazarusidestrconsts.lisimportfromfile
|
|
msgid "Import from File"
|
|
msgstr "Import z pliku"
|
|
|
|
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
|
msgid "Importing BuildModes is not supported for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportlist
|
|
msgid "Import list"
|
|
msgstr "Importuj listę"
|
|
|
|
#: lazarusidestrconsts.lisimportpackagelistxml
|
|
msgid "Import package list (*.xml)"
|
|
msgstr "Importuj listę pakietów (*.xml)"
|
|
|
|
#: lazarusidestrconsts.lisimpossible
|
|
msgid "Impossible"
|
|
msgstr "Niemożliwe"
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "In a source directory of the package \"%s\"."
|
|
msgstr "Nie można utworzyć katalogu ze źródłami \"%s\"%sdla pakietu %s."
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
|
msgid "In a source directory of the project. Check for duplicates."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludepath
|
|
msgid "include path"
|
|
msgstr "ścieżka dołączanych plików"
|
|
|
|
#: lazarusidestrconsts.lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr "Dodatkowe ścieżki"
|
|
|
|
#: lazarusidestrconsts.lisincluderecursive
|
|
msgid "Include, recursive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincompatibleppu
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid ", incompatible ppu=%s"
|
|
msgstr "Niekompatybilny identyfikator"
|
|
|
|
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
|
#, fuzzy
|
|
msgid "Incorrect configuration directory found"
|
|
msgstr "Nie znaleziono katalogu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisincorrectfppkgconfiguration
|
|
#, object-pascal-format
|
|
msgid "there is a problem with the Fppkg configuration. (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindentationforpascalsources
|
|
msgid "Indentation for Pascal sources"
|
|
msgstr "Wcięcia źródeł Pascala"
|
|
|
|
#: lazarusidestrconsts.lisinformation
|
|
msgid "Information"
|
|
msgstr "Informacje"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutunit
|
|
#, object-pascal-format
|
|
msgid "Information about %s"
|
|
msgstr "Informacja o %s"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
|
msgid "Information about used FPC"
|
|
msgstr "Informacje o używanym FPC"
|
|
|
|
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
|
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfrontofrelated
|
|
msgid "In front of related"
|
|
msgstr "Przed spokrewnionym"
|
|
|
|
#: lazarusidestrconsts.lisinheriteditem
|
|
#, fuzzy
|
|
msgid "Inherited Item"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.lisinheritedparameters
|
|
#, fuzzy
|
|
msgid "Inherited parameters"
|
|
msgstr "Parametry:"
|
|
|
|
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
|
#, fuzzy
|
|
msgid "Inherited project component"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.lisinitialchecks
|
|
msgid "Initial Checks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinitializelocalvariable
|
|
#, fuzzy
|
|
msgid "Initialize Local Variable"
|
|
msgstr "Zmienna"
|
|
|
|
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
#, object-pascal-format
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsert
|
|
msgctxt "lazarusidestrconsts.lisinsert"
|
|
msgid "Insert"
|
|
msgstr "Insert"
|
|
|
|
#: lazarusidestrconsts.lisinsertassignment
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Insert Assignment %s := ..."
|
|
msgstr "Dodaj operator przypisania :="
|
|
|
|
#: lazarusidestrconsts.lisinsertdate
|
|
msgid "insert date"
|
|
msgstr "wstaw datę"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtime
|
|
msgid "insert date and time"
|
|
msgstr "wstaw datę i godzinę"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
|
msgid "Insert date and time. Optional: format string."
|
|
msgstr "Wstaw datę i czas. Opcjonalnie: format."
|
|
|
|
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
|
msgid "Insert date. Optional: format string."
|
|
msgstr "Wstaw datę. Opcjonalnie: format."
|
|
|
|
#: lazarusidestrconsts.lisinsertendifneeded
|
|
#, fuzzy
|
|
msgid "insert end if needed"
|
|
msgstr "Automatycznie przebuduj gdy trzeba"
|
|
|
|
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
|
|
msgid ""
|
|
"Insert header of current procedure.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
|
|
"WithoutClassKeyword,// without 'class' proc keyword\n"
|
|
"AddClassName, // extract/add ClassName.\n"
|
|
"WithoutClassName, // skip classname\n"
|
|
"WithoutName, // skip function name\n"
|
|
"WithoutParamList, // skip param list\n"
|
|
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
|
|
"WithParameterNames, // extract parameter names\n"
|
|
"WithoutParamTypes, // skip colon, param types and default values\n"
|
|
"WithDefaultValues, // extract default values\n"
|
|
"WithResultType, // extract colon + result type\n"
|
|
"WithOfObject, // extract 'of object'\n"
|
|
"WithCallingSpecs, // extract cdecl; inline;\n"
|
|
"WithProcModifiers, // extract forward; alias; external;\n"
|
|
"WithComments, // extract comments and spaces\n"
|
|
"InUpperCase, // turn to uppercase\n"
|
|
"CommentsToSpace, // replace comments with a single space\n"
|
|
" // (default is to skip unnecessary space,\n"
|
|
" // e.g 'Do ;' normally becomes 'Do;'\n"
|
|
" // with this option you get 'Do ;')\n"
|
|
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
|
|
"WithoutSemicolon, // skip semicolon at end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertmacro
|
|
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
|
msgid "Insert Macro"
|
|
msgstr "Wstaw makro"
|
|
|
|
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
|
#, fuzzy
|
|
msgid "Insert name of current procedure."
|
|
msgstr "Nazwa nowej procedury"
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag2
|
|
#, fuzzy
|
|
msgid "Insert printshort tag"
|
|
msgstr "Wstaw znacznik pogrubienia"
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurehead
|
|
#, fuzzy
|
|
msgid "insert procedure head"
|
|
msgstr "Zasady wstawiania procedur"
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurename
|
|
#, fuzzy
|
|
msgid "insert procedure name"
|
|
msgstr "Nazwa nowej procedury"
|
|
|
|
#: lazarusidestrconsts.lisinsertsemicolonifneeded
|
|
#, fuzzy
|
|
msgid "Insert semicolon if needed"
|
|
msgstr "Średnik"
|
|
|
|
#: lazarusidestrconsts.lisinserttime
|
|
msgid "insert time"
|
|
msgstr "wstaw godzinę"
|
|
|
|
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
|
msgid "Insert time. Optional: format string."
|
|
msgstr "Wstaw czas. Opcjonalnie: format."
|
|
|
|
#: lazarusidestrconsts.lisinserturltag
|
|
msgid "Insert url tag"
|
|
msgstr "Wstaw znacznik url"
|
|
|
|
#: lazarusidestrconsts.lisinsession
|
|
#, fuzzy
|
|
msgid "In session"
|
|
msgstr "Sesja"
|
|
|
|
#: lazarusidestrconsts.lisinstalled
|
|
msgid "installed"
|
|
msgstr "zainstalowany"
|
|
|
|
#: lazarusidestrconsts.lisinstallitilikethefat
|
|
msgid "Install it, I like the fat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallpackagesmsg
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"The following packages are not installed, but available in the main repository: %s.\n"
|
|
"Do you wish to install missing packages?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Instaluj zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lisinstalluninstallpackages
|
|
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
|
msgid "Install/Uninstall Packages"
|
|
msgstr "Instaluj/odinstaluj pakiety"
|
|
|
|
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
|
msgid "Instead of compile package create a simple Makefile."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsufficientencoding
|
|
#, fuzzy
|
|
msgid "Insufficient encoding"
|
|
msgstr "Kodowanie"
|
|
|
|
#: lazarusidestrconsts.lisinteractive
|
|
msgid "Interactive"
|
|
msgstr "Interaktywnie"
|
|
|
|
#: lazarusidestrconsts.lisinternalerror
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "internal error: %s"
|
|
msgstr "Błąd przy zapisie formularza do strumienia \"%s\": %s"
|
|
|
|
#: lazarusidestrconsts.lisinvaliddelete
|
|
#, fuzzy
|
|
msgid "Invalid delete"
|
|
msgstr "Usuń nieprawidłowe ścieżki"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutable
|
|
msgid "Invalid Executable"
|
|
msgstr "Nieprawidłowy plik wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
|
#, object-pascal-format, fuzzy
|
|
msgid "The file \"%s\" is not executable."
|
|
msgstr "Plik odpluskwiacza \"%s\" nie jest wykonywalny."
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
|
#, object-pascal-format
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Błędne wyrażenie.%sWskazówka: funkcja Utwórz łańcuch zasobów oczekuje stałej łańcuchowej w pojedyńczym pliku. Wybierz wyrażenie i spróbuj ponownie."
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilename
|
|
msgid "Invalid file name"
|
|
msgstr "Nieprawidłowa nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr "Błędny filtr"
|
|
|
|
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
|
#, object-pascal-format
|
|
msgid "Invalid line, column in message%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosin
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Invalid macros in \"%s\""
|
|
msgstr "niedozwolony znak \"%s\" w %s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
|
#, object-pascal-format
|
|
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
|
#, object-pascal-format
|
|
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
|
msgstr "Niedozwolone makro \"%s\". Nazwa makro musi być identyfikatorem Pascala."
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Invalid macro name \"%s\". The name is a keyword."
|
|
msgstr "Jako nazwy komponentu \"%s\" próbujesz użyć słowa kluczowego"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmask
|
|
#, fuzzy
|
|
msgid "Invalid Mask"
|
|
msgstr "Maska wejściowa:"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmode
|
|
#, object-pascal-format
|
|
msgid "Invalid mode %s"
|
|
msgstr "Błędny tryb %s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmultiselection
|
|
#, fuzzy
|
|
msgid "Invalid multiselection"
|
|
msgstr "Nieprawidłowa pułapka"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Nieprawidłowy identyfikator pascala"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiername
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
|
|
msgstr "Nazwa \"%s\" nie jest prawidłowym identyfikatorem pascala."
|
|
|
|
#: lazarusidestrconsts.lisinvalidprocname
|
|
#, fuzzy
|
|
msgid "Invalid proc name"
|
|
msgstr "Błędna nazwa modułu"
|
|
|
|
#: lazarusidestrconsts.lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Błędna nazwa pliku projektu"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
|
#, fuzzy
|
|
msgid "Invalid publishing Directory"
|
|
msgstr "Polecenie po module publikacji"
|
|
|
|
#: lazarusidestrconsts.lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr "Nieprawidłowe zaznaczenie"
|
|
|
|
#: lazarusidestrconsts.lisinvalidversionin
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "invalid version in %s"
|
|
msgstr "Nieodpowiednia wersja"
|
|
|
|
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
|
#, object-pascal-format
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s należy już do projektu."
|
|
|
|
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "\"%s\" jest błędną nazwą projektu.%sWybierz inną nazwę (np. project1.lpi)"
|
|
|
|
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
|
#, object-pascal-format
|
|
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisddirectorynotfound
|
|
msgid "directory not found"
|
|
msgstr "nie znaleziono katalogu"
|
|
|
|
#: lazarusidestrconsts.lisissues
|
|
msgid "Issues"
|
|
msgstr "Ograniczenia komponentów według platform"
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
|
#, object-pascal-format
|
|
msgid "I wonder how you did that. Error in the %s:"
|
|
msgstr "Ciekawe jak to zrobiłeś. Błąd w pliku %s:"
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
|
msgid "I wonder how you did that: Error in the base directory:"
|
|
msgstr "Ciekawe jak to zrobiłeś. Błąd w katalogu podstawowym:"
|
|
|
|
#: lazarusidestrconsts.lisjhjumphistory
|
|
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Historia skoków"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerror
|
|
msgid "Jump to error"
|
|
msgstr "Przeskocz do błędu"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
|
msgid "When an error in the sources is found at identifier completion, jump to it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoprocedure
|
|
#, object-pascal-format
|
|
msgid "Jump to procedure %s"
|
|
msgstr "Przejdź do procedury %s"
|
|
|
|
#: lazarusidestrconsts.liskb
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%s KB"
|
|
msgstr "%s nie istnieje: %s"
|
|
|
|
#: lazarusidestrconsts.liskeep2
|
|
msgid "Keep"
|
|
msgstr "Zachowaj"
|
|
|
|
#: lazarusidestrconsts.liskeepfileopen
|
|
msgid "Keep converted files open in editor"
|
|
msgstr "Zachowaj przekonwertowane pliki otwarte w edytorze"
|
|
|
|
#: lazarusidestrconsts.liskeepfileopenhint
|
|
msgid "All project files will be open in editor after conversion"
|
|
msgstr "Po konwersji wszystkie pliki projektu zostaną otwarte w edytorze"
|
|
|
|
#: lazarusidestrconsts.liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Zachowaj nazwę"
|
|
|
|
#: lazarusidestrconsts.liskeepopen
|
|
msgid "Keep open"
|
|
msgstr "Utrzymaj otwarte"
|
|
|
|
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
|
msgid "Keep relative indentation of multi line template"
|
|
msgstr "Zachowaj względne wcięcia wielo-linijkowych szablonów"
|
|
|
|
#: lazarusidestrconsts.liskeepsubindentation
|
|
msgid "Keep indentation"
|
|
msgstr "Zachowaj wcięcia"
|
|
|
|
#: lazarusidestrconsts.liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr "Zachowaj i kontynuuj"
|
|
|
|
#: lazarusidestrconsts.liskey
|
|
msgctxt "lazarusidestrconsts.liskey"
|
|
msgid "Key"
|
|
msgstr "Klawisz"
|
|
|
|
#: lazarusidestrconsts.liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Polecenia użytkownika"
|
|
|
|
#: lazarusidestrconsts.liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Polecenia projektanta"
|
|
|
|
#: lazarusidestrconsts.liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr "Polecenia Inspektora obiektów"
|
|
|
|
#: lazarusidestrconsts.liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr "Klawisz (lub sekwencja dwóch)"
|
|
|
|
#: lazarusidestrconsts.liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr "Przerwij budowanie"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpaddress
|
|
msgid "Add Address Breakpoint"
|
|
msgstr "Dodaj pułapkę w adresie"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpsource
|
|
msgid "Add Source Breakpoint"
|
|
msgstr "Dodaj pułapkę w źródle"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
|
#, fuzzy
|
|
msgid "Add Data/WatchPoint"
|
|
msgstr "Dane.."
|
|
|
|
#: lazarusidestrconsts.liskmaddwatch
|
|
msgctxt "lazarusidestrconsts.liskmaddwatch"
|
|
msgid "Add watch"
|
|
msgstr "Dodaj czujkę"
|
|
|
|
#: lazarusidestrconsts.liskmbuildmanymodes
|
|
msgid "Build many modes"
|
|
msgstr "Buduj wiele trybów"
|
|
|
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr "Buduj projekt/program"
|
|
|
|
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr "Wybierz schemat skrótów klawiszowych"
|
|
|
|
#: lazarusidestrconsts.liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Klasyczny"
|
|
|
|
#: lazarusidestrconsts.liskmcleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Wyczyść i buduj"
|
|
|
|
#: lazarusidestrconsts.liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Zamknij projekt"
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr "Edytor symboli CodeTools"
|
|
|
|
#: lazarusidestrconsts.liskmcompileprojectprogram
|
|
msgid "Compile project/program"
|
|
msgstr "Kompiluj program/projekt"
|
|
|
|
#: lazarusidestrconsts.liskmconfigbuildfile
|
|
msgid "Config \"Build File\""
|
|
msgstr "Konfiguruj \"Buduj plik\""
|
|
|
|
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
|
msgid "Configure Custom Components"
|
|
msgstr "Konfiguruj komponenty użytkownika"
|
|
|
|
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr "Pomoc kontekstowa"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Konwertuj pakiet Delphi do pakietu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
|
msgid "Convert Delphi Project to Lazarus Project"
|
|
msgstr "Konwertuj projekt z Delphi do projektu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
|
msgid "Convert Delphi Unit to Lazarus Unit"
|
|
msgstr "Konwertuj moduł z Delphi do modułu Lazarusa"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
|
msgid "Convert DFM File to LFM"
|
|
msgstr "Konwertuj plik z roszerzeniem .dfm do .lfm"
|
|
|
|
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
|
msgid "Copy selected components"
|
|
msgstr "Kopiuj wybrane komponenty do schowka"
|
|
|
|
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
|
msgid "Cut selected components"
|
|
msgstr "Wytnij wybrane komponenty do schowka"
|
|
|
|
#: lazarusidestrconsts.liskmdefaulttoosx
|
|
#, fuzzy
|
|
msgid "Default adapted to macOS"
|
|
msgstr "(domyślne)"
|
|
|
|
#: lazarusidestrconsts.liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Usuń ostatni znak"
|
|
|
|
#: lazarusidestrconsts.liskmdiffeditorfiles
|
|
msgid "Diff Editor Files"
|
|
msgstr "Różnice między plikami w edytorze"
|
|
|
|
#: lazarusidestrconsts.liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr "Edycja szablonów kodu"
|
|
|
|
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr "Edycja pomocy kontekstowej"
|
|
|
|
#: lazarusidestrconsts.liskmencloseselection
|
|
msgid "Enclose Selection"
|
|
msgstr "Zamknięcie zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr "Sprawdź/Modyfikuj"
|
|
|
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr "Ustawienia zewnętrznych narzędzi"
|
|
|
|
#: lazarusidestrconsts.liskmfindincremental
|
|
msgid "Find Incremental"
|
|
msgstr "Szukaj przyrostowo"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker0
|
|
msgid "Go to bookmark 0"
|
|
msgstr "Przejdź do znacznika 0"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker1
|
|
msgid "Go to bookmark 1"
|
|
msgstr "Przejdź do znacznika 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker2
|
|
msgid "Go to bookmark 2"
|
|
msgstr "Przejdź do znacznika 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker3
|
|
msgid "Go to bookmark 3"
|
|
msgstr "Przejdź do znacznika 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker4
|
|
msgid "Go to bookmark 4"
|
|
msgstr "Przejdź do znacznika 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker5
|
|
msgid "Go to bookmark 5"
|
|
msgstr "Przejdź do znacznika 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker6
|
|
msgid "Go to bookmark 6"
|
|
msgstr "Przejdź do znacznika 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker7
|
|
msgid "Go to bookmark 7"
|
|
msgstr "Przejdź do znacznika 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker8
|
|
msgid "Go to bookmark 8"
|
|
msgstr "Przejdź do znacznika 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker9
|
|
msgid "Go to bookmark 9"
|
|
msgstr "Przejdź do znacznika 9"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor1
|
|
msgid "Go to source editor 1"
|
|
msgstr "Przejdź do znacznika 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor10
|
|
msgid "Go to source editor 10"
|
|
msgstr "Przejdź do znacznika 10"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor2
|
|
msgid "Go to source editor 2"
|
|
msgstr "Przejdź do znacznika 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor3
|
|
msgid "Go to source editor 3"
|
|
msgstr "Przejdź do znacznika 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor4
|
|
msgid "Go to source editor 4"
|
|
msgstr "Przejdź do znacznika 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor5
|
|
msgid "Go to source editor 5"
|
|
msgstr "Przejdź do znacznika 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor6
|
|
msgid "Go to source editor 6"
|
|
msgstr "Przejdź do znacznika 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor7
|
|
msgid "Go to source editor 7"
|
|
msgstr "Przejdź do znacznika 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor8
|
|
msgid "Go to source editor 8"
|
|
msgstr "Przejdź do znacznika 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor9
|
|
msgid "Go to source editor 9"
|
|
msgstr "Przejdź do znacznika 9"
|
|
|
|
#: lazarusidestrconsts.liskminsertdateandtime
|
|
msgid "Insert date and time"
|
|
msgstr "Wstaw bieżącą datę i czas"
|
|
|
|
#: lazarusidestrconsts.liskminsertusername
|
|
msgid "Insert username"
|
|
msgstr "Wstaw bieżącą nazwę użytkownika"
|
|
|
|
#: lazarusidestrconsts.liskminspect
|
|
msgid "Inspect"
|
|
msgstr "Badaj"
|
|
|
|
#: lazarusidestrconsts.liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr "Schemat skrótów klawiszowych"
|
|
|
|
#: lazarusidestrconsts.liskmlazarusdefault
|
|
msgid "Lazarus default"
|
|
msgstr "Domyślne Lazarusa"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxapple
|
|
msgid "macOS, Apple style"
|
|
msgstr "macOS, styl Apple"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxlaz
|
|
msgid "macOS, Lazarus style"
|
|
msgstr "macOS, styl Lazarusa"
|
|
|
|
#: lazarusidestrconsts.liskmnewpackage
|
|
msgctxt "lazarusidestrconsts.liskmnewpackage"
|
|
msgid "New package"
|
|
msgstr "Nowy pakiet"
|
|
|
|
#: lazarusidestrconsts.liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Nowy projekt"
|
|
|
|
#: lazarusidestrconsts.liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Nowy projekt z pliku"
|
|
|
|
#: lazarusidestrconsts.liskmnewunit
|
|
msgctxt "lazarusidestrconsts.liskmnewunit"
|
|
msgid "New Unit"
|
|
msgstr "Nowy moduł"
|
|
|
|
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
|
msgid "Note: All keys will be set to the values of the chosen scheme."
|
|
msgstr "Uwaga: Wszystkim klawiszom zostaną przyporządkowane wartości z wybranego schematu."
|
|
|
|
#: lazarusidestrconsts.liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr "Otwórz plik pakietu"
|
|
|
|
#: lazarusidestrconsts.liskmopenrecent
|
|
msgctxt "lazarusidestrconsts.liskmopenrecent"
|
|
msgid "Open Recent"
|
|
msgstr "Otwórz poprzedni"
|
|
|
|
#: lazarusidestrconsts.liskmopenrecentpackage
|
|
msgid "Open recent package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenrecentproject
|
|
msgid "Open recent project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
|
msgid "Paste Components"
|
|
msgstr "Wklej komponenty ze schowka"
|
|
|
|
#: lazarusidestrconsts.liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr "Wstrzymaj działanie programu"
|
|
|
|
#: lazarusidestrconsts.liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Publikuj projekt"
|
|
|
|
#: lazarusidestrconsts.liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr "Szybka kompilacja bez linkowania"
|
|
|
|
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
|
msgid "Remove Active File from Project"
|
|
msgstr "Usuń z projektu bieżący plik"
|
|
|
|
#: lazarusidestrconsts.liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Uruchom program"
|
|
|
|
#: lazarusidestrconsts.liskmsaveall
|
|
msgid "SaveAll"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsaveas
|
|
msgid "SaveAs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Zapisz projekt"
|
|
|
|
#: lazarusidestrconsts.liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr "Zapisz projekt jako"
|
|
|
|
#: lazarusidestrconsts.liskmselectlineend
|
|
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
|
msgid "Select Line End"
|
|
msgstr "Wybierz do końca linii"
|
|
|
|
#: lazarusidestrconsts.liskmselectlinestart
|
|
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Wybierz do początku linii"
|
|
|
|
#: lazarusidestrconsts.liskmselectpagebottom
|
|
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Wybierz dół strony"
|
|
|
|
#: lazarusidestrconsts.liskmselectpagetop
|
|
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Wybierz górę strony"
|
|
|
|
#: lazarusidestrconsts.liskmselectwordleft
|
|
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Wybierz słowo po lewej"
|
|
|
|
#: lazarusidestrconsts.liskmselectwordright
|
|
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Wybierz słowo po prawej"
|
|
|
|
#: lazarusidestrconsts.liskmsetfreebookmark
|
|
msgid "Set free Bookmark"
|
|
msgstr "Załóż zakładkę"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker0
|
|
msgid "Set bookmark 0"
|
|
msgstr "Ustaw znacznik 0"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker1
|
|
msgid "Set bookmark 1"
|
|
msgstr "Ustaw znacznik 1"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker2
|
|
msgid "Set bookmark 2"
|
|
msgstr "Ustaw znacznik 2"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker3
|
|
msgid "Set bookmark 3"
|
|
msgstr "Ustaw znacznik 3"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker4
|
|
msgid "Set bookmark 4"
|
|
msgstr "Ustaw znacznik 4"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker5
|
|
msgid "Set bookmark 5"
|
|
msgstr "Ustaw znacznik 5"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker6
|
|
msgid "Set bookmark 6"
|
|
msgstr "Ustaw znacznik 6"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker7
|
|
msgid "Set bookmark 7"
|
|
msgstr "Ustaw znacznik 7"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker8
|
|
msgid "Set bookmark 8"
|
|
msgstr "Ustaw znacznik 8"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker9
|
|
msgid "Set bookmark 9"
|
|
msgstr "Ustaw znacznik 9"
|
|
|
|
#: lazarusidestrconsts.liskmstopprogram
|
|
msgid "Stop Program"
|
|
msgstr "Zatrzymaj program"
|
|
|
|
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr "Przełącz pomiędzy formularzem i modułem"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker0
|
|
msgid "Toggle bookmark 0"
|
|
msgstr "Przełącz zakładkę 0"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker1
|
|
msgid "Toggle bookmark 1"
|
|
msgstr "Przełącz zakładkę 1"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker2
|
|
msgid "Toggle bookmark 2"
|
|
msgstr "Przełącz zakładkę 2"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker3
|
|
msgid "Toggle bookmark 3"
|
|
msgstr "Przełącz zakładkę 3"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker4
|
|
msgid "Toggle bookmark 4"
|
|
msgstr "Przełącz zakładkę 4"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker5
|
|
msgid "Toggle bookmark 5"
|
|
msgstr "Przełącz zakładkę 5"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker6
|
|
msgid "Toggle bookmark 6"
|
|
msgstr "Przełącz zakładkę 6"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker7
|
|
msgid "Toggle bookmark 7"
|
|
msgstr "Przełącz zakładkę 7"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker8
|
|
msgid "Toggle bookmark 8"
|
|
msgstr "Przełącz zakładkę 8"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker9
|
|
msgid "Toggle bookmark 9"
|
|
msgstr "Przełącz zakładkę 9"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewassembler
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
|
msgid "View Assembler"
|
|
msgstr "Pokaż okno assemblera"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
|
msgid "View Breakpoints"
|
|
msgstr "Pokaż pułapki"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Pokaż stos wywołań"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
|
msgid "Toggle view Code Browser"
|
|
msgstr "Przełącz widoczność Przeglądarki kodu"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr "Przełącz widoczność Przeglądarki kodu"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
|
msgid "Toggle View Component Palette"
|
|
msgstr "Przełącz widoczność palety komponentów"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
|
msgid "View Debuger Event Log"
|
|
msgstr "Pokaż log zdarzeń odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
|
msgid "View Debugger Output"
|
|
msgstr "Pokaż wyjście odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr "Przełącz widoczność Edytora dokumentacji"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewhistory
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
|
msgid "View History"
|
|
msgstr "Pokaż historię"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
|
msgid "View Local Variables"
|
|
msgstr "Pokaż zmienne lokalne"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr "Przełącz widoczność okna Komunikatów"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr "Przełącz widoczność Inspektora obiektów"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
|
msgid "View Console In/Output"
|
|
msgstr "Pokaż konsolę wejścia/wyjścia"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewregisters
|
|
msgid "View Registers"
|
|
msgstr "Pokaż rejestry"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr "Przełącz widoczność wyników wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr "Przełącz widoczność Edytora źródeł"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewthreads
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Pokaż wątki"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewwatches
|
|
msgid "View Watches"
|
|
msgstr "Pokaż zmienne"
|
|
|
|
#: lazarusidestrconsts.liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr "Pokaż historię skoków"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr "Pokaż opcje projektu"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectsource
|
|
msgid "View Project Source"
|
|
msgstr "Pokaż źródło projektu"
|
|
|
|
#: lazarusidestrconsts.liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr "Informacje o module"
|
|
|
|
#: lazarusidestrconsts.lislastopened
|
|
msgid "Last opened"
|
|
msgstr "Ostatnio otwarte"
|
|
|
|
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr "Błędny program ładujący"
|
|
|
|
#: lazarusidestrconsts.lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Linia poleceń uruchamianego programu"
|
|
|
|
#: lazarusidestrconsts.lislazarusdefault
|
|
msgid "Lazarus Default"
|
|
msgstr "Domyślne Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Katalog Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lislazarusdirhint
|
|
#, object-pascal-format
|
|
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdiroverride
|
|
#, fuzzy
|
|
msgid "directory to be used as a basedirectory"
|
|
msgstr "Plik jest w użyciu"
|
|
|
|
#: lazarusidestrconsts.lislazaruseditorv
|
|
#, object-pascal-format
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr "IDE Lazarusa v%s"
|
|
|
|
#: lazarusidestrconsts.lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr "IDE Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr "Identyfikator języka Lazarus (np. ep, pl, de)"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr "Nazwa języka Lazarusa (np. english, polski)"
|
|
|
|
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [options] <project-filename>"
|
|
|
|
#: lazarusidestrconsts.lislazbuild
|
|
msgid "lazbuild"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
|
msgid "Are you sure you want to delete this build profile?"
|
|
msgstr "Na pewno chcesz skasować ten profil budowania?"
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildmany
|
|
msgid "Build Many"
|
|
msgstr "Buduj wiele"
|
|
|
|
#: lazarusidestrconsts.lislazbuildcommonsettings
|
|
msgid "Common Settings"
|
|
msgstr "Ustawienia wspólne"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
|
msgid "Confirm before build"
|
|
msgstr "Potwierdź zanim przebudujesz"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
|
msgid "Confirm deletion"
|
|
msgstr "Potwierdź kasowanie"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddebugide
|
|
msgid "Debug IDE"
|
|
msgstr "IDE Odpluskwiania"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefines
|
|
msgid "Defines"
|
|
msgstr "Symbole"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
|
msgid "Defines without -d"
|
|
msgstr "Symbole bez -d"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditdefines
|
|
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
|
msgid "Edit Defines"
|
|
msgstr "Edytuj Symbole"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
|
msgid "Edit list of defines which can be used by any profile"
|
|
msgstr "Edycja listy symboli, które mogą być użyte przez dowolny profil"
|
|
|
|
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Błąd podczas zapisu do pliku"
|
|
|
|
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
|
#, object-pascal-format
|
|
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
|
msgid "Manage Build Profiles"
|
|
msgstr "Zarządzaj profilami budowania"
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
|
msgid "Manage profiles"
|
|
msgstr "Zarządzaj profilami"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
|
msgid "Name of the active profile"
|
|
msgstr "Nazwa aktywnego profilu"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprof
|
|
msgid "Add New Profile"
|
|
msgstr "Dodaj nowy profil"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
|
#, fuzzy
|
|
msgid "Current build options will be associated with:"
|
|
msgstr "Opcje budowania IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnormalide
|
|
msgid "Normal IDE"
|
|
msgstr "Normalne IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptimizedide
|
|
msgid "Optimized IDE"
|
|
msgstr "Zoptymalizowane IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Opcje:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
|
msgid "Options passed to compiler"
|
|
msgstr "Opcje przekazane do kompilatora"
|
|
|
|
#: lazarusidestrconsts.lislazbuildprofile
|
|
msgid "Profile to build"
|
|
msgstr "Profil budowania"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprof
|
|
msgid "Rename Profile"
|
|
msgstr "Zmiana nazwy profilu"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
|
msgid "New name for profile:"
|
|
msgstr "Nowa nazwa profilu:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
|
msgid "Restart after building IDE"
|
|
msgstr "Uruchom ponownie po zbudowaniu IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
|
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
|
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
|
msgstr "Ponownie uruchom Lazarusa po budowaniu IDE (nie działa przy budowaniu innych części)"
|
|
|
|
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
|
msgid "Select profiles to build"
|
|
msgstr "Zaznacz profile do budowania"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
|
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
|
msgid "Show confirmation dialog when building directly from Tools menu"
|
|
msgstr "Pokaż żądanie potwierdzenia przy budowaniu bezpośrednio z menu Narzędzia"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
|
msgid "Show options and defines for command line"
|
|
msgstr "Pokaż opcje i symbole dla wiersza poleceń"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Docelowy procesor:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr "Docelowy katalog:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Docelowy system operacyjny:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
|
#, object-pascal-format
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr "Nie powiódł się zapis pliku \"%s\":%s"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
|
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
|
msgid "Update revision.inc"
|
|
msgstr "Zaktualizuj revision.inc"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
|
msgid "Update revision info in \"About Lazarus\" dialog"
|
|
msgstr "Uaktualnij numer wersji w oknie informacji o Lazarusie"
|
|
|
|
#: lazarusidestrconsts.lislazcleanupbuildall
|
|
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
|
msgid "Clean Up + Build all"
|
|
msgstr "Czyść + Buduj wszystko"
|
|
|
|
#: lazarusidestrconsts.lislazver
|
|
msgid "Lazarus Version (e.g. 1.2.4)"
|
|
msgstr "Wersja Lazarusa (np. 1.6.0)"
|
|
|
|
#: lazarusidestrconsts.lislclwidgettype
|
|
msgid "LCL widget type"
|
|
msgstr "Typ widżetu LCL"
|
|
|
|
#: lazarusidestrconsts.lisldaddlinktoinherited
|
|
#, fuzzy
|
|
msgid "Add link to inherited"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.lisldcopyfrominherited
|
|
#, fuzzy
|
|
msgid "Copy from inherited"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
|
#, object-pascal-format
|
|
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
|
#, fuzzy
|
|
msgid "Move entries to inherited"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
|
#, fuzzy
|
|
msgid "No valid FPDoc path"
|
|
msgstr "Ścieżka"
|
|
|
|
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
#, object-pascal-format
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleft
|
|
msgctxt "lazarusidestrconsts.lisleft"
|
|
msgid "Left"
|
|
msgstr "W lewo"
|
|
|
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr "Lewy odstęp obramowania. Wartość dodawana do odstępu podstawowego."
|
|
|
|
#: lazarusidestrconsts.lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Lewe umocowanie"
|
|
|
|
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleftsides
|
|
msgid "Left sides"
|
|
msgstr "Lewe strony"
|
|
|
|
#: lazarusidestrconsts.lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr "Rozmieść równomiernie lewe krawędzie"
|
|
|
|
#: lazarusidestrconsts.lisless
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisless"
|
|
msgid "Less"
|
|
msgstr "Przewiń o jeden mniej"
|
|
|
|
#: lazarusidestrconsts.lislevels
|
|
msgctxt "lazarusidestrconsts.lislevels"
|
|
msgid "Levels"
|
|
msgstr "Poziomy"
|
|
|
|
#: lazarusidestrconsts.lislfmfile
|
|
msgid "LFM file"
|
|
msgstr "plik LFM"
|
|
|
|
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
|
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr "Plik LFM uszkodzony"
|
|
|
|
#: lazarusidestrconsts.lislfmisok
|
|
msgid "LFM is ok"
|
|
msgstr "LFM jest OK"
|
|
|
|
#: lazarusidestrconsts.lislgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislibrarypath
|
|
msgid "library path"
|
|
msgstr "ścieżka do biblioteki"
|
|
|
|
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
|
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislink
|
|
msgid "Link:"
|
|
msgstr "Łącz:"
|
|
|
|
#: lazarusidestrconsts.lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr "opcje linkera"
|
|
|
|
#: lazarusidestrconsts.lislinktarget
|
|
msgid "Link target"
|
|
msgstr "Cel linkowania"
|
|
|
|
#: lazarusidestrconsts.lislistofallcasevalues
|
|
msgid "list of all case values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisloadingfailed
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Loading %s failed."
|
|
msgstr "Nie można usunąć pliku \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisloadmacrofrom
|
|
msgid "Load macro from"
|
|
msgstr "Załaduj makro z"
|
|
|
|
#: lazarusidestrconsts.lislocal
|
|
msgid "&Local"
|
|
msgstr "&Lokalne"
|
|
|
|
#: lazarusidestrconsts.lislowercasestring
|
|
#, fuzzy
|
|
msgid "lowercase string"
|
|
msgstr "LOWERCASE(<Tekst>)/Zamienia <Tekst> na małe litery."
|
|
|
|
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
|
msgid "Lowercase string given as parameter."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
|
|
msgid "Maximize compatibility of project files (LPI and LPS)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
|
|
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
|
|
msgid "Maximize compatibility of package file (LPK)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
|
|
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
|
#, object-pascal-format
|
|
msgid "lpk has vanished on disk. Using as alternative%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkismissing
|
|
msgid "lpk is missing"
|
|
msgstr "brak lpk"
|
|
|
|
#: lazarusidestrconsts.lislrsincludefiles
|
|
msgid "Lazarus resources (.lrs) include files"
|
|
msgstr "Dołączane pliki zasobów Lazarusa (.lrs)"
|
|
|
|
#: lazarusidestrconsts.lismacpreferences
|
|
msgid "Preferences..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacro
|
|
#, object-pascal-format
|
|
msgid "Macro %s"
|
|
msgstr "Makro %s"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Wprowadź dane"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "Wprowadź parametry uruchomieniowe"
|
|
|
|
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
|
msgid "Main unit has Uses section containing all units of project"
|
|
msgstr "Główny moduł posiada sekcję Uses zawierającą wszystkie moduły projektu"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsource
|
|
msgid "Main unit is Pascal source"
|
|
msgstr "Główny moduł jest źródłem Pascala"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
|
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
|
msgstr "Zakładaj, że to Pascal, nawet gdy rozszerzenie inne niż .pas/.pp."
|
|
|
|
#: lazarusidestrconsts.lismajorchangesdetected
|
|
msgid "Major changes detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakecurrent
|
|
msgctxt "lazarusidestrconsts.lismakecurrent"
|
|
msgid "Current"
|
|
msgstr "Bieżący"
|
|
|
|
#: lazarusidestrconsts.lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Utwórz plik wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr "Nie znaleziono \"make\""
|
|
|
|
#: lazarusidestrconsts.lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Utwórz ResourceString"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "Dodaj do sekcji"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
|
#, object-pascal-format
|
|
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "Resourcestring \"%s\" już istnieje.%sWybierz inną nazwę.%sUżyj Ignoruj aby dodać ją pomimo tego."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Opcje konwersji"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr "Identyfikator użytkownika"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
|
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Identyfikator"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Długość identyfikatora:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr "Przedrostek identyfikatora:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Wstaw alfabetycznie"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Wstaw z uwzględnieniem kontekstu"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Błędna sekcja Resourcestring"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "Resourcestring już istnieje"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Sekcja Resourcestring:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Podgląd źródła"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "Stała łańcuchowa w źródle"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "Stałe łańcuchowe o tej samej wartości:"
|
|
|
|
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
|
msgid "Make sure all ppu files of a package are in its output directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismanagesourceeditors
|
|
msgid "Manage Source Editors ..."
|
|
msgstr "Zarządzaj oknami kodu źródłowego ..."
|
|
|
|
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
|
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
|
#, object-pascal-format
|
|
msgid "Maximum parallel processes, 0 means default (%s)"
|
|
msgstr "Maksymalna liczba równoległych procesów. 0 oznacza domyślnie (%s)"
|
|
|
|
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
|
#, object-pascal-format
|
|
msgid "%s Maybe you have to recompile the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismb
|
|
#, object-pascal-format
|
|
msgid "%s MB"
|
|
msgstr "%s MB"
|
|
|
|
#: lazarusidestrconsts.lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Przerwij budowanie"
|
|
|
|
#: lazarusidestrconsts.lismenuaboutfpc
|
|
msgid "About FPC"
|
|
msgstr "O FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuaddbreakpoint
|
|
msgctxt "lazarusidestrconsts.lismenuaddbreakpoint"
|
|
msgid "Add &Breakpoint"
|
|
msgstr "Dodaj pułapkę"
|
|
|
|
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
|
msgid "Add Active File to Package ..."
|
|
msgstr "Dodaj aktywny plik do pakietu ..."
|
|
|
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
|
msgid "Add Jump Point to History"
|
|
msgstr "Dodaj punkt skoku do historii"
|
|
|
|
#: lazarusidestrconsts.lismenuaddtoproject
|
|
msgid "Add Editor File to Project"
|
|
msgstr "Dodaj plik do projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuaddwatch
|
|
msgid "Add &Watch ..."
|
|
msgstr "Dodaj zmienną ..."
|
|
|
|
#: lazarusidestrconsts.lismenubeaklinesinselection
|
|
msgid "Break Lines in Selection"
|
|
msgstr "Łam linie w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Zbuduj plik"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarus
|
|
msgid "Build Lazarus with Current Profile"
|
|
msgstr "Buduj Lazarusa zgodnie z bieżącym profilem"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarusprof
|
|
#, object-pascal-format
|
|
msgid "Build Lazarus with Profile: %s"
|
|
msgstr "Buduj Lazarusa z profilu : %s"
|
|
|
|
#: lazarusidestrconsts.lismenuchecklfm
|
|
msgid "Check LFM File in Editor"
|
|
msgstr "Sprawdź plik LFM w edytorze"
|
|
|
|
#: lazarusidestrconsts.lismenucleandirectory
|
|
msgid "Clean Directory ..."
|
|
msgstr "Wyczyść katalogi..."
|
|
|
|
#: lazarusidestrconsts.lismenucleanupandbuild
|
|
msgid "Clean up and Build ..."
|
|
msgstr "Wyczyść i buduj ..."
|
|
|
|
#: lazarusidestrconsts.lismenucloseall
|
|
msgid "Close A&ll"
|
|
msgstr "Zamknij wszystko"
|
|
|
|
#: lazarusidestrconsts.lismenucloseeditorfile
|
|
msgid "&Close Editor File"
|
|
msgstr "Zamknij edytowany plik"
|
|
|
|
#: lazarusidestrconsts.lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Zamknij projekt"
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor ..."
|
|
msgstr "Edytor symboli CodeTools..."
|
|
|
|
#: lazarusidestrconsts.lismenucommentselection
|
|
msgid "Comment Selection"
|
|
msgstr "Zaznacz i zamień na komentarz"
|
|
|
|
#: lazarusidestrconsts.lismenucomparefiles
|
|
msgid "Compare files ..."
|
|
msgstr "Porównaj pliki ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompilemanymodes
|
|
msgid "Compile many Modes ..."
|
|
msgstr "Buduj wiele trybów ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompletecode
|
|
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Uzupełnij kod"
|
|
|
|
#: lazarusidestrconsts.lismenucompletecodeinteractive
|
|
msgid "Complete Code (with dialog)"
|
|
msgstr "Uzupełnij kod (z oknem dialogowym)"
|
|
|
|
#: lazarusidestrconsts.lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Konfiguruj plik \"Buduj+Uruchom\" ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
|
msgid "Configure Custom Components ..."
|
|
msgstr "Konfiguruj dodatkowe komponenty..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigexternaltools
|
|
msgid "Configure External Tools ..."
|
|
msgstr "Konfiguruj zewnętrzne narzędzia..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "Konfiguruj \"Buduj Lazarusa\" ..."
|
|
|
|
#: lazarusidestrconsts.lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr "Pomoc kontekstowa"
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
|
msgid "Convert Delphi Package to Lazarus Package ..."
|
|
msgstr "Konwertuj pakiet z Delphi do pakietu Lazarusa..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
|
msgid "Convert Delphi Project to Lazarus Project ..."
|
|
msgstr "Konwertuj projekt z Delphi do projektu Lazarusa..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
|
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
|
msgstr "Konwertuj moduł z Delphi do modułu Lazarusa ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
|
#, fuzzy
|
|
#| msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
|
msgid "Convert Binary DFM to LFM ..."
|
|
msgstr "Konwertuj plik .dfm na tekst w pliku .lfm + sprawdź składnię..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertencoding
|
|
msgid "Convert Encoding of Projects/Packages ..."
|
|
msgstr "Zmień kodowanie projektów lub pakietów ..."
|
|
|
|
#: lazarusidestrconsts.lismenudebugwindows
|
|
msgid "Debug Windows"
|
|
msgstr "Okna odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lismenudelphiconversion
|
|
msgid "Delphi Conversion"
|
|
msgstr "Konwersja plików Delphi"
|
|
|
|
#: lazarusidestrconsts.lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Edycja"
|
|
|
|
#: lazarusidestrconsts.lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Szablony źródeł..."
|
|
|
|
#: lazarusidestrconsts.lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr "Edycja pomocy kontekstowej"
|
|
|
|
#: lazarusidestrconsts.lismenueditinstallpkgs
|
|
msgctxt "lazarusidestrconsts.lismenueditinstallpkgs"
|
|
msgid "Install/Uninstall Packages ..."
|
|
msgstr "Instaluj/odinstaluj pakiety ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
|
|
#, object-pascal-format
|
|
msgid "Accelerator(&&) key \"%s\" needs changing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
|
|
msgid "Add a new item above selected item"
|
|
msgstr "Dodaj nowy element powyżej zaznaczonego elementu"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
|
|
msgid "Add a new item after selected item"
|
|
msgstr "Dodaj nowy element po zaznaczonym elemencie"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
|
|
msgid "Add a new item before selected item"
|
|
msgstr "Dodaj nowy element przed zaznaczonym elementem"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
|
|
msgid "Add a new item below selected item"
|
|
msgstr "Dodaj nowy element poniżej zaznaczonego elementu"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
|
|
msgid "Add a submenu at the right of selected item"
|
|
msgstr "Dodaj podmenu z prawej strony zaznaczonego elementu"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
|
|
msgid "Add a submenu below selected item"
|
|
msgstr "Dodaj podmenu poniżej zaznaczonego elementu"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddfromtemplate
|
|
msgid "&Add from template ..."
|
|
msgstr "Dod&aj z szablonu..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddiconfroms
|
|
#, object-pascal-format
|
|
msgid "Add icon from %s"
|
|
msgstr "Dodaj ikonę z %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddimagelisticon
|
|
msgid "Add imagelist &icon"
|
|
msgstr "Dodaj &ikonę z imagelist"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddmenuitem
|
|
msgid "Add menu item"
|
|
msgstr "Dodaj element menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemabove
|
|
msgid "&Add new item above"
|
|
msgstr "Dod&aj nowy element powyżej"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemafter
|
|
msgid "Add ne&w item after"
|
|
msgstr "Dodaj no&wy element po"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembefore
|
|
msgid "&Add new item before"
|
|
msgstr "Dod&aj nowy element przed"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembelow
|
|
msgid "Add ne&w item below"
|
|
msgstr "Dodaj no&wy element poniżej"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddonclickhandler
|
|
msgid "Add &OnClick handler"
|
|
msgstr "Dodaj zdarzenie &OnClick"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorafter
|
|
msgid "Add separator &after"
|
|
msgstr "Dodaj sep&arator po"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
|
|
msgid "Add separator &before"
|
|
msgstr "Dodaj separator &przed"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenu
|
|
msgid "Add submenu"
|
|
msgstr "Dodaj podmenu"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
|
|
msgid "Add &submenu below"
|
|
msgstr "Dodaj podmenu poniżej"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenuright
|
|
msgid "Add &submenu right"
|
|
msgstr "Dodaj podmenu z prawej"
|
|
|
|
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
|
#, object-pascal-format
|
|
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
|
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
|
|
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
|
|
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
|
|
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaption
|
|
msgid "Caption"
|
|
msgstr "Nagłówek"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptioneditemss
|
|
#, object-pascal-format
|
|
msgid "Captioned items: %s"
|
|
msgstr "Elementy z nazwami: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
|
|
msgid "Caption should not be blank"
|
|
msgstr "Etykieta nie może być pusta"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
|
|
#, object-pascal-format
|
|
msgid "Change conflicting accelerator \"%s\""
|
|
msgstr "Zmień kolidujący klawisz skrótu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
|
|
msgid "Change imagelist &icon"
|
|
msgstr "Zmień &ikonę z imagelist"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Change %s for %s"
|
|
msgstr "Zmień klasę %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Change shortcut conflict \"%s\""
|
|
msgstr "Zmień klasę %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Change the shortCut for %s"
|
|
msgstr "Zmień klasę %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Change the shortCutKey2 for %s"
|
|
msgstr "Zmień klasę %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
|
|
msgid "Choose template to delete"
|
|
msgstr "Wybierz szablon do skasowania"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
|
|
msgid "Choose template to insert"
|
|
msgstr "Wybierz szablon do wstawienia"
|
|
|
|
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
|
|
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
|
|
#, fuzzy
|
|
msgid "Component is unexpected kind"
|
|
msgstr "Rodzaj kształtu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
|
|
msgid "Component is unnamed"
|
|
msgstr "Komponent nie jest nazwany"
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
|
|
#, fuzzy
|
|
msgid "<conflict resolution complete>"
|
|
msgstr "Konflikt "
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
|
|
#, object-pascal-format
|
|
msgid "Conflicts found initially: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
|
|
#, object-pascal-format
|
|
msgid "Deepest nested menu level: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteitem
|
|
msgid "&Delete item"
|
|
msgstr "Skasuj element"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletemenutemplate
|
|
msgid "&Delete menu template ..."
|
|
msgstr "Usuń szablon menu ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
|
|
msgid "Delete saved menu template"
|
|
msgstr "Usuń zapisany szablon menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
|
|
msgid "Delete selected menu template"
|
|
msgstr "Usuń wybrany szablon menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
|
|
#, fuzzy
|
|
msgid "Delete this item and its subitems?"
|
|
msgstr "Usunąć element \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
|
|
msgid "Display preview as &Popup menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditcaption
|
|
msgid "Edit &Caption"
|
|
msgstr "Edy&cja etykiety"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
|
|
#, object-pascal-format
|
|
msgid "Editing Caption of %s"
|
|
msgstr "Edycja etykiety %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsdots
|
|
#, object-pascal-format
|
|
msgid "To resolve conflict edit %s.%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsfors
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Editing %s for %s"
|
|
msgstr "Edycja"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Editing %s.%s - no menuitem selected"
|
|
msgstr "Wywołaj procedurę %sRegister%s bieżącego modułu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteramenudescription
|
|
msgid "Enter a menu &Description:"
|
|
msgstr "Opis menu:"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
|
|
#, object-pascal-format
|
|
msgid "Enter a new ShortCut for %s"
|
|
msgstr "Wpisz nowy skrót do makra %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
|
|
#, object-pascal-format
|
|
msgid "Enter a new ShortCutKey2 for %s"
|
|
msgstr "Wpisz nowy ShortCutKey2 do makra %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
|
|
msgid "Existing saved templates"
|
|
msgstr "Istniejące zapisane szablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
|
|
#, fuzzy
|
|
msgid "Further shortcut conflict"
|
|
msgstr "Konflikt "
|
|
|
|
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
|
|
msgid "Get help to use this editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgrabkey
|
|
msgid "&Grab key"
|
|
msgstr "Przechwyć klawisz"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexd
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "GroupIndex: %d"
|
|
msgstr "%d linii, %d znaków"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Values in use: %s"
|
|
msgstr "Użyj CheckBox dla wartości logicznych"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinadequatedescription
|
|
msgid "Inadequate Description"
|
|
msgstr "Nieodpowiedni opis"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
|
|
#, object-pascal-format
|
|
msgid "Insert menu template into root of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
|
|
msgid "Insert selected menu template"
|
|
msgstr "Wstaw z zaznaczonego szablonu menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorisnotassigned
|
|
msgid "is not assigned"
|
|
msgstr "nie jest przypisany"
|
|
|
|
#: lazarusidestrconsts.lismenueditoritemswithicons
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Items with icon: %s"
|
|
msgstr "Elementy"
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
|
|
#, object-pascal-format, fuzzy
|
|
msgid "List shortcuts and &accelerators for %s ..."
|
|
msgstr "Pakiet %s jest już na liście"
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
|
|
#, object-pascal-format, fuzzy
|
|
msgid "List shortcuts for %s ..."
|
|
msgstr "Usuń z listy \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Edytor Menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemactions
|
|
msgid "Menu Item actions"
|
|
msgstr "Działania elementów menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
|
|
#, object-pascal-format
|
|
msgid "Menuitem shortcut conflicts in %s"
|
|
msgstr "Skrót elementu menu jest w konflikcie z %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemdown
|
|
msgid "Mo&ve item down"
|
|
msgstr "Przesuń element w dół"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemleft
|
|
msgid "&Move item left"
|
|
msgstr "Przesuń ele&ment w lewo"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemright
|
|
msgid "Mo&ve item right"
|
|
msgstr "Przesuń element w prawo"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemup
|
|
msgid "&Move item up"
|
|
msgstr "Przesuń ele&ment w górę"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr "Przesuń zaznaczony element w dół"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
|
|
msgid "Move selected item to the left"
|
|
msgstr "Przesuń zaznaczony element w lewo"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
|
|
msgid "Move selected item to the right"
|
|
msgstr "Przesuń zaznaczony element w prawo"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr "Przesuń zaznaczony element w górę"
|
|
|
|
#: lazarusidestrconsts.lismenueditorna
|
|
msgid "n/a"
|
|
msgstr "nd."
|
|
|
|
#: lazarusidestrconsts.lismenueditornomenuselected
|
|
msgid "(no menu selected)"
|
|
msgstr "(nie wybrano menu)"
|
|
|
|
#: lazarusidestrconsts.lismenueditornone
|
|
msgid "<none>"
|
|
msgstr "<brak>"
|
|
|
|
#: lazarusidestrconsts.lismenueditornonenone
|
|
msgid "<none>,<none>"
|
|
msgstr "<brak>,<brak>"
|
|
|
|
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
|
|
#, fuzzy
|
|
msgid "<no shortcut conflicts>"
|
|
msgstr "Skrót już istnieje"
|
|
|
|
#: lazarusidestrconsts.lismenueditornousersavedtemplates
|
|
msgid "No user-saved templates"
|
|
msgstr "Nie ma szablonów zapisanych przez użytkownika"
|
|
|
|
#: lazarusidestrconsts.lismenueditorpickaniconfroms
|
|
#, object-pascal-format
|
|
msgid "Pick an icon from %s"
|
|
msgstr "Pobierz ikonę z %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorpopupassignmentss
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Popup assignments: %s"
|
|
msgstr "%s nie istnieje: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorradioitem
|
|
msgid "RadioItem"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorremainingconflictss
|
|
#, object-pascal-format
|
|
msgid "Remaining conflicts: %s"
|
|
msgstr "Pozostały konflikty: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorremoveallseparators
|
|
msgid "&Remove all separators"
|
|
msgstr "Usuń wszystkie separatory"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolvedconflictss
|
|
#, object-pascal-format
|
|
msgid "Resolved conflicts: %s"
|
|
msgstr "Rozwiązane konflikty: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
|
|
msgid "Resolve selected conflict"
|
|
msgstr "Rozwiąż zaznaczony konflikt"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
|
|
msgid "&Resolve shortcut conflicts ..."
|
|
msgstr "&Rozwiąż konflikt skrótów ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavedtemplates
|
|
msgid "Saved templates"
|
|
msgstr "Zapisane szablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
|
|
msgid "&Save menu as a template ..."
|
|
msgstr "Zapi&sz menu jako szablon ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
|
|
msgid "Save menu as template"
|
|
msgstr "Zapisz menu jako szablon"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
|
|
msgid "Save menu as template for future use"
|
|
msgstr "Zapisz menu jako szablon do użycia w przyszłości"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
|
|
msgid "Save menu shown as a new template"
|
|
msgstr "Zapisz wyświetlone menu jako nowy szablon"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
|
#, object-pascal-format
|
|
msgid "%s conflicts with %s"
|
|
msgstr "%s jest w konflikcie z %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorseparators
|
|
msgid "Se¶tors"
|
|
msgstr "Se¶tory"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutitemss
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Shortcut items: %s"
|
|
msgstr "Skrót już istnieje"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
|
|
#, fuzzy
|
|
msgid "Shortcut not yet changed"
|
|
msgstr "Skrót już istnieje"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts
|
|
msgid "Shortcuts"
|
|
msgstr "Skróty"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts2
|
|
msgid "Shortc&uts"
|
|
msgstr "Skrót&y"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
|
|
#, fuzzy
|
|
msgid "Shortcuts and Accelerator keys"
|
|
msgstr "Nie ma konfliktu klawiszy."
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts (%d)"
|
|
msgstr "Skróty (%d)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts (%d) and Accelerator keys (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
|
|
#, fuzzy
|
|
msgid "Shortcut,Source Property"
|
|
msgstr "Skrót już istnieje"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedins
|
|
#, object-pascal-format
|
|
msgid "Shortcuts used in %s"
|
|
msgstr "Skróty użyte w %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts used in %s (%d)"
|
|
msgstr "Skróty użyte w %s (%d)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
|
|
msgid "ShowMenuEditor: TMenu parameter is nil"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsins
|
|
#, object-pascal-format
|
|
msgid "\"%s\" in %s"
|
|
msgstr "\"%s\" w %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"\"%s\" is already in use in %s as a shortcut.\n"
|
|
"Try a different shortcut."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
|
|
#, object-pascal-format
|
|
msgid "Please expand: \"%s\" is not a sufficient Description"
|
|
msgstr "Proszę rozwinąć: \"%s\" nie jest wystarczającym opisem"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
|
|
msgid "Some widgetsets do not allow separators in the main menubar"
|
|
msgstr "Niektóre zestawy widżetów nie dopuszczają separatorów w menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcuts
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%s: Shortcuts"
|
|
msgstr "%s nie istnieje: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
|
|
#, object-pascal-format
|
|
msgid "%s: Shortcuts and accelerator keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsssonclicks
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%s.%s.%s - OnClick: %s"
|
|
msgstr "Błąd zapisu: %s%sPlik: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorstandardtemplates
|
|
msgid "Standard templates"
|
|
msgstr "Standardowe szablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatedescription
|
|
msgid "Template description:"
|
|
msgstr "Opis szablonu:"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplates
|
|
msgid "&Templates"
|
|
msgstr "Szablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatesaved
|
|
msgid "Template saved"
|
|
msgstr "Zapisano szablon"
|
|
|
|
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
|
|
msgid ""
|
|
"There are no user-saved menu templates.\n"
|
|
"\n"
|
|
"Only standard default templates are available."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
|
|
#, object-pascal-format
|
|
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"You have to change the shortcut from %s\n"
|
|
"to avoid a conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
|
|
msgid "You must enter text for the Caption"
|
|
msgstr "Musisz podać tekst etykiety"
|
|
|
|
#: lazarusidestrconsts.lismenuencloseinifdef
|
|
msgid "Enclose in $IFDEF ..."
|
|
msgstr "Zaznacz i zamknij go w $IFDEF ..."
|
|
|
|
#: lazarusidestrconsts.lismenuencloseselection
|
|
msgid "Enclose Selection ..."
|
|
msgstr "Zaznacz i zamknij zaznaczenie w ..."
|
|
|
|
#: lazarusidestrconsts.lismenuevaluate
|
|
msgid "E&valuate/Modify ..."
|
|
msgstr "Sprawdź/Modyfikuj ..."
|
|
|
|
#: lazarusidestrconsts.lismenuextractproc
|
|
msgid "Extract Procedure ..."
|
|
msgstr "Zaznacz i wydziel procedurę ..."
|
|
|
|
#: lazarusidestrconsts.lismenufile
|
|
msgid "&File"
|
|
msgstr "&Plik"
|
|
|
|
#: lazarusidestrconsts.lismenufind
|
|
msgctxt "lazarusidestrconsts.lismenufind"
|
|
msgid "Find"
|
|
msgstr "Znajdź"
|
|
|
|
#: lazarusidestrconsts.lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr "&Znajdź..."
|
|
|
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
|
msgid "Find Other End of Code Block"
|
|
msgstr "Znajdź end jeśli kursor jest przed begin"
|
|
|
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
|
msgid "Find Start of Code Block"
|
|
msgstr "Znajdź begin jeśli kursor jest w funkcji"
|
|
|
|
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
|
msgid "Find Declaration at Cursor"
|
|
msgstr "Znajdź deklarację przy kursorze"
|
|
|
|
#: lazarusidestrconsts.lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Znajdź referencje do identyfikatora..."
|
|
|
|
#: lazarusidestrconsts.lismenufindinfiles
|
|
msgid "Find &in Files ..."
|
|
msgstr "Znajdź w pl&ikach..."
|
|
|
|
#: lazarusidestrconsts.lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "Znajdź &następny"
|
|
|
|
#: lazarusidestrconsts.lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "Znajdź &poprzedni"
|
|
|
|
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
|
msgid "Find References Of Used Unit"
|
|
msgstr "Znajdź odniesienia do używanego modułu"
|
|
|
|
#: lazarusidestrconsts.lismenugeneraloptions
|
|
msgid "Options ..."
|
|
msgstr "Opcje..."
|
|
|
|
#: lazarusidestrconsts.lismenugotoincludedirective
|
|
msgid "Goto Include Directive"
|
|
msgstr "Idź do dyrektywy include"
|
|
|
|
#: lazarusidestrconsts.lismenugotoline
|
|
msgid "Goto Line ..."
|
|
msgstr "Przeskocz do numeru wiersza..."
|
|
|
|
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
|
msgid "Guess Misplaced IFDEF/ENDIF"
|
|
msgstr "Znajdź niepotrzebną dyrektywę IFDEF/ENDIF"
|
|
|
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
|
msgid "Guess Unclosed Block"
|
|
msgstr "Znajdź niepotrzebny koniec linii end"
|
|
|
|
#: lazarusidestrconsts.lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "Pomo&c"
|
|
|
|
#: lazarusidestrconsts.lismenuideinternals
|
|
msgid "IDE Internals"
|
|
msgstr "Środowisko wewnętrzne"
|
|
|
|
#: lazarusidestrconsts.lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Szukaj przyrostowo"
|
|
|
|
#: lazarusidestrconsts.lismenuindentselection
|
|
msgid "Indent Selection"
|
|
msgstr "Zwiększ wcięcie"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
|
msgid "ChangeLog Entry"
|
|
msgstr "Element dziennika zmian"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcharacter
|
|
msgid "Insert from Character Map ..."
|
|
msgstr "Wstaw znak specjalny..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
|
msgid "Insert CVS Keyword"
|
|
msgstr "Wstaw słowo kluczowe CVS"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertdatetime
|
|
msgid "Current Date and Time"
|
|
msgstr "Bieżącą data i czas"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertfilename
|
|
msgid "Insert Full Filename ..."
|
|
msgstr "Wstaw pełną nazwę pliku ..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgeneral
|
|
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
|
msgid "Insert General"
|
|
msgstr "Wstaw informacje"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnotice
|
|
msgid "GPL Notice"
|
|
msgstr "Tekst licencji GPL"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
|
msgid "GPL Notice (translated)"
|
|
msgstr "Informacja o licencji GPL (przetłumaczona)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
|
msgid "LGPL Notice"
|
|
msgstr "Tekst licencji LGPL"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
|
msgid "LGPL Notice (translated)"
|
|
msgstr "Licencja LGPL (tłumaczenie)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnotice
|
|
msgid "MIT Notice"
|
|
msgstr "Tekst licencji MIT"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
|
msgid "MIT Notice (translated)"
|
|
msgstr "Informacja o licencji MIT (tłumaczenie)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL Notice"
|
|
msgstr "Tekst zmodyfikowanej licencji LGPL"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
|
msgid "Modified LGPL Notice (translated)"
|
|
msgstr "Zmodyfikowana licencja LGPL (tłumaczenie)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertusername
|
|
msgid "Current Username"
|
|
msgstr "Nazwę użytkownika"
|
|
|
|
#: lazarusidestrconsts.lismenuinspect
|
|
msgctxt "lazarusidestrconsts.lismenuinspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Badaj..."
|
|
|
|
#: lazarusidestrconsts.lismenujumpback
|
|
msgid "Jump Back"
|
|
msgstr "Przeskocz do ostatniej pozycji"
|
|
|
|
#: lazarusidestrconsts.lismenujumpforward
|
|
msgid "Jump Forward"
|
|
msgstr "Przeskocz do początkowej pozycji"
|
|
|
|
#: lazarusidestrconsts.lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Przeskocz do"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementation
|
|
msgid "Jump to Implementation"
|
|
msgstr "Skocz do implementation"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
|
msgid "Jump to Implementation uses"
|
|
msgstr "Skocz do imlementation uses"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoinitialization
|
|
msgid "Jump to Initialization"
|
|
msgstr "Skocz do initialization"
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerface
|
|
msgid "Jump to Interface"
|
|
msgstr "Skocz do interface"
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
|
msgid "Jump to Interface uses"
|
|
msgstr "Skocz do interface uses"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonextbookmark
|
|
msgid "Jump to Next Bookmark"
|
|
msgstr "Przejdź do następnej zakładki"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonexterror
|
|
msgid "Jump to Next Error"
|
|
msgstr "Przeskocz do następnego błędu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
|
msgid "Jump to Previous Bookmark"
|
|
msgstr "Przejdź do poprzedniej zakładki"
|
|
|
|
#: lazarusidestrconsts.lismenujumptopreverror
|
|
msgid "Jump to Previous Error"
|
|
msgstr "Przeskocz do poprzedniego błędu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
|
msgid "Jump to Procedure begin"
|
|
msgstr "Skocz do początku procedury"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
|
msgid "Jump to Procedure header"
|
|
msgstr "Skocz do nagłówka procedury"
|
|
|
|
#: lazarusidestrconsts.lismenulowercaseselection
|
|
msgid "Lowercase Selection"
|
|
msgstr "Zamień na małe litery"
|
|
|
|
#: lazarusidestrconsts.lismenumacrolistview
|
|
#, fuzzy
|
|
#| msgid "Editor Macros ..."
|
|
msgctxt "lazarusidestrconsts.lismenumacrolistview"
|
|
msgid "Editor Macros"
|
|
msgstr "Edytor makr ..."
|
|
|
|
#: lazarusidestrconsts.lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Zaznacz i utwórz łańcuch w zasobach..."
|
|
|
|
#: lazarusidestrconsts.lismenumultipaste
|
|
msgid "MultiPaste ..."
|
|
msgstr "Wklej do wielu wierszy ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewcomponent
|
|
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Nowy komponent"
|
|
|
|
#: lazarusidestrconsts.lismenunewcustom
|
|
#, object-pascal-format
|
|
msgid "New %s"
|
|
msgstr "Nowy %s"
|
|
|
|
#: lazarusidestrconsts.lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Nowy formularz"
|
|
|
|
#: lazarusidestrconsts.lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Nowy..."
|
|
|
|
#: lazarusidestrconsts.lismenunewpackage
|
|
msgctxt "lazarusidestrconsts.lismenunewpackage"
|
|
msgid "New Package ..."
|
|
msgstr "Nowy pakiet ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Nowy projekt..."
|
|
|
|
#: lazarusidestrconsts.lismenunewprojectfromfile
|
|
msgid "New Project from File ..."
|
|
msgstr "Nowy projekt z pliku..."
|
|
|
|
#: lazarusidestrconsts.lismenunewunit
|
|
msgctxt "lazarusidestrconsts.lismenunewunit"
|
|
msgid "New Unit"
|
|
msgstr "Nowy moduł"
|
|
|
|
#: lazarusidestrconsts.lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Pomoc online"
|
|
|
|
#: lazarusidestrconsts.lismenuopen
|
|
msgid "&Open ..."
|
|
msgstr "Otwórz..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
|
msgid "Open Filename at Cursor"
|
|
msgstr "Otwórz plik jeśli kursor jest przed jego nazwą"
|
|
|
|
#: lazarusidestrconsts.lismenuopenfolder
|
|
msgid "Open Folder ..."
|
|
msgstr "Otwórz katalog ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackage
|
|
msgctxt "lazarusidestrconsts.lismenuopenpackage"
|
|
msgid "Open Loaded Package ..."
|
|
msgstr "Otwórz załadowany pakiet ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
|
msgctxt "lazarusidestrconsts.lismenuopenpackagefile"
|
|
msgid "Open Package File (.lpk) ..."
|
|
msgstr "Otwórz plik pakietu (.lpk) ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
|
msgctxt "lazarusidestrconsts.lismenuopenpackageofcurunit"
|
|
msgid "Open Package of Current Unit"
|
|
msgstr "Otwórz pakiet aktualnego modułu"
|
|
|
|
#: lazarusidestrconsts.lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Otwórz projekt..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecent
|
|
msgid "Open &Recent"
|
|
msgstr "Otwórz poprzedni"
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentpkg
|
|
msgctxt "lazarusidestrconsts.lismenuopenrecentpkg"
|
|
msgid "Open Recent Package"
|
|
msgstr "Otwórz ostatnio otwarty pakiet"
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentproject
|
|
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
|
msgid "Open Recent Project"
|
|
msgstr "Otwórz ostatnio otwarty projekt"
|
|
|
|
#: lazarusidestrconsts.lismenuopenunit
|
|
msgid "Open Unit ..."
|
|
msgstr "Otwórz moduł ..."
|
|
|
|
#: lazarusidestrconsts.lismenupackage
|
|
msgid "Pa&ckage"
|
|
msgstr "P&akiet"
|
|
|
|
#: lazarusidestrconsts.lismenupackagegraph
|
|
msgctxt "lazarusidestrconsts.lismenupackagegraph"
|
|
msgid "Package Graph"
|
|
msgstr "Drzewo zależności pakietów"
|
|
|
|
#: lazarusidestrconsts.lismenupackagelinks
|
|
msgctxt "lazarusidestrconsts.lismenupackagelinks"
|
|
msgid "Package Links ..."
|
|
msgstr "Powiązania pakietów..."
|
|
|
|
#: lazarusidestrconsts.lismenupastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
|
msgid "Paste from clipboard"
|
|
msgstr "Wklej ze schowka"
|
|
|
|
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
|
msgid "New package component"
|
|
msgstr "Nowy składnik pakietu"
|
|
|
|
#: lazarusidestrconsts.lismenuprocedurelist
|
|
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
|
msgid "Procedure List ..."
|
|
msgstr "Lista procedur..."
|
|
|
|
#: lazarusidestrconsts.lismenuproject
|
|
msgid "&Project"
|
|
msgstr "P&rojekt"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Inspektor projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Opcje projektu..."
|
|
|
|
#: lazarusidestrconsts.lismenuprojectrun
|
|
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
|
msgid "&Run"
|
|
msgstr "Uruchom"
|
|
|
|
#: lazarusidestrconsts.lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Publikuj projekt..."
|
|
|
|
#: lazarusidestrconsts.lismenuquickcompile
|
|
msgid "Quick Compile"
|
|
msgstr "Przyspiesz kompilację"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
|
msgid "Quick Syntax Check"
|
|
msgstr "Szybko sprawdź składnię"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
|
msgid "Quick syntax check OK"
|
|
msgstr "Szybkie sprawdzanie składni przebiegło pomyślnie"
|
|
|
|
#: lazarusidestrconsts.lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Usuń z projektu..."
|
|
|
|
#: lazarusidestrconsts.lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Zaznacz i zmień nazwę identyfikatora..."
|
|
|
|
#: lazarusidestrconsts.lismenureportingbug
|
|
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
|
msgid "Reporting a Bug"
|
|
msgstr "Zgłoś błąd"
|
|
|
|
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
|
msgid "Resave forms with enabled i18n"
|
|
msgstr "Ponownie zapisz formularze z włączonym i18n"
|
|
|
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
|
msgid "Rescan FPC Source Directory"
|
|
msgstr "Przeskanuj katalog plików kompilatora FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuresetdebugger
|
|
msgid "Reset Debugger"
|
|
msgstr "Zresetuj odpluskwiacz"
|
|
|
|
#: lazarusidestrconsts.lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Przywróć"
|
|
|
|
#: lazarusidestrconsts.lismenurun
|
|
msgctxt "lazarusidestrconsts.lismenurun"
|
|
msgid "&Run"
|
|
msgstr "&Uruchom"
|
|
|
|
#: lazarusidestrconsts.lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Uruchom plik"
|
|
|
|
#: lazarusidestrconsts.lismenurunparameters
|
|
msgid "Run &Parameters ..."
|
|
msgstr "Uruchom z ¶metrami ..."
|
|
|
|
#: lazarusidestrconsts.lismenuruntocursor
|
|
#, fuzzy
|
|
#| msgid "Step over to &Cursor"
|
|
msgctxt "lazarusidestrconsts.lismenuruntocursor"
|
|
msgid "Run to Cursor"
|
|
msgstr "Dojdź do kursora"
|
|
|
|
#: lazarusidestrconsts.lismenurunwithdebugging
|
|
msgid "Run with Debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurunwithoutdebugging
|
|
msgid "Run without Debugging"
|
|
msgstr "U&ruchom bez odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lismenusave
|
|
msgctxt "lazarusidestrconsts.lismenusave"
|
|
msgid "&Save"
|
|
msgstr "Zapisz"
|
|
|
|
#: lazarusidestrconsts.lismenusaveas
|
|
msgid "Save &As ..."
|
|
msgstr "Zapisz jako..."
|
|
|
|
#: lazarusidestrconsts.lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Zapisz projekt"
|
|
|
|
#: lazarusidestrconsts.lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Zapisz projekt jako..."
|
|
|
|
#: lazarusidestrconsts.lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Szukaj"
|
|
|
|
#: lazarusidestrconsts.lismenuselect
|
|
msgid "Select"
|
|
msgstr "Zaznacz"
|
|
|
|
#: lazarusidestrconsts.lismenuselectall
|
|
msgctxt "lazarusidestrconsts.lismenuselectall"
|
|
msgid "Select All"
|
|
msgstr "Zaznacz wszystko"
|
|
|
|
#: lazarusidestrconsts.lismenuselectcodeblock
|
|
msgid "Select Code Block"
|
|
msgstr "Zaznacz blok"
|
|
|
|
#: lazarusidestrconsts.lismenuselectline
|
|
msgid "Select Line"
|
|
msgstr "Zaznacz wiersz"
|
|
|
|
#: lazarusidestrconsts.lismenuselectparagraph
|
|
msgid "Select Paragraph"
|
|
msgstr "Zaznacz akapit"
|
|
|
|
#: lazarusidestrconsts.lismenuselecttobrace
|
|
msgid "Select to Brace"
|
|
msgstr "Zaznacz do nawiasu"
|
|
|
|
#: lazarusidestrconsts.lismenuselectword
|
|
msgid "Select Word"
|
|
msgstr "Zaznacz słowo"
|
|
|
|
#: lazarusidestrconsts.lismenusetfreebookmark
|
|
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Załóż zakładkę"
|
|
|
|
#: lazarusidestrconsts.lismenushowexecutionpoint
|
|
msgid "S&how Execution Point"
|
|
msgstr "Pokaż punkt wykonywania"
|
|
|
|
#: lazarusidestrconsts.lismenushowsmarthint
|
|
msgid "Context sensitive smart hint"
|
|
msgstr "Sprytna podpowiedź z uwzględnieniem kontekstu"
|
|
|
|
#: lazarusidestrconsts.lismenusortselection
|
|
msgid "Sort Selection ..."
|
|
msgstr "Sortuj zaznaczone ..."
|
|
|
|
#: lazarusidestrconsts.lismenusource
|
|
msgid "S&ource"
|
|
msgstr "Źródło"
|
|
|
|
#: lazarusidestrconsts.lismenuswapcaseselection
|
|
msgid "Swap Case in Selection"
|
|
msgstr "Zamień wielkość liter"
|
|
|
|
#: lazarusidestrconsts.lismenutabstospacesselection
|
|
msgid "Tabs to Spaces in Selection"
|
|
msgstr "Zamień znaki tabulacji na spacje w zaznaczonym tekście"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateabout
|
|
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
|
msgid "About"
|
|
msgstr "Informacja"
|
|
|
|
#: lazarusidestrconsts.lismenutogglecomment
|
|
msgctxt "lazarusidestrconsts.lismenutogglecomment"
|
|
msgid "Toggle Comment in Selection"
|
|
msgstr "Wstaw znak komentarza //"
|
|
|
|
#: lazarusidestrconsts.lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Narzędzia"
|
|
|
|
#: lazarusidestrconsts.lismenuuncommentselection
|
|
msgid "Uncomment Selection"
|
|
msgstr "Zaznacz i cofnij komentarz"
|
|
|
|
#: lazarusidestrconsts.lismenuunindentselection
|
|
msgid "Unindent Selection"
|
|
msgstr "Zmniejsz wcięcie"
|
|
|
|
#: lazarusidestrconsts.lismenuuppercaseselection
|
|
msgid "Uppercase Selection"
|
|
msgstr "Zaznaczenie wielkimi literami"
|
|
|
|
#: lazarusidestrconsts.lismenuuseunit
|
|
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
|
msgid "Add Unit to Uses Section ..."
|
|
msgstr "Dodaj moduł do sekcji Uses ..."
|
|
|
|
#: lazarusidestrconsts.lismenuview
|
|
msgid "&View"
|
|
msgstr "&Widok"
|
|
|
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
|
msgid "Anchor Editor"
|
|
msgstr "Edytor zakotwiczeń"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Inspektor kodu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Przeglądarka źródeł"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
|
msgid "Component Palette"
|
|
msgstr "Paleta komponentów"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Komponenty"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugevents
|
|
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
|
msgid "Event Log"
|
|
msgstr "Dziennik zdarzeń"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugoutput
|
|
msgid "Debug Output"
|
|
msgstr "Wyjście odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.lismenuviewforms
|
|
msgid "Forms ..."
|
|
msgstr "Formularze ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewhistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
|
msgid "History"
|
|
msgstr "Historia"
|
|
|
|
#: lazarusidestrconsts.lismenuviewjumphistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Historia skoków"
|
|
|
|
#: lazarusidestrconsts.lismenuviewlocalvariables
|
|
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
|
|
msgid "Local Variables"
|
|
msgstr "Zmienne lokalne"
|
|
|
|
#: lazarusidestrconsts.lismenuviewmessages
|
|
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
|
msgid "Messages"
|
|
msgstr "Komunikaty"
|
|
|
|
#: lazarusidestrconsts.lismenuviewobjectinspector
|
|
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
|
msgid "Object Inspector"
|
|
msgstr "Inspektor obiektów"
|
|
|
|
#: lazarusidestrconsts.lismenuviewprojectsource
|
|
msgid "&View Project Source"
|
|
msgstr "Pokaż źródło projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
|
|
msgid "Console In/Output"
|
|
msgstr "Konsola wejścia/wyjścia"
|
|
|
|
#: lazarusidestrconsts.lismenuviewregisters
|
|
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
|
msgid "Registers"
|
|
msgstr "Rejestry"
|
|
|
|
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr "Przeglądarka ograniczeń"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Wyniki wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsourceeditor
|
|
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Edytor źródeł"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtaborder
|
|
msgid "Tab Order"
|
|
msgstr "Kolejność kontrolek"
|
|
|
|
#: lazarusidestrconsts.lismenuviewthreads
|
|
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
|
msgid "Threads"
|
|
msgstr "Wątki"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
|
msgid "Toggle Form/Unit View"
|
|
msgstr "Przełącz pomiędzy modułem a formularzem"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
|
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Zależności między modułami"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
|
msgid "Unit Information ..."
|
|
msgstr "Pokaż informacje o module ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewunits
|
|
msgid "Units ..."
|
|
msgstr "Moduły ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewwatches
|
|
msgctxt "lazarusidestrconsts.lismenuviewwatches"
|
|
msgid "Watches"
|
|
msgstr "Zmienne"
|
|
|
|
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
|
msgid "What Needs Building"
|
|
msgstr "Wymagające budowania"
|
|
|
|
#: lazarusidestrconsts.lismenuwindow
|
|
msgid "&Window"
|
|
msgstr "&Okno"
|
|
|
|
#: lazarusidestrconsts.lismeother
|
|
msgctxt "lazarusidestrconsts.lismeother"
|
|
msgid "Other tabs"
|
|
msgstr "Inne zakładki"
|
|
|
|
#: lazarusidestrconsts.lismessageseditor
|
|
msgid "Messages Editor"
|
|
msgstr "Edytor komunikatów"
|
|
|
|
#: lazarusidestrconsts.lismessageswindow
|
|
msgid "Messages Window"
|
|
msgstr "Okno komunikatów"
|
|
|
|
#: lazarusidestrconsts.lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr "Nie znaleziono metody klasy"
|
|
|
|
#: lazarusidestrconsts.lismissingdirectory
|
|
#, object-pascal-format
|
|
msgid "missing directory \"%s\""
|
|
msgstr "brak katalogu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr "Brakujące zdarzenia"
|
|
|
|
#: lazarusidestrconsts.lismissingexecutable
|
|
#, object-pascal-format
|
|
msgid "missing executable \"%s\""
|
|
msgstr "brak pliku wykonywalnego \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr "Brakujące identyfikatory"
|
|
|
|
#: lazarusidestrconsts.lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Brakujące pakiety"
|
|
|
|
#: lazarusidestrconsts.lismissingunitschoices
|
|
msgid "Your choices are:"
|
|
msgstr "Możliwości wyboru:"
|
|
|
|
#: lazarusidestrconsts.lismissingunitscomment
|
|
#, fuzzy
|
|
msgid "Comment Out"
|
|
msgstr "Komentarz { }"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsfordelphi
|
|
msgid "For Delphi only"
|
|
msgstr "Tylko dla Delphi"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1
|
|
msgid "1) Comment out the selected units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1b
|
|
msgid "1) Use the units only for Delphi."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo2
|
|
msgid "2) Search for units. Found paths are added to project settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo3
|
|
msgid "3) Leave these units in uses sections as they are."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitssearch
|
|
msgid "Search Unit Path"
|
|
msgstr "Ścieżka poszukiwania modułów"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsskip
|
|
#, fuzzy
|
|
#| msgid "Skip this Unit"
|
|
msgctxt "lazarusidestrconsts.lismissingunitsskip"
|
|
msgid "Skip"
|
|
msgstr "Pomiń ten moduł"
|
|
|
|
#: lazarusidestrconsts.lismitnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (c) <year> <copyright holders>\n"
|
|
"\n"
|
|
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
|
"\n"
|
|
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
|
"\n"
|
|
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmadditionsandoverrides
|
|
msgid "Additions and Overrides"
|
|
msgstr "Dodatki i wymuszenia"
|
|
|
|
#: lazarusidestrconsts.lismmaddscustomoptions
|
|
msgid "Adds custom options:"
|
|
msgstr "Dodaje opcje niestandardowe:"
|
|
|
|
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
|
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackages
|
|
msgid "Apply to all packages."
|
|
msgstr "Zastosuj do wszystkich pakietów."
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
|
msgid "Apply to all packages and projects."
|
|
msgstr "Zastosuj do wszystkich pakietów i projektów."
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
|
#, object-pascal-format
|
|
msgid "Apply to all packages matching name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoproject
|
|
msgid "Apply to project."
|
|
msgstr "Zastosuj do projektu."
|
|
|
|
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
|
msgid "Create a new group of options"
|
|
msgstr "Utwórz nową grupę opcji"
|
|
|
|
#: lazarusidestrconsts.lismmcustomoption
|
|
msgid "Custom Option"
|
|
msgstr "Opcje użytkownika"
|
|
|
|
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
|
#, fuzzy
|
|
msgid "Delete the selected target or option"
|
|
msgstr "Usunąć wszystkie wybrane pułapki?"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
|
msgid "Does not add custom options:"
|
|
msgstr "Nie dodaje opcji niestandardowych:"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Does not have IDE Macro %s:=%s"
|
|
msgstr "Makro IDE %s:=%s"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
|
#, fuzzy
|
|
msgid "Does not override OutDir (-FU)"
|
|
msgstr "Nadpisz katalog wyjściowy (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
|
#, object-pascal-format
|
|
msgid "Exclude all packages matching name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "expected \":=\" after macro name but found \"%s\""
|
|
msgstr "zamiast \";\" po specyfikacji właściwości \"%s\" znalaziono %s"
|
|
|
|
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
|
#, object-pascal-format, fuzzy
|
|
msgid "expected macro name but found \"%s\""
|
|
msgstr "zamiast końca programu \"end.\" znaleziono %s"
|
|
|
|
#: lazarusidestrconsts.lismmfromto
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "From %s to %s"
|
|
msgstr "Istnieje moduł o nazwie takiej samej jak pakiet:%s1. \"%s\" w %s%s2. \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmidemacro
|
|
msgid "IDE Macro"
|
|
msgstr "Makro IDE"
|
|
|
|
#: lazarusidestrconsts.lismmidemacro2
|
|
#, object-pascal-format
|
|
msgid "IDE Macro %s:=%s"
|
|
msgstr "Makro IDE %s:=%s"
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterat
|
|
#, object-pascal-format
|
|
msgid "invalid character \"%s\" at %s"
|
|
msgstr "niedozwolony znak \"%s\" w %s"
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "invalid character in macro value \"%s\""
|
|
msgstr "niedozwolony znak \"%s\" w %s"
|
|
|
|
#: lazarusidestrconsts.lismmmissingmacroname
|
|
msgid "missing macro name"
|
|
msgstr "brak nazwy makro"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr "Przesuń zaznaczony element w dół"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr "Przesuń zaznaczony element w górę"
|
|
|
|
#: lazarusidestrconsts.lismmnewtarget
|
|
msgid "New Target"
|
|
msgstr "Nowa platforma docelowa"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Override OutDir (-FU): %s"
|
|
msgstr "Nadpisz katalog wyjściowy (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
|
msgid "Override output directory (-FU)"
|
|
msgstr "Nadpisz katalog wyjściowy (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
|
#, fuzzy
|
|
msgid "Override output directory -FU of target"
|
|
msgstr "Nadpisz katalog wyjściowy (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
|
#, fuzzy
|
|
msgid "Redo last undo to this grid"
|
|
msgstr "Cofnij / Przywróć"
|
|
|
|
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
|
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsets
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Set \"%s\""
|
|
msgstr "Ustaw domyślną wartość: %s"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
|
msgid "Stored in IDE (environmentoptions.xml)"
|
|
msgstr "Zapisane w IDE (environmentoptions.xml)"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
|
msgid "Stored in project (.lpi)"
|
|
msgstr "Zapisane w projekcie (.lpi)"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
|
#, fuzzy
|
|
msgid "Stored in session of project (.lps)"
|
|
msgstr "Tryb domyślny musi być zachowany w projekcie, nie w sesji"
|
|
|
|
#: lazarusidestrconsts.lismmtargets
|
|
msgid "Targets: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
|
#, fuzzy
|
|
msgid "Undo last change to this grid"
|
|
msgstr "Cofnij ostatnią akcję"
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencoding
|
|
msgid "Use system encoding"
|
|
msgstr "Użyj kodowania systemowego"
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencodinghint
|
|
msgid "Disable support for UTF-8 default string encoding."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmvalues
|
|
#, object-pascal-format
|
|
msgid "Value \"%s\""
|
|
msgstr "Wartość \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmwas
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "(was \"%s\")"
|
|
msgstr "Błąd zapisu: %s%sPlik: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
|
|
msgid "WidgetSet change is available only for LCL projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismode
|
|
#, object-pascal-format, fuzzy
|
|
msgid ", Mode: %s"
|
|
msgstr "Tryb budowania: %s"
|
|
|
|
#: lazarusidestrconsts.lismodifiedlgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
"\n"
|
|
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismore
|
|
msgctxt "lazarusidestrconsts.lismore"
|
|
msgid "More"
|
|
msgstr "Więcej"
|
|
|
|
#: lazarusidestrconsts.lismoresub
|
|
msgctxt "lazarusidestrconsts.lismoresub"
|
|
msgid "More"
|
|
msgstr "Więcej"
|
|
|
|
#: lazarusidestrconsts.lismove
|
|
msgid "Move"
|
|
msgstr "Przenieś"
|
|
|
|
#: lazarusidestrconsts.lismovedown
|
|
msgid "Move Down"
|
|
msgstr "Idź w dół"
|
|
|
|
#: lazarusidestrconsts.lismovefiles
|
|
msgid "Move Files"
|
|
msgstr "Przenieś pliki"
|
|
|
|
#: lazarusidestrconsts.lismovefiles2
|
|
msgid "Move files?"
|
|
msgstr "Przenieść pliki?"
|
|
|
|
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
|
#, object-pascal-format
|
|
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveonepositiondown
|
|
#, object-pascal-format
|
|
msgid "Move \"%s\" one position down"
|
|
msgstr "Przesuń \"%s\" w dół"
|
|
|
|
#: lazarusidestrconsts.lismoveonepositionup
|
|
#, object-pascal-format
|
|
msgid "Move \"%s\" one position up"
|
|
msgstr "Przesuń \"%s\" w górę"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfiles
|
|
msgid "Move or Copy files?"
|
|
msgstr "Przenieść czy kopiować pliki?"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
|
#, object-pascal-format
|
|
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovepage
|
|
msgid "Move Page"
|
|
msgstr "Przenieś stronę"
|
|
|
|
#: lazarusidestrconsts.lismoveselecteddown
|
|
msgid "Move selected item down (Ctrl+Down)"
|
|
msgstr "Przesuń zaznaczony element w dół (Ctrl+Down)"
|
|
|
|
#: lazarusidestrconsts.lismoveselectedup
|
|
msgid "Move selected item up (Ctrl+Up)"
|
|
msgstr "Przesuń zaznaczony element w górę (Ctrl+Up)"
|
|
|
|
#: lazarusidestrconsts.lismoveto
|
|
msgid "Move to: "
|
|
msgstr "Przenieś do: "
|
|
|
|
#: lazarusidestrconsts.lismoveup
|
|
msgid "Move Up"
|
|
msgstr "Idź w górę"
|
|
|
|
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
|
msgid "Moving these units will break their uses sections. See Messages window for details."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpcstyle
|
|
msgid "C style: \" => \\\""
|
|
msgstr "Styl C: \" => \\\""
|
|
|
|
#: lazarusidestrconsts.lismpescapequotes
|
|
msgid "Escape "es"
|
|
msgstr "Wymuszenie &cudzysłowu"
|
|
|
|
#: lazarusidestrconsts.lismpmultipaste
|
|
msgctxt "lazarusidestrconsts.lismpmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr "Wklej do wielu wierszy"
|
|
|
|
#: lazarusidestrconsts.lismppascalstyle
|
|
msgid "Pascal style: ' => ''"
|
|
msgstr "Styla Pascal: ' => ''"
|
|
|
|
#: lazarusidestrconsts.lismppasteoptions
|
|
msgid "Paste &options"
|
|
msgstr "&Opcje wklejania"
|
|
|
|
#: lazarusidestrconsts.lismppreview
|
|
msgid "&Preview"
|
|
msgstr "&Podgląd"
|
|
|
|
#: lazarusidestrconsts.lismptextaftereachline
|
|
msgid "Text &after each line"
|
|
msgstr "Tekst po k&ażdym wierszu"
|
|
|
|
#: lazarusidestrconsts.lismptextbeforeeachline
|
|
msgid "Text &before each line"
|
|
msgstr "Tekst p&rzed każdym wierszem"
|
|
|
|
#: lazarusidestrconsts.lismptrimclipboardcontents
|
|
msgid "&Trim clipboard contents"
|
|
msgstr "Przy&tnij zawartość schowka"
|
|
|
|
#: lazarusidestrconsts.lismsgcolors
|
|
msgid "Message colors"
|
|
msgstr "Kolory komunikatów"
|
|
|
|
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
|
msgid "Multiple directories are separated with semicolons"
|
|
msgstr "Wiele katalogów oddzielonych średnikami"
|
|
|
|
#: lazarusidestrconsts.lismultiplepack
|
|
msgid ", multiple packages: "
|
|
msgstr ", wiele pakietów: "
|
|
|
|
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Zapisz komunikaty do pliku (*.txt)"
|
|
|
|
#: lazarusidestrconsts.lisname
|
|
msgctxt "lazarusidestrconsts.lisname"
|
|
msgid "Name"
|
|
msgstr "Nazwa"
|
|
|
|
#: lazarusidestrconsts.lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr "Konflikt nazw"
|
|
|
|
#: lazarusidestrconsts.lisnameofactivebuildmode
|
|
msgid "Name of active build mode"
|
|
msgstr "Nazwa aktywnego trybu budowania"
|
|
|
|
#: lazarusidestrconsts.lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Nazwa nowej procedury"
|
|
|
|
#: lazarusidestrconsts.lisnew
|
|
msgctxt "lazarusidestrconsts.lisnew"
|
|
msgid "New"
|
|
msgstr "Nowy"
|
|
|
|
#: lazarusidestrconsts.lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Nowa klasa"
|
|
|
|
#: lazarusidestrconsts.lisnewconsoleapplication
|
|
msgid "New console application"
|
|
msgstr "Nowa aplikacja konsolowa"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
|
#, object-pascal-format
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Utwórz nowy plik edytora.%sWybierz typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Utwórz nowy pusty plik tekstowy."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
|
#, object-pascal-format
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Utwórz nowy projekt.%sWybierz typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
#, object-pascal-format
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Utwórz standardowy pakiet.%sPakiet jest zbiorem modułów i komponentów."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Utwórz nowy moduł z modułem danych."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
|
msgid "Create a new unit with a frame."
|
|
msgstr "Utwórz nowy moduł z ramką."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Utwórz nowy moduł z formularzem LCL."
|
|
|
|
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
|
msgid "Inherit from a project form or component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Nie wybrano elementu"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Najpierw wybierz element."
|
|
|
|
#: lazarusidestrconsts.lisnewencoding
|
|
msgid "New encoding:"
|
|
msgstr "Nowe kodowanie:"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname
|
|
#, object-pascal-format
|
|
msgid "Macro %d"
|
|
msgstr "Makro %d"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname2
|
|
msgid "New Macroname"
|
|
msgstr "Nowa nazwa makra"
|
|
|
|
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
|
|
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
|
|
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewpage
|
|
msgid "New page"
|
|
msgstr "Nowa strona"
|
|
|
|
#: lazarusidestrconsts.lisnewproject
|
|
msgid "(new project)"
|
|
msgstr "(nowy projekt)"
|
|
|
|
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
|
msgid "New recorded macros. Not to be saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
|
msgid "New units are added to uses sections"
|
|
msgstr "Dodawanie nowych modułów do sekcji uses"
|
|
|
|
#: lazarusidestrconsts.lisnoautosaveactivedesktop
|
|
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Bez kopii zapasowej"
|
|
|
|
#: lazarusidestrconsts.lisnobuildprofilesselected
|
|
msgid "No profiles are selected to be built."
|
|
msgstr "Nie wybrano profilu do budowania."
|
|
|
|
#: lazarusidestrconsts.lisnochange
|
|
msgid "No change"
|
|
msgstr "Bez zmian"
|
|
|
|
#: lazarusidestrconsts.lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr "Nie zaznaczono kodu"
|
|
|
|
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
|
#, fuzzy
|
|
msgid "No compiler options inherited."
|
|
msgstr "Opcje kompilatora"
|
|
|
|
#: lazarusidestrconsts.lisnofppkgprefix
|
|
msgid "empty Free Pascal compiler prefix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnohints
|
|
msgid "no hints"
|
|
msgstr "brak podpowiedzi"
|
|
|
|
#: lazarusidestrconsts.lisnoidewindowselected
|
|
#, fuzzy
|
|
msgid "No IDE window selected"
|
|
msgstr "Okno"
|
|
|
|
#: lazarusidestrconsts.lisnolfmfile
|
|
msgid "No LFM file"
|
|
msgstr "Brak pliku LFM"
|
|
|
|
#: lazarusidestrconsts.lisnomacroselected
|
|
msgid "No macro selected"
|
|
msgstr "Brak wybranego makra"
|
|
|
|
#: lazarusidestrconsts.lisnomessageselected
|
|
msgid "(no message selected)"
|
|
msgstr "(nie zaznaczono komunikatu)"
|
|
|
|
#: lazarusidestrconsts.lisnoname
|
|
msgid "noname"
|
|
msgstr "nienazwany"
|
|
|
|
#: lazarusidestrconsts.lisnoneclicktochooseone
|
|
#, fuzzy
|
|
msgid "none, click to choose one"
|
|
msgstr "Kliknij na jeden z powyższych elementów aby zobaczyć diff"
|
|
|
|
#: lazarusidestrconsts.lisnoneselected
|
|
msgid "(None selected)"
|
|
msgstr "(Nic nie wybrano)"
|
|
|
|
#: lazarusidestrconsts.lisnonodeselected
|
|
msgid "no node selected"
|
|
msgstr "nie wybrano węzła"
|
|
|
|
#: lazarusidestrconsts.lisnopascalfile
|
|
#, fuzzy
|
|
msgid "No Pascal file"
|
|
msgstr "Plik Pascala"
|
|
|
|
#: lazarusidestrconsts.lisnoprogramfilesfound
|
|
#, object-pascal-format
|
|
msgid "No program file \"%s\" found."
|
|
msgstr "Nie znaleziono pliku programu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "Nie znaleziono sekcji ResourceString"
|
|
|
|
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
|
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr "Normalnie filtr jest wyrażeniem regularnym. Przy prostej składni . jest normalnym znakiem, * oznacza dowolny ciąg, ? oznacza dowolny znak, a przecinek i średnik służą do oddzielania alternatyw. Na przykład: prosta składnia *.pas;*.pp odpowiada ^(.*\\.pas|.*\\.pp)$"
|
|
|
|
#: lazarusidestrconsts.lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Nie znaleziono stałej łańcuchowej"
|
|
|
|
#: lazarusidestrconsts.lisnotadesigntimepackage
|
|
msgid "Not a designtime package"
|
|
msgstr "Pakiet nie jest typu projektowego"
|
|
|
|
#: lazarusidestrconsts.lisnotaninstallpackage
|
|
#, fuzzy
|
|
msgid "Not an install package"
|
|
msgstr "Zainstaluj"
|
|
|
|
#: lazarusidestrconsts.lisnotavalidfppkgprefix
|
|
msgid "Free Pascal compiler not found at the given prefix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnote
|
|
msgctxt "lazarusidestrconsts.lisnote"
|
|
msgid "Note"
|
|
msgstr "Uwaga"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposbottom
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
|
msgid "Bottom"
|
|
msgstr "U dołu"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposleft
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
|
msgid "Left"
|
|
msgstr "Po lewej"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposright
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
|
msgid "Right"
|
|
msgstr "Po prawej"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabpostop
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
|
msgid "Top"
|
|
msgstr "Na górze"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "UWAGA: Nie można było utworzyć szablonu define dla źródeł Free Pascala"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "UWAGA: Nie można było utworzyć szablonu define dla źródeł Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lisnotemplateselected
|
|
msgid "no template selected"
|
|
msgstr "nie wybrano szablonu"
|
|
|
|
#: lazarusidestrconsts.lisnothingtodo
|
|
msgid "Nothing to do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplemented
|
|
msgid "Not implemented"
|
|
msgstr "Nie zaimplementowane"
|
|
|
|
#: lazarusidestrconsts.lisnotimplementedyet
|
|
#, object-pascal-format
|
|
msgid "Not implemented yet:%s%s"
|
|
msgstr "Jeszcze nie zaimplementowane: %s%s"
|
|
|
|
#: lazarusidestrconsts.lisnotinstalled
|
|
msgid "not installed"
|
|
msgstr "nie zainstalowany"
|
|
|
|
#: lazarusidestrconsts.lisnotinstalledpackages
|
|
#, fuzzy
|
|
msgid "Not installed packages"
|
|
msgstr "Automatycznie zainstalowane pakiety"
|
|
|
|
#: lazarusidestrconsts.lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Nie teraz"
|
|
|
|
#: lazarusidestrconsts.lisnowloadedscheme
|
|
msgid "Now loaded: "
|
|
msgstr "Teraz wczytane: "
|
|
|
|
#: lazarusidestrconsts.lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr "Utwórz nowy projekt"
|
|
|
|
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
|
#, object-pascal-format
|
|
msgid "Number of files to convert: %s"
|
|
msgstr "Liczba plików do konwersji: %s"
|
|
|
|
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
|
msgid "Object Inspector becomes visible when components are selected in designer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr "Domyślne dla Object Pascala"
|
|
|
|
#: lazarusidestrconsts.lisobjectpath
|
|
#, fuzzy
|
|
msgid "object path"
|
|
msgstr "Ścieżka"
|
|
|
|
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
|
msgid "Switch to Object Inspector Favorites tab"
|
|
msgstr "Przełącz na zakładkę Ulubione w Inspektorze obiektów"
|
|
|
|
#: lazarusidestrconsts.lisofpackage
|
|
#, object-pascal-format, fuzzy
|
|
msgid " of package %s"
|
|
msgstr ", pakiet %s"
|
|
|
|
#: lazarusidestrconsts.lisoftheprojectinspector
|
|
#, fuzzy
|
|
msgid " of the Project Inspector"
|
|
msgstr "Inspektor projektu"
|
|
|
|
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
|
msgid "Add to favorite properties"
|
|
msgstr "Dodaj do ulubionych właściwości"
|
|
|
|
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
|
#, object-pascal-format
|
|
msgid "Choose a base class for the favorite property \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifclassnotfound
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Class \"%s\" not found."
|
|
msgstr "Nie znaleziono klasy \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
|
msgid "Remove from favorite properties"
|
|
msgstr "Usuń z listy ulubionych właściwości"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "auto zainstalowany dynamicznie"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "auto zainstalowany statycznie"
|
|
|
|
#: lazarusidestrconsts.lisoipdescription
|
|
msgctxt "lazarusidestrconsts.lisoipdescription"
|
|
msgid "Description: "
|
|
msgstr "Opis: "
|
|
|
|
#: lazarusidestrconsts.lisoipdescriptiondescription
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisoipdescriptiondescription"
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sOpis: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipfilename
|
|
#, object-pascal-format
|
|
msgid "Filename: %s"
|
|
msgstr "Nazwa pliku: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "zainstalowany dynamicznie"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "zainstalowany statycznie"
|
|
|
|
#: lazarusidestrconsts.lisoiplicenselicense
|
|
#, object-pascal-format
|
|
msgid "%sLicense: %s"
|
|
msgstr "%sLicencja: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipmissing
|
|
msgid "missing"
|
|
msgstr "brakujący"
|
|
|
|
#: lazarusidestrconsts.lisoipmodified
|
|
msgid "modified"
|
|
msgstr "zmodyfikowany"
|
|
|
|
#: lazarusidestrconsts.lisoipopenloadedpackage
|
|
msgid "Open Loaded Package"
|
|
msgstr "Otwórz załadowany pakiet"
|
|
|
|
#: lazarusidestrconsts.lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Nazwa pakietu"
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "[wybierz pakiet]"
|
|
|
|
#: lazarusidestrconsts.lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.lisoipstate
|
|
msgctxt "lazarusidestrconsts.lisoipstate"
|
|
msgid "State"
|
|
msgstr "Stan"
|
|
|
|
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
#, object-pascal-format
|
|
msgid "%sThis package is installed but the lpk file was not found"
|
|
msgstr "%sTen pakiet jest zainstalowany, ale nie znaleziono jego pliku lpk"
|
|
|
|
#: lazarusidestrconsts.lisoldclass
|
|
msgid "Old Class"
|
|
msgstr "Stara klasa"
|
|
|
|
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
|
msgid "On break line (i.e. return or enter key)"
|
|
msgstr "Przy zmianie wiersza (po naciśnięciu klawisza Return lub Enter)"
|
|
|
|
#: lazarusidestrconsts.lisonlinepackage
|
|
#, fuzzy
|
|
msgid "available in the main repository"
|
|
msgstr "Dostępne do zainstalowania"
|
|
|
|
#: lazarusidestrconsts.lisonly32bit
|
|
msgid "only 32bit"
|
|
msgstr "tylko 32 bity"
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
|
|
msgid "Only available on Windows. Run the tool hidden."
|
|
msgstr "Dostępne tylko w Windows. Uruchom narzędzie jako ukryte."
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
|
|
msgid "Only available on Windows. Run tool in a new console."
|
|
msgstr "Dostępne tylko w Windows. Uruchom narzędzie w nowej konsoli."
|
|
|
|
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
|
msgid "Only messages fitting this regular expression:"
|
|
msgstr "Tylko komunikaty pasujące do tego wyrażenia regularnego:"
|
|
|
|
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
|
msgid "Only messages with these FPC IDs (comma separated):"
|
|
msgstr "Tylko komunikaty z tymi FPC ID (oddzielone przecinkami):"
|
|
|
|
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
|
|
msgid "Only register the Lazarus package files (.lpk). Do not build."
|
|
msgstr "Zarejestruj tylko pliki pakietów Lazarusa (.lpk). Nie buduj."
|
|
|
|
#: lazarusidestrconsts.lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr "Szukaj tylko całych wyrazów"
|
|
|
|
#: lazarusidestrconsts.lisonpastefromclipboard
|
|
msgid "On paste from clipboard"
|
|
msgstr "Przy wklejaniu ze schowka"
|
|
|
|
#: lazarusidestrconsts.lisopen
|
|
msgctxt "lazarusidestrconsts.lisopen"
|
|
msgid "Open"
|
|
msgstr "Otwórz"
|
|
|
|
#: lazarusidestrconsts.lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr "Otwórz jako plik XML"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunit
|
|
msgid "Open designer on open unit"
|
|
msgstr "Przy otwieraniu modułu otwórz też formularz"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
|
msgid "Form is loaded in designer always when source unit is opened."
|
|
msgstr "Przy otwieraniu pliku źródłowego zawsze jest otwierany do edycji także formularz."
|
|
|
|
#: lazarusidestrconsts.lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr "Otwórz istniejący plik"
|
|
|
|
#: lazarusidestrconsts.lisopenfile
|
|
msgctxt "lazarusidestrconsts.lisopenfile"
|
|
msgid "Open File"
|
|
msgstr "Otwórz plik"
|
|
|
|
#: lazarusidestrconsts.lisopenfile2
|
|
msgctxt "lazarusidestrconsts.lisopenfile2"
|
|
msgid "Open file"
|
|
msgstr "Otwórz plik"
|
|
|
|
#: lazarusidestrconsts.lisopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr "Otwórz plik przy kursorze"
|
|
|
|
#: lazarusidestrconsts.lisopeninfileman
|
|
msgid "Open in file manager"
|
|
msgstr "Otwórz w menadżerze plików"
|
|
|
|
#: lazarusidestrconsts.lisopeninfilemanhint
|
|
msgid "Open destination directory in file manager"
|
|
msgstr "Otwórz katalog docelowy w menadżerze plików"
|
|
|
|
#: lazarusidestrconsts.lisopenlfm
|
|
#, object-pascal-format
|
|
msgid "Open %s"
|
|
msgstr "Otwórz %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Chcesz otworzyć pakiet?"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage2
|
|
#, object-pascal-format
|
|
msgid "Open package %s"
|
|
msgstr "Otwórz pakiet %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage3
|
|
msgid "Open Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr "Otwórz plik pakietu"
|
|
|
|
#: lazarusidestrconsts.lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Chcesz otworzyć projekt?"
|
|
|
|
#: lazarusidestrconsts.lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Otwórz projekt"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr "Otwórz ponownie projekt"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Otwórz plik projektu"
|
|
|
|
#: lazarusidestrconsts.lisopensymlink
|
|
msgid "Open symlink"
|
|
msgstr "Otwórz dowiązanie symboliczne"
|
|
|
|
#: lazarusidestrconsts.lisopentarget
|
|
msgid "Open target"
|
|
msgstr "Otwórz cel"
|
|
|
|
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr "Otwórz plik jako normalny plik źródłowy"
|
|
|
|
#: lazarusidestrconsts.lisopenthepackage
|
|
#, object-pascal-format
|
|
msgid "Open the package %s?"
|
|
msgstr "Otworzyć pakiet %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentheproject
|
|
#, object-pascal-format
|
|
msgid "Open the project %s?"
|
|
msgstr "Otworzyć projekt %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentooloptions
|
|
#, fuzzy
|
|
msgid "Open Tool Options"
|
|
msgstr "Narzędzie zaznaczania"
|
|
|
|
#: lazarusidestrconsts.lisopenunit
|
|
msgid "Open Unit"
|
|
msgstr "Otwórz moduł"
|
|
|
|
#: lazarusidestrconsts.lisopenurl
|
|
msgid "Open URL"
|
|
msgstr "Otwórz URL"
|
|
|
|
#: lazarusidestrconsts.lisopenxml
|
|
msgid "Open XML"
|
|
msgstr "Otwórz XML"
|
|
|
|
#: lazarusidestrconsts.lisoptions
|
|
msgctxt "lazarusidestrconsts.lisoptions"
|
|
msgid "Options"
|
|
msgstr "Opcje"
|
|
|
|
#: lazarusidestrconsts.lisoptionvalueignored
|
|
msgid "ignored"
|
|
msgstr "ignorowany"
|
|
|
|
#: lazarusidestrconsts.lisor
|
|
msgid "or"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisos
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid ", OS: %s"
|
|
msgstr "Docelowy system operacyjny"
|
|
|
|
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
|
#, object-pascal-format
|
|
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
|
|
#, object-pascal-format
|
|
msgid "output directory of %s contains Pascal unit source \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoutputfilenameofproject
|
|
msgid "Output filename of project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridelanguage
|
|
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
|
|
msgid "Override function result string types with the first parameter expression type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
|
#, object-pascal-format
|
|
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
|
#, object-pascal-format
|
|
msgid "%soverride the project or IDE build mode."
|
|
msgstr "%szmień tryb budowania projektu lub IDE."
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
|
#, object-pascal-format
|
|
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
|
#, object-pascal-format
|
|
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
|
#, object-pascal-format
|
|
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverwritefile
|
|
msgid "Overwrite file?"
|
|
msgstr "Zastąpić plik?"
|
|
|
|
#: lazarusidestrconsts.lisoverwritefileondisk
|
|
msgid "Overwrite file on disk"
|
|
msgstr "Zastąpić plik na dysku"
|
|
|
|
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
|
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackage
|
|
msgctxt "lazarusidestrconsts.lispackage"
|
|
msgid "Package"
|
|
msgstr "Pakiet"
|
|
|
|
#: lazarusidestrconsts.lispackage2
|
|
#, object-pascal-format
|
|
msgid "package %s"
|
|
msgstr "pakiet %s"
|
|
|
|
#: lazarusidestrconsts.lispackage3
|
|
#, object-pascal-format
|
|
msgid ", package %s"
|
|
msgstr ", pakiet %s"
|
|
|
|
#: lazarusidestrconsts.lispackageinfo
|
|
msgid "Package info"
|
|
msgstr "Informacje o pakiecie"
|
|
|
|
#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Nazwa pakietu zaczyna się na..."
|
|
|
|
#: lazarusidestrconsts.lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Nazwa pakietu zawiera..."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
|
msgid "Package needs an output directory."
|
|
msgstr "Pakiet wymaga katalogu wyjściowego."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Pakiet wymaga zainstalowania"
|
|
|
|
#: lazarusidestrconsts.lispackageoption
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" Option"
|
|
msgstr "Opcje pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lispackageoutputdirectories
|
|
msgid "Package output directories"
|
|
msgstr "Katalogi wyjściowe pakietów"
|
|
|
|
#: lazarusidestrconsts.lispackagesourcedirectories
|
|
msgid "Package source directories"
|
|
msgstr "Katalogi źródeł pakietów"
|
|
|
|
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
|
#, object-pascal-format
|
|
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageunit
|
|
msgid "package unit"
|
|
msgstr "moduł pakietu"
|
|
|
|
#: lazarusidestrconsts.lispage
|
|
msgctxt "lazarusidestrconsts.lispage"
|
|
msgid "Page"
|
|
msgstr "Strona"
|
|
|
|
#: lazarusidestrconsts.lispagename
|
|
msgid "Page name"
|
|
msgstr "Nazwa zakładki"
|
|
|
|
#: lazarusidestrconsts.lispagenamealreadyexists
|
|
#, object-pascal-format
|
|
msgid "Page name \"%s\" already exists. Not added."
|
|
msgstr "Nazwa zakładki \"%s\" już istnieje. Nie dodano."
|
|
|
|
#: lazarusidestrconsts.lispanic
|
|
msgctxt "lazarusidestrconsts.lispanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparsed
|
|
msgid ", parsed "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparser
|
|
#, object-pascal-format, fuzzy
|
|
msgid "parser \"%s\": %s"
|
|
msgstr "%s nie istnieje: %s"
|
|
|
|
#: lazarusidestrconsts.lisparsers
|
|
msgid "Parsers:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
|
|
#, object-pascal-format
|
|
msgid "passing compiler define \"%s\" twice with different values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
|
|
#, object-pascal-format
|
|
msgid "passing compiler option -%s twice with different values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispasteclipboard
|
|
msgid "paste clipboard"
|
|
msgstr "wklej ze schowka"
|
|
|
|
#: lazarusidestrconsts.lispastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lispastefromclipboard"
|
|
msgid "Paste from clipboard."
|
|
msgstr "Wklej ze schowka."
|
|
|
|
#: lazarusidestrconsts.lispastelcolors
|
|
msgid "Pastel Colors"
|
|
msgstr "Kolory pastelowe"
|
|
|
|
#: lazarusidestrconsts.lispath
|
|
msgid "Path"
|
|
msgstr "Ścieżka"
|
|
|
|
#: lazarusidestrconsts.lispatheditbrowse
|
|
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
|
msgid "Browse"
|
|
msgstr "Przeglądaj"
|
|
|
|
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
|
msgid "Delete Invalid Paths"
|
|
msgstr "Usuń nieprawidłowe ścieżki"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathdown
|
|
msgid "Move path down (Ctrl+Down)"
|
|
msgstr "Przesuń ścieżkę w dół (Ctrl + w dół)"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathup
|
|
msgid "Move path up (Ctrl+Up)"
|
|
msgstr "Przesuń ścieżkę w górę (Ctrl + w górę)"
|
|
|
|
#: lazarusidestrconsts.lispatheditoraddhint
|
|
msgid "Add new path to the list"
|
|
msgstr "Dodaj nowy katalog do listy"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeletehint
|
|
msgid "Delete the selected path"
|
|
msgstr "Usuń zaznaczone ścieżki"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
|
msgid "Remove non-existent (gray) paths from the list"
|
|
msgstr "Usuń niestniejące (szare) ścieżki z listy"
|
|
|
|
#: lazarusidestrconsts.lispatheditorreplacehint
|
|
msgid "Replace the selected path with a new path"
|
|
msgstr "Zastąp zaznaczoną ścieżkę nową"
|
|
|
|
#: lazarusidestrconsts.lispatheditortempladdhint
|
|
msgid "Add template to the list"
|
|
msgstr "Dodaj szablon do listy"
|
|
|
|
#: lazarusidestrconsts.lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Szablony ścieżek"
|
|
|
|
#: lazarusidestrconsts.lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Ścieżki poszukiwań:"
|
|
|
|
#: lazarusidestrconsts.lispathisnodirectory
|
|
msgid "is not a directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
|
#, fuzzy
|
|
msgid "path of the instantfpc cache"
|
|
msgstr "Ścieżka"
|
|
|
|
#: lazarusidestrconsts.lispathofthemakeutility
|
|
msgid "Path of the make utility"
|
|
msgstr "Ścieżka do narzędzia make"
|
|
|
|
#: lazarusidestrconsts.lispathtoinstance
|
|
#, fuzzy
|
|
msgid "Path to failed Instance:"
|
|
msgstr "zawsze uruchamiaj nową instancję"
|
|
|
|
#: lazarusidestrconsts.lispause
|
|
msgctxt "lazarusidestrconsts.lispause"
|
|
msgid "Pause"
|
|
msgstr "Wstrzymaj"
|
|
|
|
#: lazarusidestrconsts.lispckcleartousethepackagename
|
|
msgid "Clear to use the package name"
|
|
msgstr "Wyczyść aby użyć nazwy pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckdisablei18noflfm
|
|
msgid "Disable I18N of lfm"
|
|
msgstr "Wyłącz i18n dla LFM"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
|
msgid "Add Files from File System"
|
|
msgstr "Dodaj plik z systemu plików"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddtoproject
|
|
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Dodaj do projektu"
|
|
|
|
#: lazarusidestrconsts.lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Zastosuj zmiany"
|
|
|
|
#: lazarusidestrconsts.lispckeditavailableonline
|
|
msgid "(available online)"
|
|
msgstr "(dostępny online)"
|
|
|
|
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
|
#, object-pascal-format
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "Wywołaj procedurę %sRegister%s bieżącego modułu"
|
|
|
|
#: lazarusidestrconsts.lispckeditcheckavailabilityonline
|
|
msgid "Check availability online"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
|
msgid "Clean up dependencies ..."
|
|
msgstr "Czyszczenie zależności..."
|
|
|
|
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
|
msgid "Clear default/preferred filename of dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcommonoptions
|
|
msgid "Common"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Chcesz kompilować wszystko?"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Kompiluj pakiet"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
|
#, object-pascal-format
|
|
msgid "Compiler Options for Package %s"
|
|
msgstr "Opcje kompilatora dla pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
|
msgid "Create fpmake.pp"
|
|
msgstr "Utwórz fpmake.pp"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatemakefile
|
|
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Utwórz Makefile"
|
|
|
|
#: lazarusidestrconsts.lispckeditdefault
|
|
#, object-pascal-format
|
|
msgid "%s, default: %s"
|
|
msgstr "%s, domyślnie: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr "Właściwości zależności"
|
|
|
|
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
|
msgid "Edit general options"
|
|
msgstr "Zmień ogólne opcje"
|
|
|
|
#: lazarusidestrconsts.lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Właściwości plku"
|
|
|
|
#: lazarusidestrconsts.lispckeditfpmakepackage
|
|
msgid "(fpmake)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Zainstaluj"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Błędny maksymalny numer wersji"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Błędny minimalny numer wersji"
|
|
|
|
#: lazarusidestrconsts.lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Maksymalny nr wersji:"
|
|
|
|
#: lazarusidestrconsts.lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Minimalny nr wersji:"
|
|
|
|
#: lazarusidestrconsts.lispckeditmodified
|
|
#, object-pascal-format
|
|
msgid "Modified: %s"
|
|
msgstr "Zmieniony: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Przesuń zależność w dół"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Przesuń zależność w górę"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackage
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispckeditpackage"
|
|
msgid "Package %s"
|
|
msgstr "Pakiet %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" has changed.%sSave package?"
|
|
msgstr "Pakiet \"%s\" został zmieniony.%sCzy chcesz go zapisać?"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
|
#, object-pascal-format
|
|
msgid "package %s not saved"
|
|
msgstr "pakiet %s nie został zapisany"
|
|
|
|
#: lazarusidestrconsts.lispckeditpage
|
|
#, object-pascal-format
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s, Zakładka: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Powtórnie dodaj zależność"
|
|
|
|
#: lazarusidestrconsts.lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Dodaj powtórnie plik"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadonly
|
|
#, object-pascal-format
|
|
msgid "Read Only: %s"
|
|
msgstr "Tylko do odczytu: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
|
msgid "Recompile All Required"
|
|
msgstr "Przekompiluj wszystkie wymagane"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileclean
|
|
msgid "Recompile Clean"
|
|
msgstr "Przekompiluj po wyczyszczeniu"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Czy prrzekompilować ten i wszystkie wymagane pakiety?"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Zarejestrowane wtyczki"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Zarejestruj moduł"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Usuń zależność"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Czy chcesz usunąć zależność \"%s\"%sz pakietu \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedfiles
|
|
msgid "Removed Files"
|
|
msgstr "Usunięte pliki"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Usunięte wymagane pakiety"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Usuń plik"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Chcesz usunąć plik?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Czy chcesz usunąć plik \"%s\"%sz pakietu \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Usuń wybrany element"
|
|
|
|
#: lazarusidestrconsts.lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Wymagane pakiety"
|
|
|
|
#: lazarusidestrconsts.lispckeditsavepackage
|
|
msgid "Save Package"
|
|
msgstr "Zapisz pakiet"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
|
msgid "Store file name as default for this dependency"
|
|
msgstr "Traktuj nazwę pliku jako domyślną dla tej zależności"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
|
#, fuzzy
|
|
msgid "Store file name as preferred for this dependency"
|
|
msgstr "Traktuj nazwę pliku jako domyślną dla tej zależności"
|
|
|
|
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
|
#, object-pascal-format
|
|
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Maksymalny numer wersji \"%s\" nie jest poprawnym numerem wersji pakietu.%s(przykład poprawnego: 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
|
#, object-pascal-format
|
|
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Minimalny numer wersji \"%s\" nie jest poprawnym numerem wersji pakietu.%s(przykład poprawnego: 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "Odinstaluj"
|
|
|
|
#: lazarusidestrconsts.lispckeditviewpackagesource
|
|
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
|
msgid "View Package Source"
|
|
msgstr "Pokaż źródło pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckexplbase
|
|
msgid "Base, cannot be uninstalled"
|
|
msgstr "Bazowy, nie można odinstalować"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstalled
|
|
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
|
msgid "Installed"
|
|
msgstr "Zainstalowany"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Zainstaluj przy następnym uruchomieniu"
|
|
|
|
#: lazarusidestrconsts.lispckexplstate
|
|
#, object-pascal-format
|
|
msgid "%sState: "
|
|
msgstr "%sStan: "
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
|
msgid "Uninstall on next start (unless needed by an installed package)"
|
|
msgstr "Odinstaluj przy następnym uruchomieniu (jeżeli nie jest wymagane przez inny pakiet)"
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallpackage
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
|
msgid "Uninstall package %s"
|
|
msgstr "Odinstalowanie pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "Dodaj opcje do zależnych pakietów i projektów"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Dodaj ścieżki do zależnych pakietów/projektów"
|
|
|
|
#: lazarusidestrconsts.lispckoptsauthor
|
|
msgid "Author"
|
|
msgstr "Autor"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Automatycznie przebuduj gdy trzeba"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Automatycznie przebuduj przy Przebuduj wszystkie"
|
|
|
|
#: lazarusidestrconsts.lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Dodatkowe"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
|
msgid "Description / Abstract"
|
|
msgstr "Opis / Streszczenie"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntime
|
|
msgctxt "lazarusidestrconsts.lispckoptsdesigntime"
|
|
msgid "Designtime"
|
|
msgstr "Tryb projektowy"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
|
msgctxt "lazarusidestrconsts.lispckoptsdesigntimeandruntime"
|
|
msgid "Designtime and runtime"
|
|
msgstr "Projektowy i uruchomieniowy"
|
|
|
|
#: lazarusidestrconsts.lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "Integracja z IDE"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr "Dołącz"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Nieprawidłowy typ pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Biblioteka"
|
|
|
|
#: lazarusidestrconsts.lispckoptslicense
|
|
msgctxt "lazarusidestrconsts.lispckoptslicense"
|
|
msgid "License"
|
|
msgstr "Licencja"
|
|
|
|
#: lazarusidestrconsts.lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Linker"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr "Major"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Ręczna kompilacja (nigdy automatyczna)"
|
|
|
|
#: lazarusidestrconsts.lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr "Minor"
|
|
|
|
#: lazarusidestrconsts.lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Obiekt"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackageoptions
|
|
msgid "Package Options"
|
|
msgstr "Opcje pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackagetype
|
|
msgid "Package type"
|
|
msgstr "Typ pakietu"
|
|
|
|
#: lazarusidestrconsts.lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr "Dostarcza"
|
|
|
|
#: lazarusidestrconsts.lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Release"
|
|
|
|
#: lazarusidestrconsts.lispckoptsruntime
|
|
#, fuzzy
|
|
msgid "Runtime"
|
|
msgstr "Biblioteka runtime"
|
|
|
|
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
|
msgstr "Pakiet \"%s\" ma flagę auto instalacji.%sOznacza to, że będzie on automatycznie instalowany przez IDE. Instalowane pakiety%s muszą być pakietami projektowymi."
|
|
|
|
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
|
msgid "Update / Rebuild"
|
|
msgstr "Odśwież/przebuduj"
|
|
|
|
#: lazarusidestrconsts.lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Użycie"
|
|
|
|
#: lazarusidestrconsts.lispckpackage
|
|
msgctxt "lazarusidestrconsts.lispckpackage"
|
|
msgid "Package:"
|
|
msgstr "Pakiet:"
|
|
|
|
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
|
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckshowunneededdependencies
|
|
msgid "Show unneeded dependencies"
|
|
msgstr "Pokaż niepotrzebne zależności"
|
|
|
|
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
|
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispdabort
|
|
msgctxt "lazarusidestrconsts.lispdabort"
|
|
msgid "Abort"
|
|
msgstr "Przerwij"
|
|
|
|
#: lazarusidestrconsts.lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Postęp"
|
|
|
|
#: lazarusidestrconsts.lispecollapsedirectory
|
|
msgid "Collapse directory"
|
|
msgstr "Zwiń katalog"
|
|
|
|
#: lazarusidestrconsts.lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr "Natrafiono na konflikt"
|
|
|
|
#: lazarusidestrconsts.lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr "Edycja wirtualnego modułu"
|
|
|
|
#: lazarusidestrconsts.lispeexpanddirectory
|
|
msgid "Expand directory"
|
|
msgstr "Rozwiń katalog"
|
|
|
|
#: lazarusidestrconsts.lispefilename
|
|
msgid "Filename:"
|
|
msgstr "Nazwa pliku:"
|
|
|
|
#: lazarusidestrconsts.lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr "Popraw wielkość znaków w nazwach plików"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr "Nieprawidłowa nazwa pliku modułu"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr "Nieprawidłowa nazwa modułu"
|
|
|
|
#: lazarusidestrconsts.lispemissingfilesofpackage
|
|
#, object-pascal-format
|
|
msgid "Missing files of package %s"
|
|
msgstr "Brak plików pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
|
#, fuzzy
|
|
msgid "New file not in include path"
|
|
msgstr "Plik dołączany (include)"
|
|
|
|
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
|
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
|
msgid "No files missing. All files exist."
|
|
msgstr "Nie brakuje plików. Wszystkie pliki istnieją."
|
|
|
|
#: lazarusidestrconsts.lisperemovefiles
|
|
msgid "Remove files"
|
|
msgstr "Usuń pliki"
|
|
|
|
#: lazarusidestrconsts.lisperevertpackage
|
|
msgid "Revert Package"
|
|
msgstr "Przywrócenie pakietu"
|
|
|
|
#: lazarusidestrconsts.lispesavepackageas
|
|
msgid "Save Package As ..."
|
|
msgstr "Zapisz pakiet jako..."
|
|
|
|
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
|
msgid "Show directory hierarchy"
|
|
msgstr "Pokaż hierarchię katalogów"
|
|
|
|
#: lazarusidestrconsts.lispeshowmissingfiles
|
|
msgid "Show Missing Files"
|
|
msgstr "Pokaż brakujące pliki"
|
|
|
|
#: lazarusidestrconsts.lispesortfiles
|
|
msgid "Sort Files Permanently"
|
|
msgstr "Sortuj pliki"
|
|
|
|
#: lazarusidestrconsts.lispesortfilesalphabetically
|
|
msgid "Sort files alphabetically"
|
|
msgstr "Sortuj pliki alfabetycznie"
|
|
|
|
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr "Nazwa modułu:"
|
|
|
|
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
|
#, fuzzy
|
|
msgid "Use all units in directory"
|
|
msgstr "katalog modułów packagera"
|
|
|
|
#: lazarusidestrconsts.lispeusenounitsindirectory
|
|
#, fuzzy
|
|
msgid "Use no units in directory"
|
|
msgstr "katalog modułów packagera"
|
|
|
|
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
|
msgid "Clean up package dependencies"
|
|
msgstr "Wyczyść zależności pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgclearselection
|
|
msgid "Clear Selection"
|
|
msgstr "Wyczyść wybór"
|
|
|
|
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
|
msgid "CompiledSrcPath addition"
|
|
msgstr "dodatek ŚcieżkaŹródłowaKompilatora"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsnamespaces
|
|
msgid "Namespaces"
|
|
msgstr "Przestrzenie nazw"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
|
msgid "Output directory"
|
|
msgstr "Katalog wyjściowy"
|
|
|
|
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
|
msgid "Package Source Directory Mark"
|
|
msgstr "Znacznik katalogu źródeł pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsunitpath
|
|
msgid "Unit Path"
|
|
msgstr "Ścieżka modułu"
|
|
|
|
#: lazarusidestrconsts.lispkgdeletedependencies
|
|
msgid "Delete dependencies"
|
|
msgstr "Usuń zależności"
|
|
|
|
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
#, object-pascal-format
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Czy naprawdę chcesz anulować wszystkie zmiany do pakietu %s ponownie wczytać go z pliku?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "Nowy modułu jest poza ścieżką do modułów"
|
|
|
|
#: lazarusidestrconsts.lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Publikuj pakiet"
|
|
|
|
#: lazarusidestrconsts.lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Chcesz przywrócić pakiet?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
|
msgstr "Plik \"%s\"%sjest poza ścieżką do modułów. %sCzy chesz dodać \"%s\" do ścieżki modułów?"
|
|
|
|
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
|
msgid "More functions for the package"
|
|
msgstr "Więcej funkcji dla pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypebinary
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
|
msgid "Binary"
|
|
msgstr "Binarny"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeinclude
|
|
msgid "Include file"
|
|
msgstr "Plik dołączany (include)"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeissues
|
|
#, fuzzy
|
|
msgid "Issues xml file"
|
|
msgstr "Otwórz jako plik XML"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelfm
|
|
msgid "LFM - Lazarus form text"
|
|
msgstr "LFM - formularz Lazarusa jako tekst"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelrs
|
|
msgid "LRS - Lazarus resource"
|
|
msgstr "LRS - zasoby Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypemainunit
|
|
msgid "Main Unit"
|
|
msgstr "Główny moduł"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypetext
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
|
msgid "Virtual Unit"
|
|
msgstr "Wirtualny moduł"
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
|
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
|
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
|
|
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
|
|
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
|
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
|
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%sAdding new Dependency for package %s: package %s"
|
|
msgstr "Pakiet ma już określoną zależność od pakietu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%sAdding new Dependency for project %s: package %s"
|
|
msgstr "Projekt ma już zależność od pakietu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddunittousesclause
|
|
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Znaleziono moduły o dwuznacznej nazwie"
|
|
|
|
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Automatycznie zainstalowane pakiety"
|
|
|
|
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
#, object-pascal-format
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sPakiety są powiązane, tzn. jeden z nich jest używany przez drugi, albo obydwa są używane przez inny pakiet."
|
|
|
|
#: lazarusidestrconsts.lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Zerwana zależność"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
|
msgid "Circular dependencies found"
|
|
msgstr "Znaleziono cykliczne zależności"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcompilepackage
|
|
#, object-pascal-format
|
|
msgid "Compile package %s"
|
|
msgstr "Kompilacja pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeletefailed
|
|
msgid "Delete failed"
|
|
msgstr "Błąd podczas usuwania"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Chcesz usunąć stary plik pakietu?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
|
#, object-pascal-format
|
|
msgid "Delete old package file \"%s\"?"
|
|
msgstr "Czy chcesz usunąć stary plik pakietu \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
|
#, object-pascal-format
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Zależność bez właściciela: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
|
msgid "Error reading file"
|
|
msgstr "Błąd odczytu pliku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Błąd przy odczycie pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Błąd podczas zapisu do pliku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Błąd przy zapisywaniu pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "Plik już należy do pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "Plik należy do projektu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Nazwa pliku różni się od nazwy pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Plik jest używany przez inny pakiet"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Plik o tej nazwie jest już używany w projekcie"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotfound
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Nie znaleziono pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "Plik nie zapisany"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
#, object-pascal-format
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
#, object-pascal-format
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Błędne rozszerzenie pliku"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Nieprawidłowe rozszerzenie nazwy pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Nieprawidłowa nazwa pliku pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Nieprawidłowa nazwa pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Nieprawidłowa nazwa pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
|
#, object-pascal-format
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
|
msgstr "Załadowanie pakietu %s spowoduje zastąpienie pakietu %s%sz pliku %s.%sPoprzedni pakiet był zmieniany.%sCzy chcesz zapisać poprzedni pakiet %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackage
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispkgmangpackage"
|
|
msgid "Package: %s"
|
|
msgstr "Pakiet: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Pakiet jest w konflikcie"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
|
msgid "Package is not a designtime package"
|
|
msgstr "Pakiet nie jest typu projektowego"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Pakiet jest wymagany"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
|
msgid "package main source file"
|
|
msgstr "główny plik źródłowy pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Pakiet o tej nazwie już istnieje"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Pakiety muszą mieć rozszerzenie .lpk"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
|
msgid "Please compile the package first."
|
|
msgstr "Proszę najpierw skompilować pakiet."
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Zapisz plik przed dodaniem go do pakietu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangproject
|
|
#, object-pascal-format
|
|
msgid "Project: %s"
|
|
msgstr "Projekt: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Czy przebudować Lazarusa?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr "Zmienić litery na małe w nazwie pliku?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
|
#, object-pascal-format
|
|
msgid "Replace existing file \"%s\"?"
|
|
msgstr "Nadpisać istniejący plik \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Nadpisz plik"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
|
msgid "One or more required packages were not found. See package graph for details."
|
|
msgstr "Nie znaleziono jednego lub więcej pakietów. Zobacz szczegóły w grafie pakietów."
|
|
|
|
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"The package %s is already open in the IDE.\n"
|
|
"You cannot save a package with the same name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage
|
|
msgid "Save package?"
|
|
msgstr "Zapisać pakiet?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
|
#, object-pascal-format
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Zapisz pakiet %s (*.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
|
#, object-pascal-format
|
|
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
|
msgstr "Czy litery w nazwie pliku mają być zmienione na małe: %s\"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr "Pomiń ten pakiet"
|
|
|
|
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
|
msgid "static packages config file"
|
|
msgstr "plik konfiguracji statycznych pakietów"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
|
msgid "The file \"%s\"%sis already in the package %s."
|
|
msgstr "Plik \"%s\"%s już należy do pakietu %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is not a Lazarus package."
|
|
msgstr "Plik \"%s\" nie jest pakietem Lazarusa."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
#, object-pascal-format
|
|
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
|
msgstr "Nazwa pliku \"%s\" nie odpowiada nazwie pakietu \"%s\" w tym pliku.%sCzy chcesz zmienić nazwę pakietu na \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
|
#, object-pascal-format
|
|
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "Plik o nazwie \"%s\" jest już częścią bieżącego projektu.%sProjekt i pakiety nie powinny współdzielić plików."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
|
#, object-pascal-format
|
|
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
|
msgstr "Plik \"%s\" jest używany przez%spakiet \"%s\"%sw pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The file \"%s\" of package %s was not found."
|
|
msgstr "Nie znaleziono pakietu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
|
#, fuzzy
|
|
msgid "The following package failed to load:"
|
|
msgstr "Nie można załadować pakietu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr "Nie udało się wczytać następujących pakietów:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
#, object-pascal-format
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
#, object-pascal-format
|
|
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
|
msgstr "Nazwa pliku pakietu \"%s\"w%s\"%s\" nie jest prawidłową nazwą pakietu Lazarusa."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
#, object-pascal-format
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
|
msgstr "Pakiet %s jest tylko pakietem uruchomieniowym.%sTego typu pakiety nie mogą być instalowane w IDE."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Pakiet \"%s\" został zaznaczony do instalacji, ale nie można go odnaleźć.%sCzy usunąć zależność z listy pakietów do instalacji?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
#, object-pascal-format
|
|
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
|
|
msgstr "Pakiet %s Jest wymagany przez %s, który został zaznaczony do instalacji.%sSpójrz na graf pakietów."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
#, object-pascal-format
|
|
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "Nazwa pakietu \"%s\" jest nieprawidłowa%sWybierz inną nazwę (np. package1.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
|
#, object-pascal-format
|
|
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
|
msgstr "Nazwa pakietu \"%s\" z%spliku \"%s\" jest nieprawidłowa."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Pakiet \"%s\" został zaznaczony.%sAktualnie Lazarus obsługuje tylko statyczne łączenie pakietów. Pełna instalacja wymaga przebudowania i powtórnego uruchomienia Lazarusa.%sCzy chcesz teraz przebudować Lazarusa?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Pakiet \"%s\" został zaznaczony do instalacji.%sAktualnie Lazarus obsługuje tylko statyczne łączenie pakietów. Pełna instalacja wymaga przebudowania i powtórnego uruchomienia Lazarusa.%sCzy chcesz teraz przebudować Lazarusa?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
#, object-pascal-format
|
|
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Projekt wymaga pakietu,\"%s\".%sktóry nie został odnaleziony. Sprawdź Projekt-> Inspektor projektu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
|
#, object-pascal-format
|
|
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
|
msgstr "Istnieją dwa moduły z tą samą nazwą::%s1. \"%s\" w %s%s2 oraz \"%s\" w %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
|
msgid "There is a circular dependency in the packages. See package graph."
|
|
msgstr "Znaleziono zapętlenie zależności pakietów. Spójrz na graf pakietów."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
#, object-pascal-format
|
|
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
|
msgstr "Istnieje moduł w FPC o nazwie takiej samej jak pakiet:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
|
#, object-pascal-format
|
|
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
|
msgstr "Istnieje moduł w FPC o nazwie takiej samej jak pakiet:%s\"%s\" w %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
|
#, object-pascal-format
|
|
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
|
msgstr "Istnieje już inny pakiet o nazwie \"%s\".%sKonfklikt w: \"%s\"%sPlik: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
|
#, object-pascal-format
|
|
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgstr "Pakiet jest już \"%s\" załadowany%sz pliku \"%s\".%sSprawdć Komponenty -> Lista pakietów.%sNadpisanie jest niemożliwe."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Znaleziono wśród wymaganych pakietów niezapisany pakiet. Sprawdź listę pakietów."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
#, object-pascal-format
|
|
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
|
msgstr "Istnieje moduł o nazwie takiej samej jak pakiet:%s1. \"%s\" w %s%s2. \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr "To jest pakiet wirtualny. Nie ma jeszcze tekstu źródłowego. Proszę najpierw zapisać pakiet."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
|
msgid "Unable to create directory"
|
|
msgstr "Nie można utworzyć katalogu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
|
#, object-pascal-format
|
|
msgid "Unable to create output directory \"%s\"%sfor package %s."
|
|
msgstr "Nie można utworzyć kaalogu wyjściowego \"%s\"%s dla pakietu %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
|
#, object-pascal-format
|
|
msgid "Unable to create package source directory \"%s\"%sfor package %s."
|
|
msgstr "Nie można utworzyć katalogu ze źródłami \"%s\"%sdla pakietu %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
#, object-pascal-format
|
|
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgstr "Nie można utworzyć katalogu docelowego dla Lazarusa:%s\"%s\".%sTen katalog jest wymagany przez nowe zmienione IDE z dodatkowymi pakietami."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
|
#, object-pascal-format
|
|
msgid "Unable to delete file \"%s\"."
|
|
msgstr "Nie można usunąć pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
|
msgid "Unable to delete file"
|
|
msgstr "Nie można usunąć pliku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
|
#, object-pascal-format
|
|
msgid "Unable to delete old state file \"%s\"%sfor package %s."
|
|
msgstr "Nie można usunąć starego pliku statusu \"%s\"%spakietu %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
|
msgid "Unable to load package"
|
|
msgstr "Nie można załadować pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
|
#, object-pascal-format
|
|
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
|
|
msgstr "Nie można otworzyć pakietu \"%s\".%sPakiet ten został zaznaczony do instalacji."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
|
#, object-pascal-format
|
|
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Nie można odczytać pliku statusu \"%s\"%spakietu %s.%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
|
msgstr "Nie można zapisać pakietu \"%s\"%sdo pliku \"%s\".%sBład: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
|
#, object-pascal-format
|
|
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Nie można zapisać pliku statusu \"%s\"%spakietu %s.%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Odinstalować pakiet?"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
|
#, object-pascal-format
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Odinstalować pakiet %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Niezapisany pakiet"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Użyj modułu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
|
#, object-pascal-format
|
|
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
|
msgstr "Uwaga: Plik \"%s\"%snależy do bieżącego projektu."
|
|
|
|
#: lazarusidestrconsts.lispkgmgrkeep
|
|
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
|
msgid "keep"
|
|
msgstr "zachowaj"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrnew
|
|
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
|
msgid "new"
|
|
msgstr "nowy"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrremove
|
|
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
|
msgid "remove"
|
|
msgstr "usuń"
|
|
|
|
#: lazarusidestrconsts.lispkgselectapackage
|
|
msgid "Select a package"
|
|
msgstr "Wybierz pakiet"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
|
msgid "Cannot register components without unit"
|
|
msgstr "Nie można zarejestrować komponentów bez modułu"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
|
#, object-pascal-format
|
|
msgid "Component Class \"%s\" already defined"
|
|
msgstr "Klasa komponentu \"%s\" już została zdefiniowana"
|
|
|
|
#: lazarusidestrconsts.lispkgsysfilename
|
|
#, object-pascal-format
|
|
msgid "%s%sFile Name: \"%s\""
|
|
msgstr "%s%sNazwa pliku: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
|
msgid "Invalid component class"
|
|
msgstr "Nieprawidłowa klasa komponentu"
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
|
#, object-pascal-format
|
|
msgid "Invalid Unitname: %s"
|
|
msgstr "Błędna nazwa modułu: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgsyslpkfilename
|
|
#, object-pascal-format
|
|
msgid "%s%slpk file: \"%s\""
|
|
msgstr "%s%slpk plik: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
|
msgid "Package file not found"
|
|
msgstr "Nie znaleziono pliku pakietu"
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
|
msgid "Package registration error"
|
|
msgstr "Błąd rejestracji komponentu"
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
|
msgid "Register procedure is nil"
|
|
msgstr "Procedura rejestracji jest pusta"
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
|
msgid "RegisterUnit was called but no package is registering."
|
|
msgstr "Wywołano RegisterUnit, ale żaden pakiet nie jest rejestrowany."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%s%sThe lpk file was not found."
|
|
msgstr "%sTen pakiet jest zainstalowany, ale nie znaleziono jego pliku lpk"
|
|
|
|
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
|
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
|
msgstr "To jest domyślny pakiet, używany tylko dla komponentów które nie mają pakietu. Te komponenty są już przedawnione."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitname
|
|
#, object-pascal-format
|
|
msgid "%s%sUnit Name: \"%s\""
|
|
msgstr "%s%sNazwa modułu: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
|
#, object-pascal-format
|
|
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
|
|
msgid "Unit \"%s\" was removed from package (lpk)"
|
|
msgstr "Moduł \"%s\" usunięto z pakietu (lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
|
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
|
#, object-pascal-format
|
|
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
|
#, fuzzy
|
|
msgid "This file is not in any loaded package."
|
|
msgstr "Otwórz załadowany pakiet ..."
|
|
|
|
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Unable to read package file \"%s\".%sError: %s"
|
|
msgstr "Nie można odczytać pliku \"%s\"%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisplay
|
|
msgid "Play"
|
|
msgstr "Odtwórz"
|
|
|
|
#: lazarusidestrconsts.lispldglobal
|
|
msgctxt "lazarusidestrconsts.lispldglobal"
|
|
msgid "Global"
|
|
msgstr "Globalny"
|
|
|
|
#: lazarusidestrconsts.lispldonline
|
|
#, fuzzy
|
|
msgid "Online"
|
|
msgstr "Pomoc online"
|
|
|
|
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
|
|
#, fuzzy
|
|
msgid "Online packages cannot be deleted"
|
|
msgstr "Nie można usunąć głównego komponentu."
|
|
|
|
#: lazarusidestrconsts.lispldpackagelinks
|
|
msgctxt "lazarusidestrconsts.lispldpackagelinks"
|
|
msgid "Package Links"
|
|
msgstr "Odnośniki pakietów"
|
|
|
|
#: lazarusidestrconsts.lispldshowgloballinksin
|
|
msgid "Show global links in "
|
|
msgstr "Pokaż odnośniki globalne "
|
|
|
|
#: lazarusidestrconsts.lispldshowonlinelinks
|
|
msgid "Show online links"
|
|
msgstr "Pokaż odnośniki online"
|
|
|
|
#: lazarusidestrconsts.lispldshowuserlinksin
|
|
msgid "Show user links in "
|
|
msgstr "Pokaż odnośniki użytkownika "
|
|
|
|
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
|
|
#, fuzzy
|
|
msgid "Some packages cannot be deleted"
|
|
msgstr "Nie można usunąć głównego komponentu."
|
|
|
|
#: lazarusidestrconsts.lisplduser
|
|
msgid "User"
|
|
msgstr "Użytkownika"
|
|
|
|
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
|
msgid "Please fix the error shown in the message window which is normally below the source editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "Proszę otworzyć moduł przed uruchomieniem."
|
|
|
|
#: lazarusidestrconsts.lispleaseselectatleastonebuildmode
|
|
#, fuzzy
|
|
msgid "Please select at least one build mode."
|
|
msgstr "Musi być przynajmniej jeden tryb budowania."
|
|
|
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplistall
|
|
msgctxt "lazarusidestrconsts.lisplistall"
|
|
msgid "<All>"
|
|
msgstr "<wszystkie>"
|
|
|
|
#: lazarusidestrconsts.lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr "Zmień czcionkę"
|
|
|
|
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr "Kopiuj do schowka nazwę metody"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr "Filtruj zgodnie z częścią nazwy metody"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr "Filtruj zgodnie z początkiem nazwy metody"
|
|
|
|
#: lazarusidestrconsts.lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Skocz do zaznaczenia"
|
|
|
|
#: lazarusidestrconsts.lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<brak>"
|
|
|
|
#: lazarusidestrconsts.lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Obiekty"
|
|
|
|
#: lazarusidestrconsts.lisplistprocedurelist
|
|
msgid "Procedure List"
|
|
msgstr "Lista procedur"
|
|
|
|
#: lazarusidestrconsts.lisplisttype
|
|
msgctxt "lazarusidestrconsts.lisplisttype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr "Wybierz katalog pliku .po"
|
|
|
|
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Nie zapisuj żadnych informacji o sesji"
|
|
|
|
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
|
msgid "Save in .lps file in IDE config directory"
|
|
msgstr "Zapisz w pliku .lps w katalogu konfiguracyjnym IDE"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "Zapisz w pliku .lpi"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr "Zapisz w pliku .lps w katalogu projektu"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Zapisz informacje o sesji w"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
|
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposition
|
|
msgid "Position"
|
|
msgstr "Pozycja"
|
|
|
|
#: lazarusidestrconsts.lispositionoutsideofsource
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%s (position outside of source)"
|
|
msgstr "Pozycja poza źródłem"
|
|
|
|
#: lazarusidestrconsts.lisppuinwrongdirectory
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "ppu in wrong directory=%s."
|
|
msgstr "Katalog wyjściowy projektu (tzn. katalog plików *.ppu)"
|
|
|
|
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
|
#, object-pascal-format
|
|
msgid "%s.ppu not found. Check your fpc.cfg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprecedingword
|
|
msgid "Preceding word"
|
|
msgstr "Poprzedzające słowo"
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
msgid "primary config directory where Lazarus stores its config files. Default is "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigpath
|
|
msgid "Primary config path"
|
|
msgstr "Pierwszoplanowa ścieżka konfiguracji"
|
|
|
|
#: lazarusidestrconsts.lisprior
|
|
#, object-pascal-format
|
|
msgid "prior %s"
|
|
msgstr "poprzedni %s"
|
|
|
|
#: lazarusidestrconsts.lispriority
|
|
msgctxt "lazarusidestrconsts.lispriority"
|
|
msgid "Priority"
|
|
msgstr "Priorytet"
|
|
|
|
#: lazarusidestrconsts.lisprivate
|
|
#, fuzzy
|
|
msgid "Private"
|
|
msgstr "publiczne/prywatne"
|
|
|
|
#: lazarusidestrconsts.lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Metody prywatne"
|
|
|
|
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
#, object-pascal-format
|
|
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprocedure
|
|
msgctxt "lazarusidestrconsts.lisprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedura"
|
|
|
|
#: lazarusidestrconsts.lisprocedurewithinterface
|
|
#, fuzzy
|
|
msgid "Procedure with interface"
|
|
msgstr "Procedura"
|
|
|
|
#: lazarusidestrconsts.lisprogram
|
|
msgctxt "lazarusidestrconsts.lisprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Wykryto program"
|
|
|
|
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
|
msgid "A Free Pascal command line program with some useful settings added."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Plik źródłowy Pascala powinien mieć odpowiednie rozszerzenie, jak .pas, .pp lub .lpr"
|
|
|
|
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Zależność już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
|
msgid "Add Editor Files"
|
|
msgstr "Dodaj pliki z edytora"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Błędna wersja Min-Max"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Nieodpowiednia wersja"
|
|
|
|
#: lazarusidestrconsts.lisprojaddlocalpkg
|
|
#, object-pascal-format
|
|
msgid "Local (%s)"
|
|
msgstr "Lokalne (%s)"
|
|
|
|
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Maksymalny numer wersji (opcjonalny):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Minimalny numer wersji (opcjonalny):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
|
|
msgid "New FPMake Requirement"
|
|
msgstr "Nowy wymóg FPMake"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Nowy wymóg"
|
|
|
|
#: lazarusidestrconsts.lisprojaddonlinepkg
|
|
#, object-pascal-format
|
|
msgid "Online (%s)"
|
|
msgstr "Online (%s)"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Nazwa pakietu:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Nie znaleziono pakietu"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagetype
|
|
msgid "Package Type:"
|
|
msgstr "Typ pakietu:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
|
#, object-pascal-format
|
|
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
|
msgstr "Nie znaleziono zależności \"%s\".%sWybierz istniejący pakiet."
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Maksymalny numer wersji \"%s\" jest nieprawidłowy.%sUżyj formatu: major.minor.release.build%sNp.: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maksymalny numer wersji jest mniejszy niż minimalny."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Minimalny numer wersji \"%s\" jest nieprawidłowy.%sUżyj formatu: major.minor.release.build%sNp.: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
|
#, object-pascal-format
|
|
msgid "The project has already a dependency for the package \"%s\"."
|
|
msgstr "Projekt jest już zależny od pakietu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
|
msgstr "Moduł o nazwie \"%s\" już istnieje w projekcie%sw pliku: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
|
msgstr "Nazwa modułu \"%s\" już istnieje w zaznaczeniu%sw pliku: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Moduł o tej nazwie już istnieje"
|
|
|
|
#: lazarusidestrconsts.lisproject
|
|
#, object-pascal-format
|
|
msgid "Project %s"
|
|
msgstr "Projekt %s"
|
|
|
|
#: lazarusidestrconsts.lisproject2
|
|
msgid "Project: "
|
|
msgstr "Projekt: "
|
|
|
|
#: lazarusidestrconsts.lisproject3
|
|
msgid "project"
|
|
msgstr "projekt"
|
|
|
|
#: lazarusidestrconsts.lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Projekt zmieniony"
|
|
|
|
#: lazarusidestrconsts.lisprojectchangedondisk
|
|
msgid "Project changed on disk"
|
|
msgstr "Projekt na dysku uległ zmianie"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectory
|
|
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Katalog projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
|
msgid "Title in taskbar shows also directory path of the project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Nazwa pliku projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Ścieżka dołączanych plików projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "Wykryto plik z informacją o projekcie"
|
|
|
|
#: lazarusidestrconsts.lisprojectinspectorshowprops
|
|
msgid "Show properties pane in Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Projekt jest wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnablehint
|
|
msgid "Generates a binary executable which can be run."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacro
|
|
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
|
msgid "Project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.lisprojectmacroproperties
|
|
#, fuzzy
|
|
msgid "Project macro properties"
|
|
msgstr "&Właściwości"
|
|
|
|
#: lazarusidestrconsts.lisprojectnamespaces
|
|
#, fuzzy
|
|
msgid "Project Namespaces"
|
|
msgstr "w projekcie:"
|
|
|
|
#: lazarusidestrconsts.lisprojectoption
|
|
msgid "Project Option"
|
|
msgstr "Opcje projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutdir
|
|
msgid "Project Output directory (e.g. the ppu directory)"
|
|
msgstr "Katalog wyjściowy projektu (tzn. katalog plików *.ppu)"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutputdirectory
|
|
msgid "Project output directory"
|
|
msgstr "Katalog wyjściowy projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectpathhint
|
|
msgid "Directory where project's main file must be"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsession
|
|
#, fuzzy
|
|
msgid "Project Session"
|
|
msgstr "Pytaj przed zapisem sesji projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectsessionchanged
|
|
#, fuzzy
|
|
msgid "Project session changed"
|
|
msgstr "Projekt zmieniony"
|
|
|
|
#: lazarusidestrconsts.lisprojectsourcedirectories
|
|
msgid "Project source directories"
|
|
msgstr "Katalogi źródeł projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s At address %1:x"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
|
#, object-pascal-format
|
|
msgid "Project %s raised exception class '%s'."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
|
#, object-pascal-format
|
|
msgid "Project %s raised exception class '%s' with message:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Ścieżka źródeł projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectunit
|
|
#, fuzzy
|
|
msgid "project unit"
|
|
msgstr "Ścieżka do modułów projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Ścieżka do modułów projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr "Kreator projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Potwierdź usunięcie zależności"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr "Potwierdź usunięcie pliku"
|
|
|
|
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
|
#, object-pascal-format
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Chcesz usunąć zależność od %s?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspprojectinspector
|
|
#, object-pascal-format
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Inspektor projektu - %s"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Usunięte wymagane pakiety"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
|
#, object-pascal-format
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Chcesz usunąć plik %s z projektu?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Remove %s items from project?"
|
|
msgstr "Chcesz usunąć plik %s z projektu?"
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Unable to read state file %s of project %s%sError: %s"
|
|
msgstr "Nie można odczytać pliku statusu \"%s\"%spakietu %s.%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Unable to write state file for project %s%sError: %s"
|
|
msgstr "Nie można zapisać pliku statusu \"%s\"%spakietu %s.%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Zawsze buduj (nawet jeśli nic nie zostało zmienione)"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
|
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptserror
|
|
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
|
msgid "Error"
|
|
msgstr "Błąd"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
|
#, object-pascal-format
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Nie można w źródle programu zmienić listy formularzy do automatycznego utworzenia.%sProszę najpierw poprawić błędy."
|
|
|
|
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
|
#, fuzzy
|
|
msgid "Project Source Directory Mark"
|
|
msgstr "Znacznik katalogu źródeł pakietu"
|
|
|
|
#: lazarusidestrconsts.lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Spytaj o wartość"
|
|
|
|
#: lazarusidestrconsts.lisproperties
|
|
msgid "Properties (replace or remove)"
|
|
msgstr "Właściwości (zamień lub usuń)"
|
|
|
|
#: lazarusidestrconsts.lisproperty
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "%s property"
|
|
msgstr "zamiast \";\" po specyfikacji właściwości \"%s\" znalaziono %s"
|
|
|
|
#: lazarusidestrconsts.lisprotected
|
|
msgid "Protected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprotectedmethod
|
|
#, fuzzy
|
|
msgid "Protected Method"
|
|
msgstr "Metody prywatne"
|
|
|
|
#: lazarusidestrconsts.lispublicmethod
|
|
#, fuzzy
|
|
msgid "Public Method"
|
|
msgstr "publiczne/prywatne"
|
|
|
|
#: lazarusidestrconsts.lispublishedmethod
|
|
#, fuzzy
|
|
msgid "Published Method"
|
|
msgstr "nazwa metody"
|
|
|
|
#: lazarusidestrconsts.lispublishedto
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Published to %s"
|
|
msgstr "Puplikowane właścowości bez wartości domyślnej"
|
|
|
|
#: lazarusidestrconsts.lispublishmodulenote
|
|
msgid "Files belonging to project / package will be included automatically."
|
|
msgstr "Pliki należące do projektu/pakietu zostaną dołączone automatycznie."
|
|
|
|
#: lazarusidestrconsts.lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Publikuj katalog projektu"
|
|
|
|
#: lazarusidestrconsts.lispublishproject
|
|
msgid "Publish Project"
|
|
msgstr "Publikuj projekt"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
|
msgid "Save .lrs files in the output directory"
|
|
msgstr "Zapisz pliki .lrs w katalogu wyjściowym"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
|
#, fuzzy
|
|
msgid "The resource will be available for FPC."
|
|
msgstr "Nie ma dostępnego skanera"
|
|
|
|
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Moduł pascala powinien mieć rozszerzenie .pp lub .pas"
|
|
|
|
#: lazarusidestrconsts.lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr "Edycja wirtualnego modułu"
|
|
|
|
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr "%s%sNazwa pliku: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
|
msgid "The unitname is not a valid Pascal identifier."
|
|
msgstr "Nazwa nie jest prawidłowym identyfikatorem Pascala."
|
|
|
|
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr "Nazwa modułu i nazwa pliku nie odpowiadają sobie.%sPrzykład: unit1.pas i Unit1"
|
|
|
|
#: lazarusidestrconsts.lispwconvertproject
|
|
msgid "Convert &Delphi Project"
|
|
msgstr "Konwertuj projekt &Delphi"
|
|
|
|
#: lazarusidestrconsts.lispwnewproject
|
|
msgid "&New Project"
|
|
msgstr "&Nowy projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenproject
|
|
msgid "&Open Project"
|
|
msgstr "&Otwórz projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenrecentproject
|
|
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
|
msgid "Open &Recent Project"
|
|
msgstr "Otwórz ostatnio otwarty projekt"
|
|
|
|
#: lazarusidestrconsts.lispwviewexampleprojects
|
|
msgid "View &Example Projects"
|
|
msgstr "Pokaż przykładowe proj&ekty"
|
|
|
|
#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
|
|
msgid "Quick check Fppkg configuration at start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixerror
|
|
#, fuzzy
|
|
msgid "QuickFix error"
|
|
msgstr "BŁĄD:"
|
|
|
|
#: lazarusidestrconsts.lisquickfixes
|
|
msgid "Quick fixes"
|
|
msgstr "Szybkie poprawki"
|
|
|
|
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
|
msgid "Search identifier"
|
|
msgstr "Szukaj identyfikatora"
|
|
|
|
#: lazarusidestrconsts.lisquit
|
|
msgctxt "lazarusidestrconsts.lisquit"
|
|
msgid "Quit"
|
|
msgstr "Wyjdź"
|
|
|
|
#: lazarusidestrconsts.lisquitlazarus
|
|
msgid "&Quit Lazarus"
|
|
msgstr "&Wyjdź z Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lisreaderror
|
|
msgid "Read Error"
|
|
msgstr "Błąd odczytu"
|
|
|
|
#: lazarusidestrconsts.lisreallydelete
|
|
msgid "Really delete?"
|
|
msgstr "Na pewno usunąć?"
|
|
|
|
#: lazarusidestrconsts.lisrecenttabs
|
|
msgid "Recent tabs"
|
|
msgstr "Poprzednie zakładki"
|
|
|
|
#: lazarusidestrconsts.lisrecord
|
|
msgctxt "lazarusidestrconsts.lisrecord"
|
|
msgid "Record"
|
|
msgstr "Nagraj"
|
|
|
|
#: lazarusidestrconsts.lisrecordedmacros
|
|
msgid "Recorded"
|
|
msgstr "Nagrane"
|
|
|
|
#: lazarusidestrconsts.lisredo
|
|
msgctxt "lazarusidestrconsts.lisredo"
|
|
msgid "Redo"
|
|
msgstr "Przywróć"
|
|
|
|
#: lazarusidestrconsts.lisregularexpression
|
|
msgctxt "lazarusidestrconsts.lisregularexpression"
|
|
msgid "Regular expression"
|
|
msgstr "Wyrażenia regularne"
|
|
|
|
#: lazarusidestrconsts.lisrelative
|
|
msgid "Relative"
|
|
msgstr "Ścieżka względna"
|
|
|
|
#: lazarusidestrconsts.lisremove
|
|
msgctxt "lazarusidestrconsts.lisremove"
|
|
msgid "Remove"
|
|
msgstr "Usuń"
|
|
|
|
#: lazarusidestrconsts.lisremove2
|
|
msgid "Remove?"
|
|
msgstr "Usunąć?"
|
|
|
|
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Usuń wszystkie nieprawidłowe właściwości"
|
|
|
|
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
|
msgid "Remove all message type filters"
|
|
msgstr "Usuń wszystkie filtry komunikatów"
|
|
|
|
#: lazarusidestrconsts.lisremoveallunits
|
|
msgid "Remove all units"
|
|
msgstr "Usuń wszystkie moduły"
|
|
|
|
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
|
msgid "Remove Compiler Option Hide Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Remove %s dependencies from package \"%s\"?"
|
|
msgstr "Usunąć %s pliki z pakietu \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisremovedpropertys
|
|
#, object-pascal-format
|
|
msgid "Removed property \"%s\"."
|
|
msgstr "Usunięto właściwość \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisremovefilesfrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove %s files from package \"%s\"?"
|
|
msgstr "Usunąć %s pliki z pakietu \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisremovefromproject
|
|
msgid "Remove from Project"
|
|
msgstr "Usuń z projektu"
|
|
|
|
#: lazarusidestrconsts.lisremovefromsearchpath
|
|
msgid "Remove from search path"
|
|
msgstr "Usuń ze ścieżki wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lisremoveincludepath
|
|
msgid "Remove include path?"
|
|
msgstr "Usunąć ścieżkę dołączania?"
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable3
|
|
#, object-pascal-format
|
|
msgid "Remove local variable \"%s\""
|
|
msgstr "Usuń zmienną lokalną \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisremovemessagetypefilter
|
|
msgid "Remove Message Type Filter"
|
|
msgstr "Usuń filtry typu komunikatów"
|
|
|
|
#: lazarusidestrconsts.lisremovenonexistingfiles
|
|
msgid "Remove nonexistent files"
|
|
msgstr "Usuń nieistniejące pliki"
|
|
|
|
#: lazarusidestrconsts.lisremoveselectedunits
|
|
msgid "Remove selected units"
|
|
msgstr "Usuń wybrane moduły"
|
|
|
|
#: lazarusidestrconsts.lisremovethem
|
|
#, fuzzy
|
|
msgid "Remove them"
|
|
msgstr "Zachowaj i kontynuuj"
|
|
|
|
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
|
#, fuzzy
|
|
msgid "Remove the paths from \"Other sources\""
|
|
msgstr "Usuń niestniejące (szare) ścieżki z listy"
|
|
|
|
#: lazarusidestrconsts.lisremoveunitpath
|
|
msgid "Remove unit path?"
|
|
msgstr "Usunąć ścieżkę modułów?"
|
|
|
|
#: lazarusidestrconsts.lisremoveuses
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Remove uses \"%s\""
|
|
msgstr "Chcesz usunąć plik %s z projektu?"
|
|
|
|
#: lazarusidestrconsts.lisrename
|
|
msgctxt "lazarusidestrconsts.lisrename"
|
|
msgid "Rename"
|
|
msgstr "Zmień"
|
|
|
|
#: lazarusidestrconsts.lisrename2
|
|
msgid "Rename ..."
|
|
msgstr "Zmień ..."
|
|
|
|
#: lazarusidestrconsts.lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Chcesz zmienić nazwę pliku?"
|
|
|
|
#: lazarusidestrconsts.lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Nie można zmienić nazwy pliku"
|
|
|
|
#: lazarusidestrconsts.lisrenameshowresult
|
|
msgid "Show list of renamed Identifiers"
|
|
msgstr "Pokaż listę zmienionych identyfikatorów"
|
|
|
|
#: lazarusidestrconsts.lisrenameto
|
|
#, object-pascal-format
|
|
msgid "Rename to %s"
|
|
msgstr "Zmień nazwę na %s"
|
|
|
|
#: lazarusidestrconsts.lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr "Zamień na małe litery"
|
|
|
|
#: lazarusidestrconsts.lisreopenproject
|
|
msgid "Reopen project"
|
|
msgstr "Otwórz projekt ponownie"
|
|
|
|
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr "Otwórz z innym kodowaniem"
|
|
|
|
#: lazarusidestrconsts.lisrepeat
|
|
msgctxt "lazarusidestrconsts.lisrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Powtarzaj"
|
|
|
|
#: lazarusidestrconsts.lisreplace
|
|
msgctxt "lazarusidestrconsts.lisreplace"
|
|
msgid "Replace"
|
|
msgstr "Zamień"
|
|
|
|
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
|
#, object-pascal-format
|
|
msgid "Replaced property \"%s\" with \"%s\"."
|
|
msgstr "Zastąpiono właściwość \"%s\" przez \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisreplacedtypeswiths
|
|
#, object-pascal-format
|
|
msgid "Replaced type \"%s\" with \"%s\"."
|
|
msgstr "Zastąpiono typ \"%s\" przez \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisreplacement
|
|
msgid "Replacement"
|
|
msgstr "Zamiana"
|
|
|
|
#: lazarusidestrconsts.lisreplacementfuncs
|
|
msgid "Replacement functions"
|
|
msgstr "Funkcje zamiany"
|
|
|
|
#: lazarusidestrconsts.lisreplacements
|
|
msgid "Replacements"
|
|
msgstr "Zamiany"
|
|
|
|
#: lazarusidestrconsts.lisreplaceremoveunknown
|
|
#, fuzzy
|
|
msgid "Fix unknown properties and types"
|
|
msgstr "Nieznane właściwości"
|
|
|
|
#: lazarusidestrconsts.lisreplacewholeidentifier
|
|
msgid "Replace whole identifier"
|
|
msgstr "Zamieniaj cały identyfikator"
|
|
|
|
#: lazarusidestrconsts.lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr "Błąd podczas zamiany zaznaczenia."
|
|
|
|
#: lazarusidestrconsts.lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrescan
|
|
msgid "Rescan"
|
|
msgstr "Przeskanuj"
|
|
|
|
#: lazarusidestrconsts.lisreset
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisreset"
|
|
msgid "Reset"
|
|
msgstr "Zresetuj wszystkie define"
|
|
|
|
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
|
msgid "Reset all file filters to defaults?"
|
|
msgstr "Czy ustawić wszystkie filtry na domyślne?"
|
|
|
|
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
|
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
|
msgid "Resource name must be unique."
|
|
msgstr "Nazwa zasobu musi być unikalna."
|
|
|
|
#: lazarusidestrconsts.lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Nie można zapisać zasobów"
|
|
|
|
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
|
msgid "Resource type of project"
|
|
msgstr "Rodzaj zasobów projektu"
|
|
|
|
#: lazarusidestrconsts.lisrestart
|
|
msgctxt "lazarusidestrconsts.lisrestart"
|
|
msgid "Restart"
|
|
msgstr "Uruchom ponownie"
|
|
|
|
#: lazarusidestrconsts.lisresult2
|
|
msgid "Result:"
|
|
msgstr "Wynik:"
|
|
|
|
#: lazarusidestrconsts.lisreturnparameterindexedword
|
|
msgid ""
|
|
"Return parameter-indexed word from the current line preceding cursor position.\n"
|
|
"\n"
|
|
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
|
|
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
|
|
"is always the current macro.\n"
|
|
"\n"
|
|
"Example line:\n"
|
|
"i 0 count-1 forb|\n"
|
|
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
|
"\n"
|
|
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
|
msgid ""
|
|
"Return the list of all values of case variable in front of variable.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithoutExtraIndent // the case list will be generated without extra indentation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Przywrócenie nie udało się"
|
|
|
|
#: lazarusidestrconsts.lisrevision
|
|
msgid "Revision: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisright
|
|
msgctxt "lazarusidestrconsts.lisright"
|
|
msgid "Right"
|
|
msgstr "W prawo"
|
|
|
|
#: lazarusidestrconsts.lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Prawe umocowanie"
|
|
|
|
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr "Prawy odstęp obramowania. Ta wartość jest dodawana do podstawowego odstępu."
|
|
|
|
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrightsides
|
|
msgid "Right sides"
|
|
msgstr "Prawe strony"
|
|
|
|
#: lazarusidestrconsts.lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr "Rozmieść równomiernie prawe krawędzie"
|
|
|
|
#: lazarusidestrconsts.lisrun
|
|
msgctxt "lazarusidestrconsts.lisrun"
|
|
msgid "Run"
|
|
msgstr "Uruchom"
|
|
|
|
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
|
msgid "\"Run and Design time\" packages have no limitations."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunning
|
|
#, object-pascal-format
|
|
msgid "%s (running ...)"
|
|
msgstr "%s (uruchomiony ...)"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "Plik nie jest wykonywalny"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
|
#, object-pascal-format
|
|
msgid "The host application \"%s\" is not executable."
|
|
msgstr "Aplikacja hosta \"%s\" nie jest plikiem wykonywalnym."
|
|
|
|
#: lazarusidestrconsts.lisrunstage
|
|
msgctxt "lazarusidestrconsts.lisrunstage"
|
|
msgid "Run"
|
|
msgstr "Uruchom"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
|
msgid "Runtime only, cannot be installed in IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
|
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
|
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Idź-do nie zadziałało"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract Methods - not yet overridden"
|
|
msgstr "Metody abstrakcyjne - jeszcze nie przykryte"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsof
|
|
#, object-pascal-format
|
|
msgid "Abstract methods of %s"
|
|
msgstr "Metody abstrakcyjne %s"
|
|
|
|
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr "Kursor nie jest wewnątrz deklaracji klasy"
|
|
|
|
#: lazarusidestrconsts.lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr "IDE jest zajęte"
|
|
|
|
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
|
#, object-pascal-format
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr "Nie znaleziono metod abstrakcyjnych"
|
|
|
|
#: lazarusidestrconsts.lissamoverrideallselected
|
|
#, fuzzy
|
|
msgid "Override all selected"
|
|
msgstr "Następna komórka (wszystkie zaznaczone)"
|
|
|
|
#: lazarusidestrconsts.lissamoverridefirstselected
|
|
#, fuzzy
|
|
msgid "Override first selected"
|
|
msgstr "Nadpisz katalog wyjściowy (-FU)"
|
|
|
|
#: lazarusidestrconsts.lissamselectnone
|
|
msgid "Select none"
|
|
msgstr "Nic nie zaznaczaj"
|
|
|
|
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
#, object-pascal-format
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
|
#, fuzzy
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr "Pokaż metody abstrakcyjne"
|
|
|
|
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissave
|
|
msgctxt "lazarusidestrconsts.lissave"
|
|
msgid "Save"
|
|
msgstr "Zapisz"
|
|
|
|
#: lazarusidestrconsts.lissaveall
|
|
msgctxt "lazarusidestrconsts.lissaveall"
|
|
msgid "Save All"
|
|
msgstr "Zapisz wszystko"
|
|
|
|
#: lazarusidestrconsts.lissaveallchecked
|
|
msgid "Save All Checked"
|
|
msgstr "Zapisz zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lissaveallmodified
|
|
msgid "Save all modified files"
|
|
msgstr "Zapisz wszystkie zmienione pliki"
|
|
|
|
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
|
msgid "Save All/Original Messages to File ..."
|
|
msgstr "Zapiszj wszystkie/oryginalne komunikaty do pliku ..."
|
|
|
|
#: lazarusidestrconsts.lissaveandexitdialog
|
|
msgid "Save and exit dialog"
|
|
msgstr "Zapisz i zamknij okno"
|
|
|
|
#: lazarusidestrconsts.lissaveandrebuildide
|
|
msgid "Save and rebuild IDE"
|
|
msgstr "Zapisz i przebuduj IDE"
|
|
|
|
#: lazarusidestrconsts.lissavechangedfiles
|
|
msgid "Save changed files?"
|
|
msgstr "Zapisać zmienione pliki?"
|
|
|
|
#: lazarusidestrconsts.lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Chcesz zapisać zmiany?"
|
|
|
|
#: lazarusidestrconsts.lissavechangestoproject
|
|
#, object-pascal-format
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Chcesz zapisać zmiany w projekcie %s?"
|
|
|
|
#: lazarusidestrconsts.lissavecurrenteditorfile
|
|
msgid "Save current editor file"
|
|
msgstr "Zapisz edytowany plik"
|
|
|
|
#: lazarusidestrconsts.lissavedwithidesettings
|
|
msgid "Saved with IDE settings"
|
|
msgstr "Zapisane wraz z ustawieniami IDE"
|
|
|
|
#: lazarusidestrconsts.lissavedwithprojectsession
|
|
msgid "Saved with project session"
|
|
msgstr "Zapisane wraz z sesją projektu"
|
|
|
|
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
|
#, object-pascal-format
|
|
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
|
msgstr "Czy zapisać plik \"%s\"%sprzed zamknięciem formularza \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lissavemacroas
|
|
msgid "Save macro as"
|
|
msgstr "Zapisz makro jako"
|
|
|
|
#: lazarusidestrconsts.lissavemessages
|
|
msgid "Save messages"
|
|
msgstr "Zapisz komunikaty"
|
|
|
|
#: lazarusidestrconsts.lissaveproject
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Save project %s (*%s)"
|
|
msgstr "Chcesz zapisać zmiany w projekcie %s?"
|
|
|
|
#: lazarusidestrconsts.lissavesessionchangestoproject
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Save session changes to project %s?"
|
|
msgstr "Chcesz zapisać zmiany w projekcie %s?"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstate
|
|
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
|
|
msgid "Save fold info"
|
|
msgstr "Zapisuj informację o zwijaniu"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
|
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
|
msgstr "Edytor kodu umożliwia zwijanie (tymczasowe ukrywanie) bloków kodu."
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistory
|
|
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
|
|
msgid "Save jump history"
|
|
msgstr "Zapisz historię skoków"
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
|
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Zapisz ustawienia"
|
|
|
|
#: lazarusidestrconsts.lissaveshownmessagestofile
|
|
msgid "Save Shown Messages to File ..."
|
|
msgstr "Zapisz wyświetlone komunikaty do pliku..."
|
|
|
|
#: lazarusidestrconsts.lissavespace
|
|
msgid "Save "
|
|
msgstr "Zapisz "
|
|
|
|
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
|
#, object-pascal-format
|
|
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr "Współczynnik skalowania:"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdir
|
|
msgid "Scan files in parent directory"
|
|
msgstr "Skanuj katalog nadrzędny"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
|
msgid "Search for source files in sibling directories (parent directory and its children)"
|
|
msgstr "Poszukuj plików źródłowych w katalogach równorzędnych (katalogu nadrzędnym i jego podkatalogach)"
|
|
|
|
#: lazarusidestrconsts.lisscanning
|
|
msgid "Scanning"
|
|
msgstr "Skanowanie"
|
|
|
|
#: lazarusidestrconsts.lisscanning2
|
|
#, object-pascal-format
|
|
msgid "%s. Scanning ..."
|
|
msgstr "%s. Skanowanie ..."
|
|
|
|
#: lazarusidestrconsts.lisscanparentdir
|
|
msgid "Scanning parent directory"
|
|
msgstr "Skanuj katalog nadrzędny"
|
|
|
|
#: lazarusidestrconsts.lissearchpaths2
|
|
msgid "Search paths"
|
|
msgstr "Ścieżki wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.lissearchunit
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Search Unit \"%s\""
|
|
msgstr "Ścieżka poszukiwania modułów"
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
|
msgid "secondary config directory where Lazarus searches for config template files. Default is "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigpath
|
|
msgid "Secondary config path"
|
|
msgstr "Drugoplanowa ścieżka konfiguracji"
|
|
|
|
#: lazarusidestrconsts.lissecondtest
|
|
msgid "&Second test"
|
|
msgstr "Drugi te&st"
|
|
|
|
#: lazarusidestrconsts.lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Zobacz komunikaty."
|
|
|
|
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
|
#, object-pascal-format, fuzzy
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr "Inspektor projektu - %s"
|
|
|
|
#: lazarusidestrconsts.lisselectahelpitem
|
|
#, fuzzy
|
|
msgid "Select a help item:"
|
|
msgstr "Najpierw wybierz element."
|
|
|
|
#: lazarusidestrconsts.lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Wybierz węzeł"
|
|
|
|
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
|
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
|
msgstr "Wybierz inny zestaw kontrolek LCL (makro LCLWidgetType)"
|
|
|
|
#: lazarusidestrconsts.lisselectdfmfiles
|
|
msgid "Select Delphi form files (*.dfm)"
|
|
msgstr "Wybierz formularze Delphi (*.dfm)"
|
|
|
|
#: lazarusidestrconsts.lisselected
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisselected"
|
|
msgid "Selected"
|
|
msgstr "Zaznaczony obszar"
|
|
|
|
#: lazarusidestrconsts.lisselectedaddition
|
|
msgid "Selected addition:"
|
|
msgstr "Zaznaczony dodatek:"
|
|
|
|
#: lazarusidestrconsts.lisselectedandchildcontrols
|
|
msgid "Selected and child controls"
|
|
msgstr "Wybrane i potomne kontrolki"
|
|
|
|
#: lazarusidestrconsts.lisselectedbottomneighbour
|
|
msgid "(selected bottom neighbour)"
|
|
msgstr "(zaznaczony sąsiad z dołu)"
|
|
|
|
#: lazarusidestrconsts.lisselectedcommandsmapping
|
|
#, fuzzy
|
|
msgid "Selected Command's Mapping"
|
|
msgstr "Błędne klawisze skrótu"
|
|
|
|
#: lazarusidestrconsts.lisselectedforinstallation
|
|
msgid "selected for installation"
|
|
msgstr "zaznaczone do zainstalowania"
|
|
|
|
#: lazarusidestrconsts.lisselectedforuninstallation
|
|
msgid "selected for uninstallation"
|
|
msgstr "zaznaczone do odinstalowania"
|
|
|
|
#: lazarusidestrconsts.lisselectedleftneighbour
|
|
msgid "(selected left neighbour)"
|
|
msgstr "(zaznaczony sąsiad z lewej)"
|
|
|
|
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
|
#, fuzzy
|
|
msgid "Selected message in messages window:"
|
|
msgstr "Kopiuj wybrane komunikaty do schowka"
|
|
|
|
#: lazarusidestrconsts.lisselectedmodeswerecompiled
|
|
#, object-pascal-format
|
|
msgid "Selected %d modes were successfully compiled."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedrightneighbour
|
|
msgid "(selected right neighbour)"
|
|
msgstr "(zaznaczony sąsiad z prawej)"
|
|
|
|
#: lazarusidestrconsts.lisselectedtopneighbour
|
|
msgid "(selected top neighbour)"
|
|
msgstr "(zaznaczony sąsiad z góry)"
|
|
|
|
#: lazarusidestrconsts.lisselectfile
|
|
msgid "Select the file"
|
|
msgstr "Wybierz plik"
|
|
|
|
#: lazarusidestrconsts.lisselectfpcpath
|
|
msgid "Select the path where FPC is installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
|
msgid "Select FPC source directory"
|
|
msgstr "Wybierz katalog źródeł FPC"
|
|
|
|
#: lazarusidestrconsts.lisselectframe
|
|
#, fuzzy
|
|
msgid "Select Frame"
|
|
msgstr "Brak obramowania"
|
|
|
|
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Zaznaczenie przekracza stałą łańcuchową"
|
|
|
|
#: lazarusidestrconsts.lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Narzędzie zaznaczania"
|
|
|
|
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
|
msgid "Select Lazarus source directory"
|
|
msgstr "Wybierz katalog źródeł Lazarusa"
|
|
|
|
#: lazarusidestrconsts.lisselectpathto
|
|
#, object-pascal-format
|
|
msgid "Select path to %s"
|
|
msgstr "Zaznacz ścieżkę do %s"
|
|
|
|
#: lazarusidestrconsts.lisselecttargetdirectory
|
|
msgid "Select target directory"
|
|
msgstr "Wybierz katalog docelowy"
|
|
|
|
#: lazarusidestrconsts.lissetallcolors
|
|
msgid "Set all colors:"
|
|
msgstr "Ustaw wszystkie kolory:"
|
|
|
|
#: lazarusidestrconsts.lissetdefault
|
|
msgid "Set default"
|
|
msgstr "Ustaw domyślne"
|
|
|
|
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
|
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetupdefaultindentation
|
|
msgid "(Set up default indentation)"
|
|
msgstr "(Ustaw domyślne wcięcia)"
|
|
|
|
#: lazarusidestrconsts.lisshort
|
|
#, fuzzy
|
|
msgid "Short:"
|
|
msgstr "Wybierz skrót klawiszowy"
|
|
|
|
#: lazarusidestrconsts.lisshortnopath
|
|
msgid "Short, no path"
|
|
msgstr "Krótko, bez ścieżki"
|
|
|
|
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
|
#, object-pascal-format
|
|
msgid "Should the component \"%s\" be auto created when the application starts?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshow
|
|
msgid "Show"
|
|
msgstr "Pokaż"
|
|
|
|
#: lazarusidestrconsts.lisshowabstractmethodsof
|
|
#, object-pascal-format
|
|
msgid "Show abstract methods of \"%s\""
|
|
msgstr "Pokaż metody abstrakcyjne \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
|
msgid "Show component tree"
|
|
msgstr "Pokaż drzewo komponentów"
|
|
|
|
#: lazarusidestrconsts.lisshowconsole
|
|
msgid "Show console"
|
|
msgstr "Pokaż konsolę"
|
|
|
|
#: lazarusidestrconsts.lisshowdeclarationhints
|
|
msgid "Show declaration hints"
|
|
msgstr "Pokaż podpowiedzi deklaracji"
|
|
|
|
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
|
msgid "Show differences between modes ..."
|
|
msgstr "Pokaż różnice między trybami ..."
|
|
|
|
#: lazarusidestrconsts.lisshowemptyunitspackages
|
|
msgid "Show empty units/packages"
|
|
msgstr "Pokaż puste moduły/pakiety"
|
|
|
|
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
|
msgid "Show FPC message \"lines compiled\""
|
|
msgstr "Pokaż komunikat FPC \"lines compiled\""
|
|
|
|
#: lazarusidestrconsts.lisshowglyphsfor
|
|
msgid "Show Glyphs for"
|
|
msgstr "Pokaż glify dla"
|
|
|
|
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
|
msgid "Show gutter"
|
|
msgstr "Pokaż margines ikon"
|
|
|
|
#: lazarusidestrconsts.lisshowhelp
|
|
msgid "Show help"
|
|
msgstr "Pokaż pomoc"
|
|
|
|
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
|
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
|
msgid "Show hints"
|
|
msgstr "Pokaż wskazówki"
|
|
|
|
#: lazarusidestrconsts.lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr "Pokaż identyfikatory"
|
|
|
|
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
|
msgid "Show information box"
|
|
msgstr "Pokaż pole z informacją"
|
|
|
|
#: lazarusidestrconsts.lisshowmessagetypeid
|
|
#, fuzzy
|
|
msgid "Show Message Type ID"
|
|
msgstr "Pokaż komunikat przy zatrzymaniu"
|
|
|
|
#: lazarusidestrconsts.lisshowmultiplelines
|
|
#, fuzzy
|
|
msgid "Show multiple lines"
|
|
msgstr "Pokaż linie naprowadzające"
|
|
|
|
#: lazarusidestrconsts.lisshowonlymodified
|
|
msgid "Show only modified"
|
|
msgstr "Pokaż tylko zmienione"
|
|
|
|
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
|
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoutput
|
|
msgid "Show output"
|
|
msgstr "Pokaż wyjście"
|
|
|
|
#: lazarusidestrconsts.lisshowoverviewgutter
|
|
msgid "Show overview gutter"
|
|
msgstr "Pokaż pasek przeglądu"
|
|
|
|
#: lazarusidestrconsts.lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Pokaż pakiety"
|
|
|
|
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
|
msgid "Show position of source editor"
|
|
msgstr "Pokaż pozycję w edytorze źródeł"
|
|
|
|
#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
|
|
msgid "Show property filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
|
msgid "Show recently used identifiers at top"
|
|
msgstr "Ostatnio użyte identyfikatory pokaż na górze"
|
|
|
|
#: lazarusidestrconsts.lisshowrelativepaths
|
|
msgid "Show relative paths"
|
|
msgstr "Pokaż ścieżki względne"
|
|
|
|
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
|
msgid "Shows all controls in tree hierarchy."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
|
msgid "A box at the bottom shows description for the selected property."
|
|
msgstr "Ramka poniżej pokaże opis wybranej właściwości."
|
|
|
|
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
|
msgid "Show setup dialog for most important settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr "Pokaż znaki specjalne"
|
|
|
|
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
|
msgid "Show statusbar"
|
|
msgstr "Pokaż pasek stanu"
|
|
|
|
#: lazarusidestrconsts.lisshowunits
|
|
msgid "Show units"
|
|
msgstr "Pokaż moduły"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitialization
|
|
msgid "Show units with initialization/finalization sections"
|
|
msgstr "Pokaż moduły z sekcjami initialization/finalization"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
|
msgid "These units may initialize global data used by the program/application. Remove with care."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunusedunits
|
|
msgid "Show unused units ..."
|
|
msgstr "Pokaż nieużywane moduły..."
|
|
|
|
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
|
msgid "Show value hints while debugging"
|
|
msgstr "Pokaż podpowiedzi wartości podczas odpluskiwania"
|
|
|
|
#: lazarusidestrconsts.lisshowversionandexit
|
|
msgid "show version and exit"
|
|
msgstr "pokaż wersję i wyjdź"
|
|
|
|
#: lazarusidestrconsts.lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr "Pomniejsz do najmniejszego"
|
|
|
|
#: lazarusidestrconsts.lissibling
|
|
msgid "Sibling"
|
|
msgstr "Równorzędny"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogram
|
|
msgid "Simple Program"
|
|
msgstr "Prosty program"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
|
msgid "A most simple Free Pascal command line program."
|
|
msgstr "Najprostszy program w konsoli."
|
|
|
|
#: lazarusidestrconsts.lissimplesyntax
|
|
msgid "Simple syntax"
|
|
msgstr "Prosta składnia"
|
|
|
|
#: lazarusidestrconsts.lisskiperrors
|
|
msgid "Skip errors"
|
|
msgstr "Pomiń błędy"
|
|
|
|
#: lazarusidestrconsts.lisskipfile
|
|
msgid "Skip file"
|
|
msgstr "Pomiń plik"
|
|
|
|
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr "Pomiń plik i kontynuuj wczytywanie"
|
|
|
|
#: lazarusidestrconsts.lisskiploadinglastproject
|
|
msgid "Skip loading last project"
|
|
msgstr "Pomiń wczytywanie ostatniego projektu"
|
|
|
|
#: lazarusidestrconsts.lisskipstartupchecks
|
|
msgid "Skip selected checks at startup."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskipthesewarnings
|
|
msgid "Skip these warnings"
|
|
msgstr "Pomiń te ostrzeżenia"
|
|
|
|
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
|
msgid "Slower but more accurate."
|
|
msgstr "Wolniejsze, ale dokładne."
|
|
|
|
#: lazarusidestrconsts.lissmallerratherthanfaster
|
|
msgid "Smaller rather than faster"
|
|
msgstr "Mniejszy niż szybszy"
|
|
|
|
#: lazarusidestrconsts.lissmatches
|
|
msgid "Matches"
|
|
msgstr "Odpowiedniki"
|
|
|
|
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Przykro mi, ten typ jeszcze nie jest obsługiwany"
|
|
|
|
#: lazarusidestrconsts.lissorting
|
|
msgid "Sorting"
|
|
msgstr "Sortowanie"
|
|
|
|
#: lazarusidestrconsts.lissortorderalphabetic
|
|
msgid "Alphabetic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortorderdefinition
|
|
msgid "Definition (Scoped)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortorderscopedalphabetic
|
|
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
|
|
msgid "Alphabetic (Scoped)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortordertitle
|
|
msgid "Order by"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Rosnąco"
|
|
|
|
#: lazarusidestrconsts.lissortselcasesensitive
|
|
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr "&Uwzględnij wielkość liter"
|
|
|
|
#: lazarusidestrconsts.lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Malejąco"
|
|
|
|
#: lazarusidestrconsts.lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Domena"
|
|
|
|
#: lazarusidestrconsts.lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Ignoruj odstępy"
|
|
|
|
#: lazarusidestrconsts.lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Wiersza"
|
|
|
|
#: lazarusidestrconsts.lissortseloptions
|
|
msgctxt "lazarusidestrconsts.lissortseloptions"
|
|
msgid "Options"
|
|
msgstr "Opcje"
|
|
|
|
#: lazarusidestrconsts.lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Akapity"
|
|
|
|
#: lazarusidestrconsts.lissortselpreview
|
|
msgctxt "lazarusidestrconsts.lissortselpreview"
|
|
msgid "Preview"
|
|
msgstr "Podgląd"
|
|
|
|
#: lazarusidestrconsts.lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Zatwierdź"
|
|
|
|
#: lazarusidestrconsts.lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Wybierz sortowanie"
|
|
|
|
#: lazarusidestrconsts.lissortselwords
|
|
msgctxt "lazarusidestrconsts.lissortselwords"
|
|
msgid "Words"
|
|
msgstr "Wielkość liter"
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationaresame
|
|
#, object-pascal-format
|
|
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
|
#, object-pascal-format
|
|
msgid "Source and Destination are the same:%s%s"
|
|
msgstr "Źródło i cel są jednakowe:%s%s"
|
|
|
|
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
|
#, object-pascal-format
|
|
msgid "Source directory \"%s\" does not exist."
|
|
msgstr "Katalog źródłowy \"%s\" nie istnieje."
|
|
|
|
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
|
msgid "Source Editor Window Manager"
|
|
msgstr "Zarządzanie oknami kodu źródłowego"
|
|
|
|
#: lazarusidestrconsts.lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Źródło zmienione"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
|
#, object-pascal-format
|
|
msgid "Source of page \"%s\" has changed. Save?"
|
|
msgstr "Źródło zakładki \"%s\" zostało zmienione. Czy chcesz je zapisać?"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
|
#, object-pascal-format
|
|
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Ścieżki do źródeł"
|
|
|
|
#: lazarusidestrconsts.lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Rozmieść równomiernie"
|
|
|
|
#: lazarusidestrconsts.lissrcos
|
|
#, fuzzy
|
|
msgid "Src OS"
|
|
msgstr "ścieżka źródłowa dla kompilowanych modułów"
|
|
|
|
#: lazarusidestrconsts.lisssearching
|
|
msgid "Searching"
|
|
msgstr "Wyszukiwanie"
|
|
|
|
#: lazarusidestrconsts.lisssearchtext
|
|
msgid "Search text"
|
|
msgstr "Szukany tekst"
|
|
|
|
#: lazarusidestrconsts.lisstartconversion
|
|
msgid "Start Conversion"
|
|
msgstr "Rozpocznij konwersję"
|
|
|
|
#: lazarusidestrconsts.lisstartide
|
|
msgid "Start IDE"
|
|
msgstr "Uruchom IDE"
|
|
|
|
#: lazarusidestrconsts.lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr "Uruchom z nowym projektem"
|
|
|
|
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
|
msgid "Statusbar shows the property's name and the class where it is published."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstop
|
|
msgctxt "lazarusidestrconsts.lisstop"
|
|
msgid "Stop"
|
|
msgstr "Zatrzymaj"
|
|
|
|
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Zatrzymać odpluskwianie i przebudować projekt?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Zatrzymać odpluskiwanie?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Zatrzymać odpluskiwanie?"
|
|
|
|
#: lazarusidestrconsts.lisstoponexception
|
|
msgid "Stop on exception"
|
|
msgstr "Zatrzymaj przy wyjątku"
|
|
|
|
#: lazarusidestrconsts.lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Zatrzymać odpluskiwanie?"
|
|
|
|
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
|
msgid "Store path delimiters \\ and / as"
|
|
msgstr "Zapamiętaj separatory ścieżek \\ oraz / jako"
|
|
|
|
#: lazarusidestrconsts.lisstrangelpifile
|
|
msgid "Strange lpi file"
|
|
msgstr "Dziwny plik lpi"
|
|
|
|
#: lazarusidestrconsts.lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Błąd strumienia"
|
|
|
|
#: lazarusidestrconsts.lissubprocedure
|
|
#, fuzzy
|
|
msgid "Sub Procedure"
|
|
msgstr "Podkatalog"
|
|
|
|
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccess
|
|
msgid "Success"
|
|
msgstr "Zakończony powodzeniem"
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexported
|
|
#, object-pascal-format
|
|
msgid "Successfully exported to \"%s\"."
|
|
msgstr "Wyeksportowano z powodzeniem do \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
|
#, object-pascal-format
|
|
msgid "Successfully exported %d BuildModes to \"%s\"."
|
|
msgstr "Wyeksportowano z powodzeniem %d Tryby budowania do \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
|
#, object-pascal-format
|
|
msgid "Successfully exported compiler options to \"%s\"."
|
|
msgstr "Wyeksportowano z powodzeniem opcje kompilatora do \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimported
|
|
#, object-pascal-format
|
|
msgid "Successfully imported from \"%s\"."
|
|
msgstr "Zaimportowano z powodzeniem z \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
|
#, object-pascal-format
|
|
msgid "Successfully imported %d BuildModes from \"%s\"."
|
|
msgstr "Zaimportowano z powodzeniem %d Tryby budowania z \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
|
#, object-pascal-format
|
|
msgid "Successfully imported compiler options from \"%s\"."
|
|
msgstr "Zaimportowano z powodzeniem opcje kompilatora do \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
|
msgid "Suggest default name of new file in lowercase"
|
|
msgstr "Sugeruj domyślną nazwę pliku małymi literami"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousincludepath
|
|
msgid "Suspicious include path"
|
|
msgstr "Podejrzana ścieżka dołączanych plików"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousunitpath
|
|
msgid "Suspicious unit path"
|
|
msgstr "Podejrzana ścieżka do folderu modułów"
|
|
|
|
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Błędna nazwa zmiennej"
|
|
|
|
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is not a valid identifier."
|
|
msgstr "\"%s\" nie jest prawidłowym identyfikatorem."
|
|
|
|
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Przedefiniuj zmienną systemową"
|
|
|
|
#: lazarusidestrconsts.lisswitchfiltersettings
|
|
msgid "Switch Filter Settings"
|
|
msgstr "Zmień ustawienia filtrowania"
|
|
|
|
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
|
msgid "Switch to Favorites tab after asking for component name."
|
|
msgstr "Przełącz na zakładkę Ulubione po zapytaniu o nazwę komponentu."
|
|
|
|
#: lazarusidestrconsts.lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr "Tryb składni"
|
|
|
|
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
|
msgid "system.ppu not found. Check your fpc.cfg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listab
|
|
msgid "Tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts.listaborderconfirmsort
|
|
#, object-pascal-format
|
|
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderdownhint
|
|
msgid "Move the selected control down in tab order"
|
|
msgstr "Przesuń zaznaczoną kontrolkę w dół w kolejności tabulatora"
|
|
|
|
#: lazarusidestrconsts.listaborderof
|
|
#, object-pascal-format
|
|
msgid "Tab Order of %s"
|
|
msgstr "Kolejność kontrolek dla %s"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursionhint
|
|
msgid "Calculate tab order recursively for child controls"
|
|
msgstr "Rekurencyjne wyliczanie kolejności potomków"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursively
|
|
msgid "recursively"
|
|
msgstr "rekurencyjnie"
|
|
|
|
#: lazarusidestrconsts.listabordersorthint
|
|
msgid "Calculate tab order for controls by their X- and Y- positions"
|
|
msgstr "Wylicz kolejność tabulatora na podstawie pozycji X- i Y- kontrolek"
|
|
|
|
#: lazarusidestrconsts.listaborderuphint
|
|
msgid "Move the selected control up in tab order"
|
|
msgstr "Przesuń zaznaczoną kontrolkę w górę w kolejności tabulatora"
|
|
|
|
#: lazarusidestrconsts.listabsfor
|
|
#, object-pascal-format
|
|
msgid "Tabs for %s"
|
|
msgstr "Zakładki należące do %s"
|
|
|
|
#: lazarusidestrconsts.listarget
|
|
msgid "Target:"
|
|
msgstr "Obiekt docelowy:"
|
|
|
|
#: lazarusidestrconsts.listarget2
|
|
#, object-pascal-format
|
|
msgid ", Target: %s"
|
|
msgstr ", Obiekt docelowy: %s"
|
|
|
|
#: lazarusidestrconsts.listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Docelowy procesor"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
|
msgid "Target file name: (-o, empty = use unit output directory)"
|
|
msgstr "Lokalizacja pliku wynikowego: (-o, gdy pusto przyjmij katalog wyjściowy modułów)Lokalizacja pliku wynikowego: (-o, gdy pusto przyjmij katalog wyjściowy modułów)"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameo
|
|
msgid "Target file name (-o):"
|
|
msgstr "Docelowa nazwa pliku (-o):"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Docelowa nazwa projektu"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr "Docelowa nazwa pliku + parametry"
|
|
|
|
#: lazarusidestrconsts.listargetisreadonly
|
|
msgid "Target is read only"
|
|
msgstr "Cel jest tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.listargetos
|
|
msgctxt "lazarusidestrconsts.listargetos"
|
|
msgid "Target OS"
|
|
msgstr "Docelowy system operacyjny"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcell
|
|
msgid "Editable Cell"
|
|
msgstr "Komórka edytowalna"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
|
#, object-pascal-format
|
|
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplatefile
|
|
msgid "Template file"
|
|
msgstr "Plik szablonu"
|
|
|
|
#: lazarusidestrconsts.listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Katalog testowy"
|
|
|
|
#: lazarusidestrconsts.listesturl
|
|
msgid "Test URL"
|
|
msgstr "Testowy URL"
|
|
|
|
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The Application Bundle was created for \"%s\""
|
|
msgstr "Użyj Zestawu Aplikacji do uruchomienia i odpluskiwania"
|
|
|
|
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
#, object-pascal-format
|
|
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
|
#, object-pascal-format, fuzzy
|
|
msgid "The Codetools found an error:%s%s"
|
|
msgstr "zamiast %s znaleziono %s"
|
|
|
|
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
#, object-pascal-format
|
|
msgid "The component %s can not be deleted because it is not owned by %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
#, object-pascal-format
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
|
#, object-pascal-format
|
|
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
|
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
|
#, fuzzy
|
|
msgid "The configuration will be downgraded/converted."
|
|
msgstr "Test: Sprawdzanie konfiguracji kompilatora..."
|
|
|
|
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The %s contains a nonexistent directory:%s%s"
|
|
msgstr "%s katalog projektu,%sktóry zawiera plik .dpr, dpk."
|
|
|
|
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
|
#, object-pascal-format
|
|
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
|
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
#, object-pascal-format
|
|
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
|
msgid "The default mode must be stored in project, not in session."
|
|
msgstr "Tryb domyślny musi być zachowany w projekcie, nie w sesji."
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
|
#, object-pascal-format
|
|
msgid "The destination directory%s\"%s\" does not exist."
|
|
msgstr "Katalog docelowy%s\"%s\" nie istnieje."
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" is not writable."
|
|
msgstr "Brak prawa zapisu w katalogu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listhefile
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\""
|
|
msgstr "Plik \"%s\""
|
|
|
|
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The file %s does not look like a lpi file."
|
|
msgstr "Plik \"%s\"%snie wygląda na tekstowy.%sChcesz otworzyć go pomimo tego?"
|
|
|
|
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
|
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisinvalid
|
|
#, object-pascal-format, fuzzy
|
|
msgid "The file mask \"%s\" is invalid."
|
|
msgstr "niepoprawne pliki lpk (%s)"
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
|
#, object-pascal-format
|
|
msgid "The file mask \"%s\" is not a valid regular expression."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
#, object-pascal-format
|
|
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
|
msgstr "Nie znaleziono pliku \"%s\".%sCzy chcesz zlokalizować go samemu ?"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "Nie znaleziono pliku \"%s\".%sWciśnij Ignoruj aby dalej ładować projekt,%sPorzuć zatrzyma ładowanie."
|
|
|
|
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
#, object-pascal-format
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
|
#, object-pascal-format
|
|
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheideisstillbuilding
|
|
msgid "The IDE is still building."
|
|
msgstr "Nadal trwa budowanie IDE."
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
|
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
#, object-pascal-format
|
|
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
|
#, object-pascal-format
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
#, object-pascal-format
|
|
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
|
msgstr "Program ładujący \"%s\"%snie istnieje lub nie jest plikiem wykonywalnym.%sZobacz Uruchom -> Uruchom z parametrami -> Lokalne"
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
|
#, object-pascal-format
|
|
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelazarussourcesuse
|
|
#, object-pascal-format
|
|
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
|
msgstr "Plik LFM (formularz Lazarusa) zawiera nieprawidłowe właściwości, np. może zawierać pewne właściwości lub klasy, których nie ma obecnie w LCL. Zwyczajowo naprawia się to przez usunięcie tych właściwości z LFM i ręczne poprawienie kodu w pascalu."
|
|
|
|
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The macro \"%s\" does not begin with \"%s\"."
|
|
msgstr "Właściwość %s nie istnieje"
|
|
|
|
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
|
#, object-pascal-format
|
|
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
|
#, object-pascal-format
|
|
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
#, object-pascal-format
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
|
#, fuzzy
|
|
msgid "The old configuration will be upgraded."
|
|
msgstr "Test: Sprawdzanie konfiguracji kompilatora..."
|
|
|
|
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
|
#, object-pascal-format
|
|
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
|
#, object-pascal-format
|
|
msgid "The output directory \"%s\" is missing."
|
|
msgstr "Brak katalogu wyjściowego \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheownerclasshasthisname
|
|
msgid "The owner class has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheownerhasthisname
|
|
msgid "The owner has this name"
|
|
msgstr "Właściciel ma tę nazwę"
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
|
#, object-pascal-format
|
|
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
|
#, object-pascal-format
|
|
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr "Pakiet zawiera już moduł o tej samej nazwie."
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
|
#, object-pascal-format
|
|
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
|
#, object-pascal-format
|
|
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
|
#, object-pascal-format
|
|
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
|
#, object-pascal-format
|
|
msgid "The package %s is already in the list"
|
|
msgstr "Pakiet %s jest już na liście"
|
|
|
|
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
|
#, object-pascal-format
|
|
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageisusedby
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is used by"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
|
#, object-pascal-format
|
|
msgid "The path of \"make\" is not correct: \"%s\""
|
|
msgstr "Ścieżka do \"make\" nie jest poprawna: \"%s\""
|
|
|
|
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
#, object-pascal-format
|
|
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
|
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
|
|
msgid "Running your application with debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
|
|
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
|
|
msgid "Run with no debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
|
|
#, object-pascal-format
|
|
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
|
|
msgid "Choose Debug Information format"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
|
#, object-pascal-format
|
|
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
|
|
#, object-pascal-format
|
|
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
|
msgid "The project has no main source file."
|
|
msgstr "Projekt nie ma głównego pliku źródłowego."
|
|
|
|
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
|
#, object-pascal-format
|
|
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
|
msgstr "Plik z informacją o projekcie \"%s\"%s jest taki sam jak główne źródło projektu!"
|
|
|
|
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
|
#, object-pascal-format
|
|
msgid "The project information file \"%s\"%shas changed on disk."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
#, object-pascal-format
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Projekt musi być zapisany przed budowaniem%sJeśli zmienisz \"katalog testowy\" w ustawieniach środowiska,%sbędziesz mógł budować projekty zaraz po utworzeniu.%sChcesz zapisać projekt?"
|
|
|
|
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
|
|
msgid "The project uses FPC resources which require at least FPC 2.4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
|
#, object-pascal-format
|
|
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
|
#, object-pascal-format
|
|
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
|
|
#, object-pascal-format
|
|
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
|
#, object-pascal-format
|
|
msgid "%sThere are additional notes for this message on%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherearenoconflictingkeys
|
|
msgid "There are no conflicting keys."
|
|
msgstr "Nie ma konfliktu klawiszy."
|
|
|
|
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
|
#, object-pascal-format
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "W katalogu są inne pliki o tej nazwie,%sktóre różnią się tylko wielkością liter:%s%s%sChcesz je usunąć?"
|
|
|
|
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
|
#, object-pascal-format
|
|
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
|
msgstr "Istnieje plik z taką samą nazwą i podobnym rozszerzeniem na dysku%sPlik: %s%sNiejednoznaczny plik: %s%sCzy chcesz usunąć niejednoznaczny plik?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
|
msgid "There is already a build mode with this name."
|
|
msgstr "Trybu budowania o tej nazwie już jest."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
|
#, object-pascal-format, fuzzy
|
|
msgid "There is already a component class with the name %s."
|
|
msgstr "Klasa komponentu \"%s\" już została zdefiniowana"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
|
msgid "There is already a component with this name"
|
|
msgstr "Komponent o tej nazwie już istnieje"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafilein
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "There is already a file%s%s%sin %s"
|
|
msgstr "Plik \"%s\"%sjuż jest w pakiecie %s."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
|
#, object-pascal-format
|
|
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
|
#, object-pascal-format
|
|
msgid "There is already a form with the name \"%s\""
|
|
msgstr "Formularz o nazwie \"%s\" już istnieje"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
|
#, object-pascal-format
|
|
msgid "There is already a macro with the name \"%s\"."
|
|
msgstr "Makro o nazwie \"%s\" już istnieje."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
|
#, object-pascal-format
|
|
msgid "There is already an IDE macro with the name \"%s\""
|
|
msgstr "Makro IDE o nazwie \"%s\" już istnieje."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
|
#, object-pascal-format
|
|
msgid "There is already a package %s in the list"
|
|
msgstr "Pakiet %s jest już na liście"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
|
#, object-pascal-format
|
|
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
#, object-pascal-format
|
|
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
|
#, object-pascal-format
|
|
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
|
msgstr "Moduł o nazwie \"%s\" jest już w projekcie.%sProszę wybrać inną nazwę"
|
|
|
|
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
|
#, object-pascal-format
|
|
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
|
|
#, object-pascal-format
|
|
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
|
msgid "There must be at least one build mode."
|
|
msgstr "Musi być przynajmniej jeden tryb budowania."
|
|
|
|
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
|
#, object-pascal-format
|
|
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
|
#, object-pascal-format
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
#, object-pascal-format
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
#, object-pascal-format
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
|
msgid "The root component cannot be deleted."
|
|
msgstr "Nie można usunąć głównego komponentu."
|
|
|
|
#: lazarusidestrconsts.listhesefileswillbedeleted
|
|
msgid "These files will be deleted"
|
|
msgstr "Poniższe pliki zostaną usunięte"
|
|
|
|
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
|
msgid "These settings are stored with the project."
|
|
msgstr "Te ustawienia są przechowywane z projektem."
|
|
|
|
#: lazarusidestrconsts.listheseunitswerenotfound
|
|
msgid "These units were not found:"
|
|
msgstr "Nie znaleziono tych modułów:"
|
|
|
|
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
|
#, object-pascal-format
|
|
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetargetdirectoryisafile
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The target directory is a file:%s"
|
|
msgstr "Wybierz katalog docelowy"
|
|
|
|
#: lazarusidestrconsts.listhetargetfilenameisadirectory
|
|
msgid "The target file name is a directory."
|
|
msgstr "Docelowa nazwa pliku jest katalogiem."
|
|
|
|
#: lazarusidestrconsts.listhetargetisnotwritable
|
|
#, object-pascal-format
|
|
msgid "The target %s is not writable."
|
|
msgstr "Docelowy %s bez prawa zapisu."
|
|
|
|
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
|
#, object-pascal-format
|
|
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitalreadyexists
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The unit \"%s\" already exists."
|
|
msgstr "Nazwa modułu \"%s\" już istnieje w projekcie%sw pliku: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listheunitbelongstopackage
|
|
#, object-pascal-format
|
|
msgid "The unit belongs to package %s."
|
|
msgstr "Moduł należy do pakietu %s."
|
|
|
|
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr "Nazwa modułu \"%s\" już istnieje w projekcie%sw pliku: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listheunithasthisname
|
|
msgid "The unit has this name"
|
|
msgstr "Moduł ma tę nazwę"
|
|
|
|
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
|
#, object-pascal-format
|
|
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
|
#, object-pascal-format
|
|
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
|
#, object-pascal-format
|
|
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
|
#, object-pascal-format
|
|
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
#, object-pascal-format
|
|
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
#, object-pascal-format
|
|
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
|
#, object-pascal-format, fuzzy
|
|
msgid "This component already contains a class with the name %s."
|
|
msgstr "Klasa komponentu \"%s\" już została zdefiniowana"
|
|
|
|
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
|
msgid "This function needs an open .lfm file in the source editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhishelpmessage
|
|
msgid "this help message"
|
|
msgstr "ten komunikat pomocy"
|
|
|
|
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
|
msgid "This is a test project for a design time package, testing it outside the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
#, object-pascal-format
|
|
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
|
msgid "This project has no main source file"
|
|
msgstr "Ten projekt nie ma głównego pliku źródłowego"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
|
msgid "This project has only the default build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
|
#, object-pascal-format
|
|
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
|
#, object-pascal-format
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
|
msgid "This will allow changing all build modes at once. Not implemented yet."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
|
msgid "This will create a circular dependency."
|
|
msgstr "To stworzy zapętloną zależność."
|
|
|
|
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
|
#, object-pascal-format
|
|
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitle
|
|
msgid "&Title"
|
|
msgstr "&Tytuł"
|
|
|
|
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
|
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr "Tytuł (pozostaw puste to będzie domyślny)"
|
|
|
|
#: lazarusidestrconsts.listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Ścieżka:"
|
|
|
|
#: lazarusidestrconsts.listoolbarconfiguration
|
|
msgid "Toolbar Configuration"
|
|
msgstr "Konfiguracja paska narzędzi"
|
|
|
|
#: lazarusidestrconsts.listoolhasnoexecutable
|
|
#, object-pascal-format, fuzzy
|
|
msgid "tool \"%s\" has no executable"
|
|
msgstr "brak pliku wykonywalnego \"%s\""
|
|
|
|
#: lazarusidestrconsts.listoolheaderfailed
|
|
#, fuzzy
|
|
msgid "Tool Header: Failed"
|
|
msgstr "Narzędzie zaznaczania"
|
|
|
|
#: lazarusidestrconsts.listoolheaderrunning
|
|
#, fuzzy
|
|
msgid "Tool Header: Running"
|
|
msgstr "Narzędzie p&omocy"
|
|
|
|
#: lazarusidestrconsts.listoolheaderscrolledup
|
|
msgid "Tool Header: Scrolled up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheadersuccess
|
|
#, fuzzy
|
|
msgid "Tool Header: Success"
|
|
msgstr "Powodzenie"
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
|
#, object-pascal-format
|
|
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
|
msgstr "narzędzie zatrzymane z kodem wyjścia %s. Użyj menu kontekstowego aby uzyskać więcej informacji."
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
|
|
#, object-pascal-format
|
|
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listop
|
|
msgctxt "lazarusidestrconsts.listop"
|
|
msgid "Top"
|
|
msgstr "Góra"
|
|
|
|
#: lazarusidestrconsts.listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Górne umocowanie"
|
|
|
|
#: lazarusidestrconsts.listopborderspacespinedithint
|
|
#, fuzzy
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr "Lewy odstęp obramowania. Wartość dodawana do odstępu podstawowego."
|
|
|
|
#: lazarusidestrconsts.listopinfoview
|
|
msgid "Show Class/Procedure hint"
|
|
msgstr "Pokaż nazwę klasy / procedury"
|
|
|
|
#: lazarusidestrconsts.listops
|
|
msgid "Tops"
|
|
msgstr "Górne krawędzie"
|
|
|
|
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr "Górne krawędzie równomiernie"
|
|
|
|
#: lazarusidestrconsts.listotalpages
|
|
#, object-pascal-format
|
|
msgid "Total Pages: %s"
|
|
msgstr "Wszystkich stron: %s"
|
|
|
|
#: lazarusidestrconsts.listranslatetheenglishmessages
|
|
msgid "Translate the English Messages"
|
|
msgstr "Tłumacz angielskie komunikaty"
|
|
|
|
#: lazarusidestrconsts.listreeneedsrefresh
|
|
msgid "Tree needs refresh"
|
|
msgstr "Drzewo wymaga odświeżenia"
|
|
|
|
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
|
#, object-pascal-format
|
|
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listypes
|
|
msgid "Types (not removed if no replacement)"
|
|
msgstr "Typy (nie usuwane jeśli nie można zmienić)"
|
|
|
|
#: lazarusidestrconsts.lisudadditionaldirectories
|
|
msgid "Additional directories:"
|
|
msgstr "Dodatkowe katalogi:"
|
|
|
|
#: lazarusidestrconsts.lisudallpackageunits
|
|
msgid "All package units"
|
|
msgstr "Wszystkie moduły pakietu"
|
|
|
|
#: lazarusidestrconsts.lisudallsourceeditorunits
|
|
msgid "All source editor units"
|
|
msgstr "Wszystkie moduły z kodem źródłowym"
|
|
|
|
#: lazarusidestrconsts.lisudallunits
|
|
msgid "All units"
|
|
msgstr "Wszystkie moduły"
|
|
|
|
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
|
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
|
msgstr "Domyślnie przeszukiwane są tylko moduły projektu i te otwarte w edytorze. Dodaj tutaj listę katalogów rozdzieloną średnikami aby je też przeszukiwać."
|
|
|
|
#: lazarusidestrconsts.lisudcollapseallnodes
|
|
msgid "Collapse all nodes"
|
|
msgstr "Zwiń wszystkie węzły"
|
|
|
|
#: lazarusidestrconsts.lisudexpandallnodes
|
|
msgid "Expand all nodes"
|
|
msgstr "Rozwiń wszystkie węzły"
|
|
|
|
#: lazarusidestrconsts.lisudfile
|
|
#, object-pascal-format
|
|
msgid "File: %s"
|
|
msgstr "Plik: %s"
|
|
|
|
#: lazarusidestrconsts.lisudfilter
|
|
msgid "(Filter)"
|
|
msgstr "(filtr)"
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Implementation Uses: %s"
|
|
msgstr "Skocz do imlementation uses"
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses2
|
|
#, object-pascal-format
|
|
msgid "implementation uses: %s"
|
|
msgstr "implementation uses: %s"
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Interface Uses: %s"
|
|
msgstr "Skocz do interface uses"
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses2
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "interface uses: %s"
|
|
msgstr "Skocz do interface uses"
|
|
|
|
#: lazarusidestrconsts.lisudprojectsandpackages
|
|
msgid "Projects and packages"
|
|
msgstr "Projekty i pakiety"
|
|
|
|
#: lazarusidestrconsts.lisudscanning
|
|
msgid "Scanning ..."
|
|
msgstr "Skanowanie ..."
|
|
|
|
#: lazarusidestrconsts.lisudscanningunits
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Scanning: %s units ..."
|
|
msgstr "Moduły: %s"
|
|
|
|
#: lazarusidestrconsts.lisudsearch
|
|
msgid "(Search)"
|
|
msgstr "(Szukaj)"
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
|
msgid "Find next occurrence of this phrase"
|
|
msgstr "Znajdź następne wystąpienie tej frazy"
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
|
msgid "Find next unit with this phrase"
|
|
msgstr "Znajdź następny moduł z wystąpieniem tej frazy"
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
|
msgid "Find previous occurrence of this phrase"
|
|
msgstr "Znajdź poprzednie wystąpienie tej frazy"
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
|
msgid "Find previous unit with this phrase"
|
|
msgstr "Znajdź poprzedni moduł z wystąpieniem tej frazy"
|
|
|
|
#: lazarusidestrconsts.lisudselectedunits
|
|
msgid "Selected units"
|
|
msgstr "Wybierz moduły"
|
|
|
|
#: lazarusidestrconsts.lisudshownodesfordirectories
|
|
msgid "Show nodes for directories"
|
|
msgstr "Pokaż węzły katalogów"
|
|
|
|
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
|
msgid "Show nodes for project and packages"
|
|
msgstr "Pokaż węzły dla projektu i pakietów"
|
|
|
|
#: lazarusidestrconsts.lisudunits
|
|
msgid "Units"
|
|
msgstr "Moduły"
|
|
|
|
#: lazarusidestrconsts.lisudunits2
|
|
#, object-pascal-format
|
|
msgid "Units: %s"
|
|
msgstr "Moduły: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Used by Implementations: %s"
|
|
msgstr "Plik jest w użyciu"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations2
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "used by implementations: %s"
|
|
msgstr "Plik jest w użyciu"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Used by Interfaces: %s"
|
|
msgstr "Plik jest w użyciu"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "used by interfaces: %s"
|
|
msgstr "Plik jest w użyciu"
|
|
|
|
#: lazarusidestrconsts.lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Nie pokazuj więcej tego komunikatu."
|
|
|
|
#: lazarusidestrconsts.lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Błąd w wyrażeniu regularnym"
|
|
|
|
#: lazarusidestrconsts.lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Czcionka bez UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisuegotoline
|
|
msgid "Goto line:"
|
|
msgstr "Wpisz numer wiersza :"
|
|
|
|
#: lazarusidestrconsts.lisuemodeseparator
|
|
msgid "/"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Nie znaleziono"
|
|
|
|
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
|
#, object-pascal-format
|
|
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
|
msgstr "Czy chcesz zastąpić rekurencje \"%s\"%s przez \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisuesearching
|
|
#, object-pascal-format
|
|
msgid "Searching: %s"
|
|
msgstr "Szukanie: %s"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
|
msgid "Continue search from the beginning?"
|
|
msgstr "Kontynuować szukanie od początku?"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
|
msgid "Continue search from the end?"
|
|
msgstr "Kontynuować szukanie od końca?"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringnotfound
|
|
#, object-pascal-format
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Nie znaleziono wyrażenia '%s'!"
|
|
|
|
#: lazarusidestrconsts.lisuethecurre
|
|
#, object-pascal-format
|
|
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr "Wyczyść pamięć podręczną"
|
|
|
|
#: lazarusidestrconsts.lisuidbytes
|
|
#, object-pascal-format
|
|
msgid "%s bytes"
|
|
msgstr "%s bajtów"
|
|
|
|
#: lazarusidestrconsts.lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Dołączane przez:"
|
|
|
|
#: lazarusidestrconsts.lisuidinproject
|
|
msgid "In project:"
|
|
msgstr "W projekcie:"
|
|
|
|
#: lazarusidestrconsts.lisuidlines
|
|
msgctxt "lazarusidestrconsts.lisuidlines"
|
|
msgid "Lines:"
|
|
msgstr "Linii:"
|
|
|
|
#: lazarusidestrconsts.lisuidname
|
|
msgctxt "lazarusidestrconsts.lisuidname"
|
|
msgid "Name:"
|
|
msgstr "Nazwa:"
|
|
|
|
#: lazarusidestrconsts.lisuidno
|
|
msgid "no"
|
|
msgstr "nie"
|
|
|
|
#: lazarusidestrconsts.lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Rozmiar:"
|
|
|
|
#: lazarusidestrconsts.lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Typ:"
|
|
|
|
#: lazarusidestrconsts.lisuidyes
|
|
msgid "yes"
|
|
msgstr "tak"
|
|
|
|
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Pokaż wartości CodeTools"
|
|
|
|
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr "Nie można skopiować komponentów do schowka"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
|
#, object-pascal-format
|
|
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Nie można dodać komentarza nagłówka zasobu do pliku zasobów %s\"%s\".%sPrawdopodobnie błąd składniowy."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
#, object-pascal-format
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Nie można dodać zasobu T%s:FORMDATA do pliku z zasobami %s\"%s\".%sPrawdopodobnie błąd składni."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
|
#, object-pascal-format
|
|
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
|
#, object-pascal-format
|
|
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
|
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
|
|
msgstr "Nie można dodać %s do projektu, ponieważ zawiera on już moduł o tej nazwie."
|
|
|
|
#: lazarusidestrconsts.lisunabletobackupfileto
|
|
#, object-pascal-format
|
|
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
|
msgstr "Nie można utworzyć kopii zapasowej pliku \"%s\" jako \"%s\"!"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeclassofto
|
|
#, object-pascal-format
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
|
|
#, object-pascal-format
|
|
msgid "Unable to change project scaled in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
|
#, object-pascal-format
|
|
msgid "Unable to change project title in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Nie można wyczyścić katalogu docelowego"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
|
#, object-pascal-format
|
|
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
|
msgstr "Nie można wyczyścić \"%s\".%sSprawdź uprawnienia."
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr "Nie można przekształcić binarnego strumienia komponentu %s:T%s na tekst."
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to convert file \"%s\"%sError: %s"
|
|
msgstr "Nie można zamienić pliku \"%s\"%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
|
#, object-pascal-format
|
|
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
|
msgstr "Nie można skonwertować pliku z danymi w formie tekstu z pliku %s\"%s\"%sna strumień dwójkowy. (%s)"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Unable to convert to encoding \"%s\""
|
|
msgstr "Nie można przekonwertować pliku \"%s\"%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfile
|
|
msgid "Unable to copy file"
|
|
msgstr "Nie można skopiować pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfileto
|
|
#, object-pascal-format
|
|
msgid "Unable to copy file \"%s\"%sto \"%s\""
|
|
msgstr "Nie można skopiować pliku \"%s\"%sdo \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatedirectory
|
|
#, object-pascal-format
|
|
msgid "Unable to create directory \"%s\"."
|
|
msgstr "Nie można utworzyć katalogu \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile
|
|
msgid "Unable to create file"
|
|
msgstr "Nie można utworzyć pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile2
|
|
#, object-pascal-format
|
|
msgid "Unable to create file \"%s\""
|
|
msgstr "Nie można utworzyć pliku \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile3
|
|
#, object-pascal-format
|
|
msgid "Unable to create file%s\"%s\""
|
|
msgstr "Nie można utworzyć pliku%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Unable to create link \"%s\" with target \"%s\""
|
|
msgstr "Nie można utworzyć katalogu z kopią zapasową \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
|
msgid "Unable to create new file because there is already a directory with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
|
msgid "Unable to create new method."
|
|
msgstr "Nie można utworzyć metody."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
|
#, object-pascal-format
|
|
msgid "Unable to delete ambiguous file \"%s\""
|
|
msgstr "Nie można usunąć niejednoznacznego pliku \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletoexecute
|
|
#, object-pascal-format
|
|
msgid "unable to execute: %s"
|
|
msgstr "nie można uruchomić: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
|
#, object-pascal-format
|
|
msgid "Unable to find a valid classname in \"%s\""
|
|
msgstr "Nie znaleziono prawidłowej nazwy klasy w \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfile
|
|
#, object-pascal-format
|
|
msgid "Unable to find file \"%s\"."
|
|
msgstr "Nie znaleziono pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
#, object-pascal-format
|
|
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr "Nie można wysłać do strumienia %s:T%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindmethod
|
|
msgid "Unable to find method."
|
|
msgstr "Nie można znaleźć metody."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
|
#, object-pascal-format
|
|
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
|
#, object-pascal-format
|
|
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
|
#, fuzzy
|
|
msgid "Unable to gather editor changes."
|
|
msgstr "nie można zastosowac zmian"
|
|
|
|
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
|
#, fuzzy
|
|
msgid "Unable to get source for designer."
|
|
msgstr "Nie udało się zmienić nazwy zmiennej w źródle."
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadfile2
|
|
#, object-pascal-format
|
|
msgid "unable to load file %s: %s"
|
|
msgstr "nie można załadować pliku %s:%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadpackage
|
|
#, object-pascal-format
|
|
msgid "Unable to load package \"%s\""
|
|
msgstr "Nie można załadować pakietu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
#, object-pascal-format
|
|
msgid "Unable to load the component class \"%s\" because it depends on itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopen
|
|
#, object-pascal-format
|
|
msgid "Unable to open \"%s\""
|
|
msgstr "Nie można otworzyć \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
#, object-pascal-format
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoread
|
|
#, object-pascal-format
|
|
msgid "Unable to read %s"
|
|
msgstr "Nie można odczytać %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile
|
|
msgid "Unable to read file"
|
|
msgstr "Nie można czytać pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile2
|
|
#, object-pascal-format
|
|
msgid "Unable to read file \"%s\"."
|
|
msgstr "Nie można odczytać pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to read file \"%s\"%sError: %s"
|
|
msgstr "Nie można odczytać pliku \"%s\"%sBład: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadlpi
|
|
msgid "Unable to read lpi"
|
|
msgstr "Nie można czytać pliku lpi"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
|
#, fuzzy
|
|
msgid "unable to read process ExitStatus"
|
|
msgstr "Nie można pobrać wersji raportu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
|
msgid "Unable to read the project info file%s\"%s\"."
|
|
msgstr "Nie można odczytać pliku informacji o projekcie%s\"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
|
#, object-pascal-format
|
|
msgid "Unable to remove old backup file \"%s\"!"
|
|
msgstr "Nie można usunąć starego pliku kopii zapasowej \"%s\"!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
|
|
#, object-pascal-format
|
|
msgid "Unable to remove project scaled from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
|
#, object-pascal-format
|
|
msgid "Unable to remove project title from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
|
#, object-pascal-format
|
|
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
|
msgstr "Nie udało się zmienić nazwy niejednoznacznego pliku \"%s\"%sna \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefile
|
|
msgid "Unable to rename file"
|
|
msgstr "Nie udało się zmienić nazwy pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto
|
|
#, object-pascal-format
|
|
msgid "Unable to rename file \"%s\" to \"%s\"!"
|
|
msgstr "Nie udało się zmienić nazwy pliku \"%s\" na \"%s\"!"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto2
|
|
#, object-pascal-format
|
|
msgid "Unable to rename file \"%s\"%sto \"%s\"."
|
|
msgstr "Nie udało sie zmienić nazwy pliku \"%s\"%s na \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Nie udało się zmienić nazwy formularza w źródle."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Nie można zmienić nazwy metody. Popraw błąd wypisany w oknie komunikatów."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Nie udało się zmienić nazwy zmiennej w źródle."
|
|
|
|
#: lazarusidestrconsts.lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr "Nie można uruchomić"
|
|
|
|
#: lazarusidestrconsts.lisunabletorun2
|
|
#, object-pascal-format
|
|
msgid "Unable to run \"%s\""
|
|
msgstr "Nie można uruchomić \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoshowmethod
|
|
msgid "Unable to show method."
|
|
msgstr "Nie można wyświetlić metody."
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr "Nie można wysłać do strumienia zaznaczonych komponentów"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
|
#, fuzzy
|
|
msgid "Unable to stream selected components."
|
|
msgstr "Nie można wysłać do strumienia %s:T%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamt
|
|
#, object-pascal-format
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "Nie można wysłać do strumienia %s:T%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
|
#, object-pascal-format
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "Nie można przekształcić binarnego strumienia komponentu %s:T%s na tekst."
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "Nie można uaktualnić polecenia CreateForm w źródle"
|
|
|
|
#: lazarusidestrconsts.lisunabletowrite2
|
|
#, object-pascal-format
|
|
msgid "Unable to write \"%s\""
|
|
msgstr "Nie można zapisać \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile
|
|
msgid "Unable to write file"
|
|
msgstr "Nie można pisać do pliku"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile2
|
|
#, object-pascal-format
|
|
msgid "Unable to write file \"%s\"."
|
|
msgstr "Nie można zapisać pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to write file \"%s\"%sError: %s"
|
|
msgstr "Nie można zapisać do pliku \"%s\"%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
|
|
msgstr "Nie można zapisać projektu do pliku%s\"%s\".%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
|
msgstr "Nie można zapisać pliku statusu \"%s\"%spakietu %s.%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetofile2
|
|
#, object-pascal-format
|
|
msgid "Unable to write to file \"%s\"."
|
|
msgstr "Nie można zapisywać do pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
|
#, object-pascal-format, fuzzy
|
|
msgid "Unable to write xml stream to %s%sError: %s"
|
|
msgstr "Nie można zapisać do pliku \"%s\"%sBłąd: %s"
|
|
|
|
#: lazarusidestrconsts.lisuncheckall
|
|
msgid "Uncheck All"
|
|
msgstr "Odznacz wszystko"
|
|
|
|
#: lazarusidestrconsts.lisundo
|
|
msgctxt "lazarusidestrconsts.lisundo"
|
|
msgid "Undo"
|
|
msgstr "Cofnij"
|
|
|
|
#: lazarusidestrconsts.lisuninstall
|
|
#, object-pascal-format
|
|
msgid "Uninstall %s"
|
|
msgstr "Odinstalowanie %s"
|
|
|
|
#: lazarusidestrconsts.lisuninstallfail
|
|
msgid "Uninstall failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallimpossible
|
|
msgid "Uninstall impossible"
|
|
msgstr "Odinstalowanie jest niemożliwe"
|
|
|
|
#: lazarusidestrconsts.lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "Odinstaluj zaznaczone"
|
|
|
|
#: lazarusidestrconsts.lisuninstallthemtoo
|
|
msgid "Uninstall them too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunit
|
|
msgctxt "lazarusidestrconsts.lisunit"
|
|
msgid "Unit"
|
|
msgstr "Moduł"
|
|
|
|
#: lazarusidestrconsts.lisunithaschangedsave
|
|
#, object-pascal-format
|
|
msgid "Unit \"%s\" has changed. Save?"
|
|
msgstr "Moduł \"%s\" został zmieniony. Czy chcesz zapisać zmiany?"
|
|
|
|
#: lazarusidestrconsts.lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Identyfikator modułu istnieje"
|
|
|
|
#: lazarusidestrconsts.lisunitinpackage
|
|
#, object-pascal-format
|
|
msgid "%s unit %s in package %s"
|
|
msgstr "%s moduł %s w pakiecie %s"
|
|
|
|
#: lazarusidestrconsts.lisunitmustsavebeforeinherit
|
|
#, object-pascal-format
|
|
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Moduł o tej nazwie jest już w projekcie"
|
|
|
|
#: lazarusidestrconsts.lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr "Nazwa modułu zaczyna się od..."
|
|
|
|
#: lazarusidestrconsts.lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr "Nazwa modułu zawiera..."
|
|
|
|
#: lazarusidestrconsts.lisunitnotfound
|
|
#, object-pascal-format
|
|
msgid "unit %s not found"
|
|
msgstr "nie znaleziono modułu %s"
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "unit %s not found at new position \"%s\""
|
|
msgstr "Nie znaleziono modułu w projekcie %s"
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundinfile
|
|
#, object-pascal-format
|
|
msgid "A unit not found in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr "Katalog wyjściowy modułów"
|
|
|
|
#: lazarusidestrconsts.lisunitpath
|
|
msgid "unit path"
|
|
msgstr "ścieżka modułów"
|
|
|
|
#: lazarusidestrconsts.lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Ścieżki do modułów"
|
|
|
|
#: lazarusidestrconsts.lisunitrequirespackage
|
|
#, object-pascal-format
|
|
msgid "unit %s requires package %s"
|
|
msgstr "moduł %s wymaga pakietu %s"
|
|
|
|
#: lazarusidestrconsts.lisunitsnotfoundinfile
|
|
#, object-pascal-format
|
|
msgid "Units not found in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusedunitsof
|
|
#, object-pascal-format
|
|
msgid "Unused units of %s"
|
|
msgstr "Nieużywane moduły w %s"
|
|
|
|
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
|
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
|
msgstr "Nietypowa nazwa kompilatora. Zwykle zaczyna się od fpc, ppc lub ppcross."
|
|
|
|
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
|
|
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
|
|
msgstr "Nietypowa nazwa kompilatora pas2js. Zwykle zaczyna się od pas2js."
|
|
|
|
#: lazarusidestrconsts.lisup
|
|
msgctxt "lazarusidestrconsts.lisup"
|
|
msgid "Up"
|
|
msgstr "W górę"
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationcreateform
|
|
msgid "Update Application.CreateForm statements in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationscaledstatement
|
|
msgid "Update Application.Scaled statement in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationtitlestatement
|
|
msgid "Update Application.Title statement in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateinfo
|
|
msgid "Update info"
|
|
msgstr "Uaktualnij numer wersji w oknie informacji o Lazarusie"
|
|
|
|
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
|
msgid "Update other procedure signatures when only letter case has changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatereferences
|
|
msgid "Update references?"
|
|
msgstr "Uaktualnić odnośniki?"
|
|
|
|
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
|
|
#, object-pascal-format
|
|
msgid "Updating PO files failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgrade
|
|
msgid "Upgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgradeconfiguration
|
|
msgid "Upgrade configuration"
|
|
msgstr "Uaktualnij konfigurację"
|
|
|
|
#: lazarusidestrconsts.lisuppercasestring
|
|
#, fuzzy
|
|
msgid "uppercase string"
|
|
msgstr "UPPERCASE(<Tekst>)/Zamienia <Tekst> na duże litery."
|
|
|
|
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
|
msgid "Uppercase string given as parameter."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
|
#, object-pascal-format
|
|
msgid "URL on wiki (the base url is %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusagemessagehoption
|
|
msgid "Usage message (-h option)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuse
|
|
msgid "Use"
|
|
msgstr "Zastosuj"
|
|
|
|
#: lazarusidestrconsts.lisuseansistrings
|
|
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Używaj łańcuchów typu AnsiString"
|
|
|
|
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
|
msgid "Use CheckBox for Boolean values"
|
|
msgstr "Użyj CheckBox dla wartości logicznych"
|
|
|
|
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
|
#, fuzzy
|
|
msgid "Use comments in custom options"
|
|
msgstr "opcje niestandardowe"
|
|
|
|
#: lazarusidestrconsts.lisusedby
|
|
#, object-pascal-format
|
|
msgid " used by %s"
|
|
msgstr " używane przez %s"
|
|
|
|
#: lazarusidestrconsts.lisusedesigntimepackages
|
|
msgid "Use design time packages"
|
|
msgstr "Używaj pakietów w trybie projektu"
|
|
|
|
#: lazarusidestrconsts.lisusedforautocreatedforms
|
|
#, fuzzy
|
|
msgid "Used for auto-created forms."
|
|
msgstr "Nowe formularze dodawaj do tworzonych automatycznie"
|
|
|
|
#: lazarusidestrconsts.lisusefilterforextrafiles
|
|
msgid "Use filter to include extra files"
|
|
msgstr "Użyj filtra do włączania dodatkowych plików"
|
|
|
|
#: lazarusidestrconsts.lisuseidentifier
|
|
msgid "Use identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseidentifierinat
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Use identifier %s in %s at %s"
|
|
msgstr "zdublowany identyfikator: %s"
|
|
|
|
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr "Program ładujący"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage
|
|
#, object-pascal-format
|
|
msgid "Use package %s in package %s"
|
|
msgstr "Użyj pakietu %s w pakiecie %s"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage2
|
|
msgid "Use package in package"
|
|
msgstr "Użyj pakietu w pakiecie"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject
|
|
#, object-pascal-format
|
|
msgid "Use package %s in project"
|
|
msgstr "Użyć pakiet %s w projekcie"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject2
|
|
msgid "Use package in project"
|
|
msgstr "Użyj pakietu w projekcie"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
|
#, object-pascal-format
|
|
msgid "Add to list \"%s\""
|
|
msgstr "Dodaj do listy \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
|
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
|
msgid "User defined text markup"
|
|
msgstr "Znaczniki użytkownika"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
|
#, object-pascal-format
|
|
msgid "Remove from list \"%s\""
|
|
msgstr "Usuń z listy \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
|
#, object-pascal-format
|
|
msgid "Toggle on list \"%s\""
|
|
msgstr "Przełącz na liście \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr "Katalog domowy użytkownika"
|
|
|
|
#: lazarusidestrconsts.lisuseunit
|
|
msgctxt "lazarusidestrconsts.lisuseunit"
|
|
msgid "Add Unit to Uses Section"
|
|
msgstr "Dodaj moduł do sekcji Uses"
|
|
|
|
#: lazarusidestrconsts.lisuseunitinunit
|
|
#, object-pascal-format
|
|
msgid "Use unit %s in unit %s"
|
|
msgstr "Użyj modułu %s w module %s"
|
|
|
|
#: lazarusidestrconsts.lisutf8withbom
|
|
msgid "UTF-8 with BOM"
|
|
msgstr "UTF-8 z BOM"
|
|
|
|
#: lazarusidestrconsts.lisvalue
|
|
msgctxt "lazarusidestrconsts.lisvalue"
|
|
msgid "Value"
|
|
msgstr "Wartość"
|
|
|
|
#: lazarusidestrconsts.lisvalue2
|
|
#, object-pascal-format
|
|
msgid "Value%s"
|
|
msgstr "Wartość%s"
|
|
|
|
#: lazarusidestrconsts.lisvalue3
|
|
msgid "Value: "
|
|
msgstr "Wartość: "
|
|
|
|
#: lazarusidestrconsts.lisvalues
|
|
msgid "Values"
|
|
msgstr "Wartości"
|
|
|
|
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
|
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvariable
|
|
msgctxt "lazarusidestrconsts.lisvariable"
|
|
msgid "Variable"
|
|
msgstr "Zmienna"
|
|
|
|
#: lazarusidestrconsts.lisverbose
|
|
msgctxt "lazarusidestrconsts.lisverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr "Badaj metodę odwołań"
|
|
|
|
#: lazarusidestrconsts.lisversion
|
|
msgid "Version"
|
|
msgstr "Wersja"
|
|
|
|
#: lazarusidestrconsts.lisversionmismatch
|
|
msgid "Version mismatch"
|
|
msgstr "Niezgodność wersji"
|
|
|
|
#: lazarusidestrconsts.lisvertical
|
|
msgid "Vertical"
|
|
msgstr "&Pionowo"
|
|
|
|
#: lazarusidestrconsts.lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr "Kopiuj informacje o wersji do schowka"
|
|
|
|
#: lazarusidestrconsts.lisveryverbose
|
|
msgid "Very Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Pokaż źródło (.lfm)"
|
|
|
|
#: lazarusidestrconsts.liswarning
|
|
msgid "Warning: "
|
|
msgstr "Ostrzeżenie: "
|
|
|
|
#: lazarusidestrconsts.liswarnings
|
|
#, object-pascal-format
|
|
msgid ", Warnings: %s"
|
|
msgstr ", Ostrzeżenia: %s"
|
|
|
|
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
|
#, object-pascal-format
|
|
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswelcometolazaruside
|
|
#, object-pascal-format
|
|
msgid "Welcome to Lazarus IDE %s"
|
|
msgstr "Witaj w IDE Lazarusa %s"
|
|
|
|
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
|
#, object-pascal-format
|
|
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhatneedsbuilding
|
|
msgid "What needs building"
|
|
msgstr "Wymagające budowania"
|
|
|
|
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
|
msgid "When a unit is renamed, update references"
|
|
msgstr "Gdy zmieniana jest nazwa modułu, zmieniaj odnośniki"
|
|
|
|
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
|
msgid "When enabled the current options are saved to the template which is used when creating new projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
|
|
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
|
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
|
msgid "Window menu shows designed form's name instead of caption"
|
|
msgstr "Menu okna pokazuje projektowaną nazwę formularza zamiast nagłówka"
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
|
msgid "Useful especially if the caption is left empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowstaysontop
|
|
msgid "Window stays on top"
|
|
msgstr "Okno zawsze na wierzchu"
|
|
|
|
#: lazarusidestrconsts.liswithincludes2
|
|
#, fuzzy
|
|
msgid ", with includes "
|
|
msgstr "Prawy klawisz myszy wywołuje przesunięcie kursora"
|
|
|
|
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
|
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
|
msgid "Without a proper debugger, debugging will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
|
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
|
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
|
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "Wraz z wymaganymi pakietami"
|
|
|
|
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Słowo przy kursorze"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr "Katalog roboczy do budowania"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr "Katalog roboczy do uruchamiania"
|
|
|
|
#: lazarusidestrconsts.liswriteerror
|
|
msgid "Write Error"
|
|
msgstr "Błąd zapisu"
|
|
|
|
#: lazarusidestrconsts.liswriteerrorfile
|
|
#, object-pascal-format
|
|
msgid "Write error: %s%sFile: %s%s%s"
|
|
msgstr "Błąd zapisu: %s%sPlik: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liswritepackageinfofailed
|
|
msgid "Writing the package info file failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswriteprojectinfofailed
|
|
#, fuzzy
|
|
msgid "Writing the project info file failed."
|
|
msgstr "Wykryto plik z informacją o projekcie"
|
|
|
|
#: lazarusidestrconsts.liswrongversionin
|
|
#, object-pascal-format
|
|
msgid "wrong version in %s: %s"
|
|
msgstr "zła wersja w %s: %s"
|
|
|
|
#: lazarusidestrconsts.lisxmlerror
|
|
msgid "XML Error"
|
|
msgstr "Błąd XML"
|
|
|
|
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
|
#, object-pascal-format
|
|
msgid "XML parser error in file %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
|
msgid "You can disable this for individual forms via the package editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
|
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
|
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
msgid "You cannot build Lazarus while debugging or compiling."
|
|
msgstr "Nie można przebudować lazarusa w czasie odpluskwiania lub kompilacji programu."
|
|
|
|
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
|
|
msgid "You cannot change the build mode while compiling."
|
|
msgstr "Nie możesz zmienić trybu budowania w czasie kompilacji."
|
|
|
|
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
|
|
msgid "You can select items by simply pressing underscored letters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis_all_
|
|
msgctxt "lazarusidestrconsts.lis_all_"
|
|
msgid "<All>"
|
|
msgstr "<wszystkie>"
|
|
|
|
#: lazarusidestrconsts.locwndsrceditor
|
|
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
|
msgid "Source Editor"
|
|
msgstr "Edytor źródeł"
|
|
|
|
#: lazarusidestrconsts.lrsplddeleteselected
|
|
msgid "Delete selected"
|
|
msgstr "Usuń wybrane"
|
|
|
|
#: lazarusidestrconsts.lrspldinvalid
|
|
msgid "invalid"
|
|
msgstr "nieprawidłowy"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
|
#, object-pascal-format
|
|
msgid "lpk file invalid (%s)"
|
|
msgstr "niepoprawne pliki lpk (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfilevalid
|
|
#, object-pascal-format
|
|
msgid "lpk file valid (%s)"
|
|
msgstr "poprawne pliki (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldunabletodeletefile
|
|
#, object-pascal-format
|
|
msgid "Unable to delete file \"%s\""
|
|
msgstr "Nie można usunąć pliku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lrspldvalid
|
|
msgid "valid"
|
|
msgstr "prawidłowy"
|
|
|
|
#: lazarusidestrconsts.lrsrescanlplfiles
|
|
msgid "Rescan lpl files"
|
|
msgstr "Przeskanuj pliki lpl"
|
|
|
|
#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
|
|
msgid "Add horizontal spacing between columns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphaddverticalspacingar
|
|
msgid "Add vertical spacing around nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphextraspacing
|
|
msgid "Extra spacing (x/y)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphnamesabovenode
|
|
msgid "Names above node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptabsolutelimi
|
|
msgid "Absolute limit for height of levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptcrossings
|
|
msgid "Crossings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptedgelen
|
|
msgid "Edge len"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptedges
|
|
msgid "Edges"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptinfo
|
|
msgid "Info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlevels
|
|
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
|
|
msgid "Levels"
|
|
msgstr "Poziomy"
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
|
|
msgid "Limit height of Levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlimitrelativ
|
|
#, object-pascal-format
|
|
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptsplitpoints
|
|
msgid "Splitpoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphreducebackedges
|
|
msgid "Reduce backedges"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapecalculatelay
|
|
msgid "Calculate layout from high-edge"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapecurved
|
|
msgid "Curved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeedgesshape
|
|
msgid "Edges shape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
|
|
msgid "Edges split mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeminimizeedge
|
|
msgid "Minimize edges len"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapenodes
|
|
msgid "Nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapestraight
|
|
msgid "Straight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeathighe
|
|
msgid "Merge at highest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
|
|
msgid "Merge at source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeattarge
|
|
msgid "Merge at target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitnone
|
|
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
|
|
msgid "None"
|
|
msgstr "Brak"
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitseparate
|
|
msgid "Separate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphstraightengraph
|
|
msgid "Straighten graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr "Dodaj moduł pakietu do sekcji uses"
|
|
|
|
#: lazarusidestrconsts.rsaddinverse
|
|
#, fuzzy
|
|
msgid "Add Inverse"
|
|
msgstr "&Dodaj..."
|
|
|
|
#: lazarusidestrconsts.rsaddnewterm
|
|
msgid "Add new term"
|
|
msgstr "Dodaj nowy element"
|
|
|
|
#: lazarusidestrconsts.rsattributes
|
|
msgid "Attributes"
|
|
msgstr "Atrybuty"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr "Automatycznie zwiększ numer budowania"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
|
msgid "Increased every time the project is compiled."
|
|
msgstr "Zwiększane po każdej kompilacji projektu."
|
|
|
|
#: lazarusidestrconsts.rsbuild
|
|
msgid "&Build:"
|
|
msgstr "&Buduj:"
|
|
|
|
#: lazarusidestrconsts.rscharacterset
|
|
msgid "Character set:"
|
|
msgstr "Zestaw znaków:"
|
|
|
|
#: lazarusidestrconsts.rscloseall
|
|
msgid "Close all pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsclosecurrentpage
|
|
#, fuzzy
|
|
#| msgid "Close current page"
|
|
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
|
|
msgstr "Zamknij bieżącą stronę"
|
|
|
|
#: lazarusidestrconsts.rscloseleft
|
|
msgid "Close page(s) on the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscloseothers
|
|
msgid "Close other page(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscloseright
|
|
msgid "Close page(s) on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr "Symbole warunkowe"
|
|
|
|
#: lazarusidestrconsts.rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr "Utwórz nowy symbol (define)"
|
|
|
|
#: lazarusidestrconsts.rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr "Włącz i18n"
|
|
|
|
#: lazarusidestrconsts.rsfilterthelistwithstring
|
|
msgid "Filter the lines in list with a string (Ctrl+F)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
|
msgid "Found but not listed here: "
|
|
msgstr "Znalezione, ale nie wypisane tutaj: "
|
|
|
|
#: lazarusidestrconsts.rsi18nexcluded
|
|
msgid "Excluded"
|
|
msgstr "Wykluczone"
|
|
|
|
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
|
|
msgid "Force update PO files on next build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nidentifiers
|
|
msgid "Identifiers:"
|
|
msgstr "Identyfikatory:"
|
|
|
|
#: lazarusidestrconsts.rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr "Opcje i18n"
|
|
|
|
#: lazarusidestrconsts.rsi18noriginals
|
|
msgid "Originals:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfohint
|
|
msgid "Version info is stored if the executable format supports it."
|
|
msgstr "Informacja o wersji jest przechowywana jeżeli format pliku wykonywalnego to przewiduje."
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
|
msgid "Include version info in executable"
|
|
msgstr "Dołącz informacje o wersji w pliku wykonywalnym"
|
|
|
|
#: lazarusidestrconsts.rslanguageafrikaans
|
|
msgid "Afrikaans"
|
|
msgstr "afrykanerski"
|
|
|
|
#: lazarusidestrconsts.rslanguagearabic
|
|
msgid "Arabic"
|
|
msgstr "arabski"
|
|
|
|
#: lazarusidestrconsts.rslanguageautomatic
|
|
msgid "Automatic (or English)"
|
|
msgstr "automatyczny (lub angielski)"
|
|
|
|
#: lazarusidestrconsts.rslanguagecatalan
|
|
msgid "Catalan"
|
|
msgstr "kataloński"
|
|
|
|
#: lazarusidestrconsts.rslanguagechinese
|
|
msgid "Chinese"
|
|
msgstr "chiński"
|
|
|
|
#: lazarusidestrconsts.rslanguagecorsican
|
|
msgid "Corsican"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageczech
|
|
msgid "Czech"
|
|
msgstr "czeski"
|
|
|
|
#: lazarusidestrconsts.rslanguagedutch
|
|
msgid "Dutch"
|
|
msgstr "holenderski"
|
|
|
|
#: lazarusidestrconsts.rslanguageenglish
|
|
msgid "English"
|
|
msgstr "angielski"
|
|
|
|
#: lazarusidestrconsts.rslanguagefinnish
|
|
msgid "Finnish"
|
|
msgstr "fiński"
|
|
|
|
#: lazarusidestrconsts.rslanguagefrench
|
|
msgid "French"
|
|
msgstr "francuski"
|
|
|
|
#: lazarusidestrconsts.rslanguagegerman
|
|
msgid "German"
|
|
msgstr "niemiecki"
|
|
|
|
#: lazarusidestrconsts.rslanguagehebrew
|
|
msgid "Hebrew"
|
|
msgstr "hebrajski"
|
|
|
|
#: lazarusidestrconsts.rslanguagehungarian
|
|
msgid "Hungarian"
|
|
msgstr "węgierski"
|
|
|
|
#: lazarusidestrconsts.rslanguageindonesian
|
|
msgid "Indonesian"
|
|
msgstr "indonezyjski"
|
|
|
|
#: lazarusidestrconsts.rslanguageitalian
|
|
msgid "Italian"
|
|
msgstr "włoski"
|
|
|
|
#: lazarusidestrconsts.rslanguagejapanese
|
|
msgid "Japanese"
|
|
msgstr "japoński"
|
|
|
|
#: lazarusidestrconsts.rslanguagelithuanian
|
|
msgid "Lithuanian"
|
|
msgstr "litewski"
|
|
|
|
#: lazarusidestrconsts.rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr "Opcje językowe"
|
|
|
|
#: lazarusidestrconsts.rslanguagepolish
|
|
msgid "Polish"
|
|
msgstr "polski"
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguese
|
|
msgid "Portuguese"
|
|
msgstr "portugalski"
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguesebr
|
|
msgid "Brazilian Portuguese"
|
|
msgstr "brazylijski portugalski"
|
|
|
|
#: lazarusidestrconsts.rslanguagerussian
|
|
msgid "Russian"
|
|
msgstr "rosyjski"
|
|
|
|
#: lazarusidestrconsts.rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr "Wybór języka:"
|
|
|
|
#: lazarusidestrconsts.rslanguageslovak
|
|
msgid "Slovak"
|
|
msgstr "słowacki"
|
|
|
|
#: lazarusidestrconsts.rslanguagespanish
|
|
msgid "Spanish"
|
|
msgstr "hiszpański"
|
|
|
|
#: lazarusidestrconsts.rslanguageturkish
|
|
msgid "Turkish"
|
|
msgstr "turecki"
|
|
|
|
#: lazarusidestrconsts.rslanguageukrainian
|
|
msgid "Ukrainian"
|
|
msgstr "ukraiński"
|
|
|
|
#: lazarusidestrconsts.rsmajorversion
|
|
msgid "&Major version:"
|
|
msgstr "Główna wersja:"
|
|
|
|
#: lazarusidestrconsts.rsminorversion
|
|
msgid "Mi&nor version:"
|
|
msgstr "Podwersja:"
|
|
|
|
#: lazarusidestrconsts.rsnewsearchwithsamecriteria
|
|
msgid "New search with same criteria (Ctrl+N)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsotherinfo
|
|
msgid "Other info"
|
|
msgstr "Inne informacje"
|
|
|
|
#: lazarusidestrconsts.rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr "Katalog wyjściowy PO:"
|
|
|
|
#: lazarusidestrconsts.rsrefreshthesearch
|
|
msgid "Refresh the search (F5)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresource
|
|
msgid "Resource"
|
|
msgstr "Zasoby"
|
|
|
|
#: lazarusidestrconsts.rsresourceclear
|
|
msgid "Delete all resources?"
|
|
msgstr "Usunąć wszystkie zasoby?"
|
|
|
|
#: lazarusidestrconsts.rsresourcefilename
|
|
msgctxt "lazarusidestrconsts.rsresourcefilename"
|
|
msgid "File name"
|
|
msgstr "Nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.rsresourcetype
|
|
msgctxt "lazarusidestrconsts.rsresourcetype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.rsrevision
|
|
msgid "&Revision:"
|
|
msgstr "&Rewizja:"
|
|
|
|
#: lazarusidestrconsts.rsselectaninheritedentry
|
|
#, fuzzy
|
|
msgid "Select an inherited entry"
|
|
msgstr "Inherited"
|
|
|
|
#: lazarusidestrconsts.rsshowabspath
|
|
msgid "Absolute path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsshowfilename
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.rsshowfilename"
|
|
msgid "File name"
|
|
msgstr "Nazwa pliku"
|
|
|
|
#: lazarusidestrconsts.rsshowpathmode
|
|
msgid "Path display mode (Ctrl+P)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsshowrelpath
|
|
msgid "Relative path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr "Numerowanie wersji"
|
|
|
|
#: lazarusidestrconsts.showoptions
|
|
msgid "Show options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Menu pomoc"
|
|
|
|
#: lazarusidestrconsts.srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Sterowanie"
|
|
|
|
#: lazarusidestrconsts.srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "CodeTools"
|
|
|
|
#: lazarusidestrconsts.srkmcatcolselection
|
|
msgid "Text column selection commands"
|
|
msgstr "Polecenia zaznaczania kolumn tekstu"
|
|
|
|
#: lazarusidestrconsts.srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Poruszanie kursorem"
|
|
|
|
#: lazarusidestrconsts.srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Edycja tekstu"
|
|
|
|
#: lazarusidestrconsts.srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Menu plik"
|
|
|
|
#: lazarusidestrconsts.srkmcatfold
|
|
msgid "Text folding commands"
|
|
msgstr "Polecenia zwijania tekstu"
|
|
|
|
#: lazarusidestrconsts.srkmcatmacrorecording
|
|
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
|
msgid "Macros"
|
|
msgstr "Makra"
|
|
|
|
#: lazarusidestrconsts.srkmcatmarker
|
|
msgid "Text bookmark commands"
|
|
msgstr "Polecenia zakładek w tekście"
|
|
|
|
#: lazarusidestrconsts.srkmcatmulticaret
|
|
msgid "Multi caret commands"
|
|
msgstr "Polecenia kursora wielokrotnego"
|
|
|
|
#: lazarusidestrconsts.srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr "Polecenia menu pakietu"
|
|
|
|
#: lazarusidestrconsts.srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Menu projekt"
|
|
|
|
#: lazarusidestrconsts.srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Menu uruchom"
|
|
|
|
#: lazarusidestrconsts.srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Wyszukiwanie i zastępowanie"
|
|
|
|
#: lazarusidestrconsts.srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Wybieranie tekstu"
|
|
|
|
#: lazarusidestrconsts.srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Zakładki edytora źródeł"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroedit
|
|
#, fuzzy
|
|
msgid "Syncron Editing"
|
|
msgstr "Edycja Syncron"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
|
#, fuzzy
|
|
msgid "Syncron Editing (not in Cell)"
|
|
msgstr "Edycja Syncron"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
|
msgid "Syncron Editing (while selecting)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateedit
|
|
msgid "Template Editing"
|
|
msgstr "Edycja szablonu"
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateeditoff
|
|
#, fuzzy
|
|
msgid "Template Editing (not in Cell)"
|
|
msgstr "Edycja szablonu"
|
|
|
|
#: lazarusidestrconsts.srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Menu narzędzia"
|
|
|
|
#: lazarusidestrconsts.srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Menu widok"
|
|
|
|
#: lazarusidestrconsts.srkmcommand
|
|
msgctxt "lazarusidestrconsts.srkmcommand"
|
|
msgid "Command:"
|
|
msgstr "Polecenie:"
|
|
|
|
#: lazarusidestrconsts.srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Konflikt "
|
|
|
|
#: lazarusidestrconsts.srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "przerwij budowanie"
|
|
|
|
#: lazarusidestrconsts.srkmecabstractmethods
|
|
msgid "Abstract Methods ..."
|
|
msgstr "Metody abstrakcyjne ..."
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpaddress
|
|
msgid "add address breakpoint"
|
|
msgstr "dodaj pułapkę w adresie"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpsource
|
|
msgid "add source breakpoint"
|
|
msgstr "dodaj pułapkę w źródle"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
|
msgid "add data/watchpoint"
|
|
msgstr "dodaj pułapkę danych"
|
|
|
|
#: lazarusidestrconsts.srkmecaddjumppoint
|
|
msgid "Add Jump Point"
|
|
msgstr "Dodaj punkt skoku do historii"
|
|
|
|
#: lazarusidestrconsts.srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "dodaj zmienną"
|
|
|
|
#: lazarusidestrconsts.srkmecattach
|
|
msgid "Attach to program"
|
|
msgstr "Dołącz do programu"
|
|
|
|
#: lazarusidestrconsts.srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Dokończenie szablonu kodu"
|
|
|
|
#: lazarusidestrconsts.srkmecblockcopy
|
|
msgid "Copy Block"
|
|
msgstr "Kopiuj blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockdelete
|
|
msgid "Delete Block"
|
|
msgstr "Usuń blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotobegin
|
|
msgid "Goto Block begin"
|
|
msgstr "Przejdź do początku bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotoend
|
|
msgid "Goto Block end"
|
|
msgstr "Przejdź na koniec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockhide
|
|
msgid "Hide Block"
|
|
msgstr "Ukryj blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockindent
|
|
msgid "Indent block"
|
|
msgstr "Zwiększ wcięcie bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockmove
|
|
msgid "Move Block"
|
|
msgstr "Przenieś blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetbegin
|
|
msgid "Set block begin"
|
|
msgstr "Ustaw początek bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetend
|
|
msgid "Set block end"
|
|
msgstr "Ustaw koniec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockshow
|
|
msgid "Show Block"
|
|
msgstr "Pokaż blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblocktogglehide
|
|
msgid "Toggle block"
|
|
msgstr "Przełącz blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindent
|
|
msgid "Unindent block"
|
|
msgstr "Zmniejsz wcięcie bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "buduj program/projekt"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "zbuduj plik"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildlazarus
|
|
msgid "Build Lazarus"
|
|
msgstr "Buduj Lazarusa"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildmanymodes
|
|
msgid "build many modes"
|
|
msgstr "buduj wiele trybów"
|
|
|
|
#: lazarusidestrconsts.srkmecchar
|
|
msgid "Char"
|
|
msgstr "Znak"
|
|
|
|
#: lazarusidestrconsts.srkmeccleanupandbuild
|
|
msgid "clean up and build"
|
|
msgstr "czyść i buduj"
|
|
|
|
#: lazarusidestrconsts.srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Usuń cały tekst"
|
|
|
|
#: lazarusidestrconsts.srkmecclearallbookmark
|
|
msgid "Clear all Bookmarks"
|
|
msgstr "Usuń wszystkie zakładki"
|
|
|
|
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
|
msgid "Clear Bookmarks for current file"
|
|
msgstr "Usun zakładki w aktualnym pliku"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseldown
|
|
#, fuzzy
|
|
msgid "Column Select Down"
|
|
msgstr "Zaznacz tekst (Tryb kolumn)"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
|
#, fuzzy
|
|
msgid "Column Select to absolute end"
|
|
msgstr "Wybierz do końca"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditortop
|
|
#, fuzzy
|
|
msgid "Column Select to absolute beginning"
|
|
msgstr "Wybierz do początku"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselleft
|
|
#, fuzzy
|
|
msgid "Column Select Left"
|
|
msgstr "Zaznacz tekst (Tryb kolumn)"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellineend
|
|
#, fuzzy
|
|
msgid "Column Select Line End"
|
|
msgstr "Wybierz do końca linii"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinestart
|
|
#, fuzzy
|
|
msgid "Column Select Line Start"
|
|
msgstr "Wybierz do początku linii"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
|
#, fuzzy
|
|
msgid "Column Select to text start in line"
|
|
msgstr "Wybierz do początku linii"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagebottom
|
|
#, fuzzy
|
|
msgid "Column Select Page Bottom"
|
|
msgstr "Wybierz dół strony"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagedown
|
|
#, fuzzy
|
|
msgid "Column Select Page Down"
|
|
msgstr "Wybierz stronę w dół"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagetop
|
|
#, fuzzy
|
|
msgid "Column Select Page Top"
|
|
msgstr "Wybierz górę strony"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpageup
|
|
#, fuzzy
|
|
msgid "Column Select Page Up"
|
|
msgstr "Wybierz stronę w górę"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselright
|
|
#, fuzzy
|
|
msgid "Column Select Right"
|
|
msgstr "Zaznacz tekst (Tryb kolumn)"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselup
|
|
#, fuzzy
|
|
msgid "Column Select Up"
|
|
msgstr "Wybierz w górę"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordleft
|
|
#, fuzzy
|
|
msgid "Column Select Word Left"
|
|
msgstr "Wybierz słowo po lewej"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordright
|
|
#, fuzzy
|
|
msgid "Column Select Word Right"
|
|
msgstr "Wybierz słowo po prawej"
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Tryb wyboru kolumn"
|
|
|
|
#: lazarusidestrconsts.srkmeccompile
|
|
msgid "compile program/project"
|
|
msgstr "kompiluj program/projekt"
|
|
|
|
#: lazarusidestrconsts.srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "konfiguruj \"buduj plik\""
|
|
|
|
#: lazarusidestrconsts.srkmeccopy
|
|
msgctxt "lazarusidestrconsts.srkmeccopy"
|
|
msgid "Copy"
|
|
msgstr "Kopiuj"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyadd
|
|
msgid "Copy (Add to Clipboard)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyaddcurrentline
|
|
msgid "Copy current line (Add to Clipboard)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopycurrentline
|
|
msgid "Copy current line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
|
msgid "Copy editor to new window"
|
|
msgstr "Kopiuj edytor do nowego okna"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
|
msgid "Copy editor to next free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
|
msgid "Copy editor to prior free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccut
|
|
msgctxt "lazarusidestrconsts.srkmeccut"
|
|
msgid "Cut"
|
|
msgstr "Wytnij"
|
|
|
|
#: lazarusidestrconsts.srkmeccutadd
|
|
msgid "Cut (Add to Clipboard)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccutaddcurrentline
|
|
msgid "Cut current line (Add to Clipboard)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccutcurrentline
|
|
msgid "Cut current line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Usuń do początku wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Usuń znak przy kursorze"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Usuń do końca wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Usuń ostatni znak"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Usuń do początku słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Usuń bieżący wiersz"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Usuń do końca słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecdetach
|
|
msgid "Detach from program"
|
|
msgstr "Odłącz od programu"
|
|
|
|
#: lazarusidestrconsts.srkmecdiff
|
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
|
msgid "Diff"
|
|
msgstr "Diff"
|
|
|
|
#: lazarusidestrconsts.srkmecdown
|
|
msgid "Move cursor down"
|
|
msgstr "Przesuń kursor w dół"
|
|
|
|
#: lazarusidestrconsts.srkmecduplicateline
|
|
msgid "Duplicate line (or lines in selection)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecduplicateselection
|
|
msgid "Duplicate selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Przesuń kursor na koniec"
|
|
|
|
#: lazarusidestrconsts.srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Przesuń kursor na początek"
|
|
|
|
#: lazarusidestrconsts.srkmecemptymethods
|
|
msgid "Empty Methods ..."
|
|
msgstr "Puste metody..."
|
|
|
|
#: lazarusidestrconsts.srkmecenvironmentoptions
|
|
msgid "IDE options"
|
|
msgstr "Opcje IDE"
|
|
|
|
#: lazarusidestrconsts.srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr "sprawdź/modyfikuj"
|
|
|
|
#: lazarusidestrconsts.srkmecextractproc
|
|
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
|
msgid "Extract Procedure"
|
|
msgstr "Zaznacz i wydziel procedurę"
|
|
|
|
#: lazarusidestrconsts.srkmecexttool
|
|
#, object-pascal-format
|
|
msgid "External tool %d"
|
|
msgstr "Zewnętrzne narzędzie %d"
|
|
|
|
#: lazarusidestrconsts.srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Ustawienia zewnętrznych narzędzi"
|
|
|
|
#: lazarusidestrconsts.srkmecfind
|
|
msgid "Find Text"
|
|
msgstr "Znajdź tekst"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Znajdź drugi koniec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Znajdź początek bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecfinddeclaration
|
|
msgid "Find Declaration"
|
|
msgstr "Znajdź deklarację"
|
|
|
|
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
|
msgid "Find Identifier References"
|
|
msgstr "Znajdź referencje do identyfikatora"
|
|
|
|
#: lazarusidestrconsts.srkmecfindinfiles
|
|
msgid "Find in Files"
|
|
msgstr "Przeszukaj pliki"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnext
|
|
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
|
msgid "Find Next"
|
|
msgstr "Znajdź następne"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
|
msgid "Find Next Word Occurrence"
|
|
msgstr "Znajdź następne wystąpienie słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloads
|
|
msgid "Find Overloads"
|
|
msgstr "Znajdź przeciążenia"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
|
msgid "Find Overloads ..."
|
|
msgstr "Znajdź przeciążenia ..."
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevious
|
|
msgid "Find Previous"
|
|
msgstr "Znajdź poprzednie"
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
|
msgid "Find Previous Word Occurrence"
|
|
msgstr "Znajdź poprzednie wystąpienie słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
|
msgid "Find Procedure Definiton"
|
|
msgstr "Znajdź definicję procedury"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduremethod
|
|
msgid "Find Procedure Method"
|
|
msgstr "Znajdź metodę-procedurę"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldcurrent
|
|
msgid "Fold at Cursor"
|
|
msgstr "Zwiń przy kursorze"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldlevel
|
|
#, object-pascal-format
|
|
msgid "Fold to Level %d"
|
|
msgstr "Zwiń do poziomu %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoeditor
|
|
#, object-pascal-format
|
|
msgid "Go to editor %d"
|
|
msgstr "Przejdź do edytora %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoincludedirective
|
|
msgid "Go to include directive of current include file"
|
|
msgstr "Przejdź do dyrektywy include dla wstawianego pliku"
|
|
|
|
#: lazarusidestrconsts.srkmecgotolinenumber
|
|
msgid "Go to Line Number"
|
|
msgstr "Przejdź do wiersza numer"
|
|
|
|
#: lazarusidestrconsts.srkmecgotomarker
|
|
#, object-pascal-format
|
|
msgid "Go to bookmark %d"
|
|
msgstr "Przejdź do zakładki %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Idź do XY"
|
|
|
|
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
|
msgid "Guess Misplaced $IFDEF"
|
|
msgstr "Znajdź niepotrzebną dyrektywę $IFDEF"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordleft
|
|
msgid "Move cursor part-word left (e.g. CamelCase)"
|
|
msgstr "Przesuń kursor w lewo o część słowa (CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordright
|
|
msgid "Move cursor part-word right (e.g. CamelCase)"
|
|
msgstr "Przesuń kursor w prawo o część słowa (CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr "Ime Str"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "Wstaw element dziennika zmian"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Wstaw znak specjalny"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "Wstaw słowo kluczowe CVS: Author"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "Wstaw słowo kluczowe CVS: Date"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "Wstaw słowo kluczowe CVS: Header"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "Wstaw słowo kluczowe CVS: ID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "Wstaw słowo kluczowe CVS: Log"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "Wstaw słowo kluczowe CVS: Name"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "Wstaw słowo kluczowe CVS: Revision"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "Wstaw słowo kluczowe CVS: Source"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Wstaw bieżącą datę i czas"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertfilename
|
|
msgid "Insert Full Filename"
|
|
msgstr "Wstaw pełną nazwę pliku"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "Wstaw informację o licencji GPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
|
msgid "Insert GPL notice (translated)"
|
|
msgstr "Informacja o licencji GPL (tłumaczenie)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr "Identyfikator GUID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "Wstaw informację o licencji LGPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
|
msgid "Insert LGPL notice (translated)"
|
|
msgstr "Informacja o licencji LGPL (tłumaczenie)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Zawiń wiersz i pozostaw kursor"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnotice
|
|
msgid "Insert MIT notice"
|
|
msgstr "Wstaw oświadczenie MIT"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
|
msgid "Insert MIT notice (translated)"
|
|
msgstr "Wstaw informacja o licencji MIT (tłumaczenie)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Tryb wstawiania"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr "Wstaw zmodyfikowane ogłoszenie LGPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
|
msgid "Insert modified LGPL notice (translated)"
|
|
msgstr "Informacja o licencji LGPL (tłumaczenie)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Wstaw bieżącą nazwę użytkownika"
|
|
|
|
#: lazarusidestrconsts.srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "badaj"
|
|
|
|
#: lazarusidestrconsts.srkmecinvertassignment
|
|
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Odwróć przyporządkowanie"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapleft
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
|
msgid "Left"
|
|
msgstr "W lewo"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapright
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
|
msgid "Right"
|
|
msgstr "W prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecleft
|
|
msgid "Move cursor left"
|
|
msgstr "Przesuń kursor w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Zawiń wiersz i przenieś kursor"
|
|
|
|
#: lazarusidestrconsts.srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Przesuń kursor na koniec wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Tryb wyboru linii"
|
|
|
|
#: lazarusidestrconsts.srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Przesuń kursor na początek wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmeclinetextstart
|
|
msgid "Move cursor to text start in line"
|
|
msgstr "Przesuń kursor na początek tekstu w wierszu"
|
|
|
|
#: lazarusidestrconsts.srkmeclockeditor
|
|
msgid "Lock Editor"
|
|
msgstr "Zablokuj edytor"
|
|
|
|
#: lazarusidestrconsts.srkmecmakeresourcestring
|
|
msgid "Make Resource String"
|
|
msgstr "Utwórz łańcuch w zasobach"
|
|
|
|
#: lazarusidestrconsts.srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Przejdź do pasującego nawiasu"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Przesuń edytor w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr "Przesuń edytor najbardziej w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
|
msgid "Move editor to new window"
|
|
msgstr "Przenieś edytor do nowego okna"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
|
msgid "Move editor to next free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
|
msgid "Move editor to prior free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Przesuń edytor w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr "Przesuń edytor najbardziej w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecmovelinedown
|
|
msgid "Move line down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmovelineup
|
|
msgid "Move line up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectdown
|
|
msgid "Move selection down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectleft
|
|
msgid "Move selection left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectright
|
|
msgid "Move selection right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectup
|
|
msgid "Move selection up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmultipaste
|
|
msgctxt "lazarusidestrconsts.srkmecmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr "Wklej do wielu wierszy"
|
|
|
|
#: lazarusidestrconsts.srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Następna zakładka"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Przejdź do następnego edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
|
msgid "Go to next editor in history"
|
|
msgstr "Przejdź do następnego edytora w historii"
|
|
|
|
#: lazarusidestrconsts.srkmecnextsharededitor
|
|
msgid "Go to next editor with same Source"
|
|
msgstr "Przejdź do następnego edytora z tym samym źródłem"
|
|
|
|
#: lazarusidestrconsts.srkmecnextwindow
|
|
msgid "Go to next window"
|
|
msgstr "Przejdź do następnego okna"
|
|
|
|
#: lazarusidestrconsts.srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Normalny tryb wyboru"
|
|
|
|
#: lazarusidestrconsts.srkmecopenfileatcursor
|
|
msgid "Open File at Cursor"
|
|
msgstr "Otwórz plik jeśli kursor jest przed jego nazwą"
|
|
|
|
#: lazarusidestrconsts.srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Tryb nadpisywania"
|
|
|
|
#: lazarusidestrconsts.srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Przesuń kursor na dół strony"
|
|
|
|
#: lazarusidestrconsts.srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Przesuń kursor o 1 stronę"
|
|
|
|
#: lazarusidestrconsts.srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Przesuń kursor w lewo o 1 stronę"
|
|
|
|
#: lazarusidestrconsts.srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Przesuń kursor w prawo o 1 stronę"
|
|
|
|
#: lazarusidestrconsts.srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Przesuń kursor na górę strony"
|
|
|
|
#: lazarusidestrconsts.srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Przesuń kursor o stronę wyżej"
|
|
|
|
#: lazarusidestrconsts.srkmecpaste
|
|
msgctxt "lazarusidestrconsts.srkmecpaste"
|
|
msgid "Paste"
|
|
msgstr "Wklej"
|
|
|
|
#: lazarusidestrconsts.srkmecpasteascolumns
|
|
msgid "Paste (as Columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpause
|
|
msgid "pause program"
|
|
msgstr "przerwij działanie programu"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
|
msgid "Clear all extra carets"
|
|
msgstr "Usuń wszystkie dodatkowe kursory"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
|
msgid "Cursor keys clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
|
msgid "Cursor keys move all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
|
msgid "Add extra caret"
|
|
msgstr "Dodaj dodatkowy kursor"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
|
msgid "Toggle extra caret"
|
|
msgstr "Przełącz dodatkowy kursor"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
|
msgid "Remove extra caret"
|
|
msgstr "Usuń dodatkowy kursor"
|
|
|
|
#: lazarusidestrconsts.srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Poprzednia zakładka"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Przejdź do poprzedniego edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
|
msgid "Go to previous editor in history"
|
|
msgstr "Przejdź do edytora poprzedniego w historii"
|
|
|
|
#: lazarusidestrconsts.srkmecprevsharededitor
|
|
msgid "Go to prior editor with same Source"
|
|
msgstr "Przejdź do poprzedniego edytora z tym samym źródłem"
|
|
|
|
#: lazarusidestrconsts.srkmecprevwindow
|
|
msgid "Go to prior window"
|
|
msgstr "Przejdź do poprzedniego okna"
|
|
|
|
#: lazarusidestrconsts.srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "szybka kompilacja, bez łączenia"
|
|
|
|
#: lazarusidestrconsts.srkmecremovebreakpoint
|
|
msgid "remove breakpoint"
|
|
msgstr "usuń pułapkę"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveemptymethods
|
|
msgid "Remove Empty Methods"
|
|
msgstr "Usuń puste metody"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveunusedunits
|
|
msgid "Remove Unused Units"
|
|
msgstr "Usuń nieużywane moduły"
|
|
|
|
#: lazarusidestrconsts.srkmecrenameidentifier
|
|
msgid "Rename Identifier"
|
|
msgstr "Zmień nazwę identyfikatora"
|
|
|
|
#: lazarusidestrconsts.srkmecreplace
|
|
msgid "Replace Text"
|
|
msgstr "Zastąp tekst"
|
|
|
|
#: lazarusidestrconsts.srkmecreportingbug
|
|
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
|
msgid "Reporting a bug"
|
|
msgstr "Zgłaszanie błędu"
|
|
|
|
#: lazarusidestrconsts.srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "zresetuj odpluskwiacz"
|
|
|
|
#: lazarusidestrconsts.srkmecright
|
|
msgid "Move cursor right"
|
|
msgstr "Przesuń kursor w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecrun
|
|
msgid "run program"
|
|
msgstr "uruchom program"
|
|
|
|
#: lazarusidestrconsts.srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "uruchom plik"
|
|
|
|
#: lazarusidestrconsts.srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "parametry uruchomienia"
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithdebugging
|
|
msgid "run with debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithoutdebugging
|
|
msgid "run without debugging"
|
|
msgstr "uruchom bez odpluskwiacza"
|
|
|
|
#: lazarusidestrconsts.srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Przewiń w dół o jedną linię"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Przewiń w lewo o jeden znak"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Przewiń w prawo o jeden znak"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Przewiń w górę o jedną linię"
|
|
|
|
#: lazarusidestrconsts.srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Wybierz w dół"
|
|
|
|
#: lazarusidestrconsts.srkmecselectall
|
|
msgctxt "lazarusidestrconsts.srkmecselectall"
|
|
msgid "Select All"
|
|
msgstr "Zaznacz wszystko"
|
|
|
|
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Zamień znaki tabulacji na spacje w zaznaczonym tekście"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Wybierz do końca"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Wybierz do początku"
|
|
|
|
#: lazarusidestrconsts.srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr "Wybierz do XY"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordleft
|
|
msgid "Select part-word left (e.g. CamelCase)"
|
|
msgstr "Przesuń kursor w lewo o część słowa (CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordright
|
|
msgid "Select part-word right (e.g. CamelCase)"
|
|
msgstr "Przesuń kursor w prawo o część słowa (CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecselleft
|
|
msgid "Select Left"
|
|
msgstr "Wybierz stronę w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecsellineend
|
|
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
|
msgid "Select Line End"
|
|
msgstr "Wybierz do końca linii"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinestart
|
|
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Wybierz do początku linii"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinetextstart
|
|
msgid "Select to text start in line"
|
|
msgstr "Przesuń kursor na początek tekstu w wierszu"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagebottom
|
|
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Wybierz dół strony"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Wybierz stronę w dół"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Wybierz stronę w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "Wybierz stronę w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagetop
|
|
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Wybierz górę strony"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Wybierz stronę w górę"
|
|
|
|
#: lazarusidestrconsts.srkmecselright
|
|
msgid "Select Right"
|
|
msgstr "Wybierz stronę w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecselsmartwordleft
|
|
msgid "Smart select word left (start/end of word)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselsmartwordright
|
|
msgid "Smart select word right (start/end of word)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselsticky
|
|
#, fuzzy
|
|
msgid "Start sticky selecting"
|
|
msgstr ". zaczynając od "
|
|
|
|
#: lazarusidestrconsts.srkmecselstickycol
|
|
msgid "Start sticky selecting (Columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickyline
|
|
#, fuzzy
|
|
msgid "Start sticky selecting (Line)"
|
|
msgstr "Ignoruj spacje na początku wiersza"
|
|
|
|
#: lazarusidestrconsts.srkmecselstickystop
|
|
#, fuzzy
|
|
msgid "Stop sticky selecting"
|
|
msgstr "zatrzymaj program"
|
|
|
|
#: lazarusidestrconsts.srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Wybierz w górę"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendleft
|
|
msgid "Select word-end left"
|
|
msgstr "Przesuń kursor na koniec słowa w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendright
|
|
msgid "Select word-end right"
|
|
msgstr "Przesuń kursor na koniec słowa w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordleft
|
|
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Wybierz słowo po lewej"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordright
|
|
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Wybierz słowo po prawej"
|
|
|
|
#: lazarusidestrconsts.srkmecsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
|
msgid "Set a free Bookmark"
|
|
msgstr "Załóż zakładkę"
|
|
|
|
#: lazarusidestrconsts.srkmecsetmarker
|
|
#, object-pascal-format
|
|
msgid "Set bookmark %d"
|
|
msgstr "Ustaw zakładkę %d"
|
|
|
|
#: lazarusidestrconsts.srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr "Shift tab"
|
|
|
|
#: lazarusidestrconsts.srkmecshowabstractmethods
|
|
msgid "Show Abstract Methods"
|
|
msgstr "Pokaż metody abstrakcyjne"
|
|
|
|
#: lazarusidestrconsts.srkmecshowcodecontext
|
|
msgid "Show Code Context"
|
|
msgstr "Pokaż kontekst źródła"
|
|
|
|
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
|
msgid "show execution point"
|
|
msgstr "pokaż punkt wykonywania"
|
|
|
|
#: lazarusidestrconsts.srkmecsmartwordleft
|
|
msgid "Smart move cursor left (start/end of word)"
|
|
msgstr "Przesuń kursor na początek/koniec słowa w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecsmartwordright
|
|
msgid "Smart move cursor right (start/end of word)"
|
|
msgstr "Przesuń kursor na początek/koniec słowa w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "zatrzymaj program"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacroplay
|
|
msgid "Play Macro"
|
|
msgstr "Odtwórz makro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacrorecord
|
|
msgid "Record Macro"
|
|
msgstr "Nagraj makro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
|
msgid "Select Cell"
|
|
msgstr "Zaznacz komórkę"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Następna komórka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Następna komórka (wszystkie zaznaczone)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr "Następna komórka (tylko pierwsze)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr "Następna komórka (wszystkie zaznaczone / tylko pierwsze)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Poprzednia komórka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Poprzednia komórka (wszystkie wybrane)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr "Poprzednia komórka (tylko pierwsze)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr "Poprzednia komórka (wszystkie wybrane / tylko pierwsze)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
|
#, fuzzy
|
|
msgid "Start Syncro edit"
|
|
msgstr "&Edytuj"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
|
msgid "Select cell"
|
|
msgstr "Zaznacz komórkę"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
|
msgid "Finish"
|
|
msgstr "Koniec"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Następna komórka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
|
#, fuzzy
|
|
msgid "Next Cell (rotate)"
|
|
msgstr "Następna komórka (wszystkie zaznaczone)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Następna komórka (wszystkie zaznaczone)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
|
#, fuzzy
|
|
msgid "Next Cell (rotate / all selected)"
|
|
msgstr "Następna komórka (wszystkie zaznaczone)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr "Następna komórka (tylko pierwsze)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
|
msgid "Next Cell (rotate / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr "Następna komórka (wszystkie zaznaczone / tylko pierwsze)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
|
msgid "Next Cell (rotate / all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Poprzednia komórka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Poprzednia komórka (wszystkie wybrane)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr "Poprzednia komórka (tylko pierwsze)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr "Poprzednia komórka (wszystkie wybrane / tylko pierwsze)"
|
|
|
|
#: lazarusidestrconsts.srkmecsyntaxcheck
|
|
msgid "Syntax Check"
|
|
msgstr "Sprawdzenie składni"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleassembler
|
|
msgid "View assembler"
|
|
msgstr "Pokaż assembler"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoint
|
|
msgid "toggle breakpoint"
|
|
msgstr "przełącz punkt kontroli"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpointenabled
|
|
msgid "enable/disable breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Pokaż punkty kontroli"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Pokaż stos wywołań"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr "Pokaż przeglądarkę kodu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "Pokaż eksploratora kodu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Pokaz paletę komponentów"
|
|
|
|
#: lazarusidestrconsts.srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Pokaż wyjście debuggera"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Przełącz pomiędzy formularzem a kodem"
|
|
|
|
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr "Pokaż dokumentację edytora"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
|
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
|
msgid "View IDE speed buttons"
|
|
msgstr "Pokaż przyciski IDE"
|
|
|
|
#: lazarusidestrconsts.srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Pokaż zmienne lokalne"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarker
|
|
#, object-pascal-format
|
|
msgid "Toggle bookmark %d"
|
|
msgstr "Przełącz zakładkę %d"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarkupword
|
|
#, fuzzy
|
|
msgid "Toggle Current-Word highlight"
|
|
msgstr "Podświetl bieżący wyraz"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Pokaż komunikaty"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Przełącz tryb"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Pokaż inspektora obiektów"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleregisters
|
|
msgid "View registers"
|
|
msgstr "Pokaż rejestry"
|
|
|
|
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr "Pokaż przeglądarkę ograniczeń"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Pokaż wyniki wyszukiwania"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Pokaż edytor źródeł"
|
|
|
|
#: lazarusidestrconsts.srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Pokaż zmienne"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldall
|
|
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Cofnij wszystkie zwinięcia"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldcurrent
|
|
msgid "Unfold at Cursor"
|
|
msgstr "Cofnij zwinięcia od kursora"
|
|
|
|
#: lazarusidestrconsts.srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "nieznane polecenie edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecunusedunits
|
|
msgid "Unused Units ..."
|
|
msgstr "Nieużywane moduły ..."
|
|
|
|
#: lazarusidestrconsts.srkmecup
|
|
msgid "Move cursor up"
|
|
msgstr "Przesuń kursor w górę"
|
|
|
|
#: lazarusidestrconsts.srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Pokaż zakotwiczenie edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr "Pokaż komponenty"
|
|
|
|
#: lazarusidestrconsts.srkmecvieweditormacros
|
|
msgid "View editor macros"
|
|
msgstr "Pokaż makra edytora"
|
|
|
|
#: lazarusidestrconsts.srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Pokaż formularze"
|
|
|
|
#: lazarusidestrconsts.srkmecviewhistory
|
|
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
|
msgid "View History"
|
|
msgstr "Pokaż historię"
|
|
|
|
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
|
msgid "View console in/output"
|
|
msgstr "Pokaż konsolę wejścia/wyjścia"
|
|
|
|
#: lazarusidestrconsts.srkmecviewtaborder
|
|
msgid "View Tab Order"
|
|
msgstr "Pokaż kolejność kontrolek"
|
|
|
|
#: lazarusidestrconsts.srkmecviewthreads
|
|
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Pokaż wątki"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Pokaż zależności modułu"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Pokaż informacje o module"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Pokaż moduły"
|
|
|
|
#: lazarusidestrconsts.srkmecwordcompletion
|
|
msgid "Word Completion"
|
|
msgstr "Uzupełnianie słowa"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendleft
|
|
msgid "Move cursor word-end left"
|
|
msgstr "Przesuń kursor na początek słowa w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendright
|
|
msgid "Move cursor word-end right"
|
|
msgstr "Przesuń kursor na koniec słowa w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Przesuń kursor o słowo w lewo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Przesuń kursor o słowo w prawo"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomin
|
|
msgid "Zoom in"
|
|
msgstr "Powiększenie"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomout
|
|
msgid "Zoom out"
|
|
msgstr "Pomniejszenie"
|
|
|
|
#: lazarusidestrconsts.srkmeditforcmd
|
|
#, fuzzy
|
|
msgid "Edit keys of command"
|
|
msgstr "(ustawianie klawiszy)"
|
|
|
|
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
|
msgid "Continue with next mouse up action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldcomments
|
|
msgid "Fold comments"
|
|
msgstr "Zwiń komentarze"
|
|
|
|
#: lazarusidestrconsts.synffoldcommentsinselection
|
|
msgid "Fold comments in selection"
|
|
msgstr "Zwiń komentarze w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdef
|
|
msgid "Fold inactive Ifdef"
|
|
msgstr "Zwiń nieaktywne ifdef"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
|
msgid "Fold inactive Ifdef (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
|
msgid "Fold inactive Ifdef in selection"
|
|
msgstr "Zwiń nieaktywne ifdef w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
|
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfhidecomments
|
|
msgid "Hide comments"
|
|
msgstr "Ukryj komentarze"
|
|
|
|
#: lazarusidestrconsts.synfhidecommentsinselection
|
|
msgid "Hide comments in selection"
|
|
msgstr "Ukryj komentarze w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
|
msgid "Match action button of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
|
msgid "Match action line of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
|
msgid "Match action modifiers of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
|
msgid "Match action pos of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
|
#, fuzzy
|
|
msgid "Search all action of mouse down"
|
|
msgstr "Standardowe, wszystkie działania (pułapka, zwijanie) przy wciśnięciu klawisza myszy"
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdef
|
|
msgid "Unfold active Ifdef"
|
|
msgstr "Rozwiń aktywne ifdef"
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
|
msgid "Unfold active Ifdef in selection"
|
|
msgstr "Rozwiń aktywne ifdef w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.synfunfoldall
|
|
msgctxt "lazarusidestrconsts.synfunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Cofnij wszystkie zwinięcia"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdef
|
|
msgid "Unfold all Ifdef"
|
|
msgstr "Rozwiń wszystkie ifdef"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
|
msgid "Unfold all Ifdef in selection"
|
|
msgstr "Rozwiń wszystkie ifdef w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallinselection
|
|
msgid "Unfold all in selection"
|
|
msgstr "Rozwiń wszystko w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.synfunfoldcomments
|
|
msgid "Unfold comments"
|
|
msgstr "Rozwiń komentarze"
|
|
|
|
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
|
msgid "Unfold comments in selection"
|
|
msgstr "Rozwiń komentarze w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
|
msgid "Unfold inactive Ifdef"
|
|
msgstr "Rozwiń nieaktywne ifdef"
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
|
msgid "Unfold inactive Ifdef in selection"
|
|
msgstr "Rozwiń nieaktywne ifdef w zaznaczeniu"
|
|
|
|
#: lazarusidestrconsts.uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "Plik jest tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "Plik \""
|
|
|
|
#: lazarusidestrconsts.uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "\" nie jest zapisywalny."
|
|
|
|
#: lazarusidestrconsts.uelocked
|
|
msgid "Locked"
|
|
msgstr "Zablokowane"
|
|
|
|
#: lazarusidestrconsts.uemacrorecording
|
|
msgid "Recording"
|
|
msgstr "Nagrywanie"
|
|
|
|
#: lazarusidestrconsts.uemacrorecordingpaused
|
|
msgid "Rec-pause"
|
|
msgstr "Wstrzymaj"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "Dodaj &zmienną przy kursorze"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
|
msgid "Add Watch&Point At Cursor"
|
|
msgstr "Dodaj &czujkę przy kursorze"
|
|
|
|
#: lazarusidestrconsts.uembookmarknset
|
|
#, object-pascal-format
|
|
msgid "Bookmark &%s: %s"
|
|
msgstr "Zakładka &%s: %s"
|
|
|
|
#: lazarusidestrconsts.uembookmarknunset
|
|
#, object-pascal-format
|
|
msgid "Bookmark &%s"
|
|
msgstr "Zakładka &%s"
|
|
|
|
#: lazarusidestrconsts.uembookmarknunsetdisabled
|
|
#, object-pascal-format
|
|
msgid "Bookmark %s"
|
|
msgstr "Zakładka %s"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpages
|
|
msgid "Close All &Other Pages"
|
|
msgstr "Zamknij wszystkie &inne strony"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesplain
|
|
msgid "Close All Other Pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesright
|
|
msgid "Close Pages on the &Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesrightplain
|
|
msgid "Close Pages on the Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "&Zamknij zakładkę"
|
|
|
|
#: lazarusidestrconsts.uemcopyfilename
|
|
msgid "Copy Filename"
|
|
msgstr "Kopiuj nazwę pliku"
|
|
|
|
#: lazarusidestrconsts.uemcopytonewwindow
|
|
msgid "Clone to New Window"
|
|
msgstr "Sklonuj do nowego okna"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindow
|
|
msgid "Clone to Other Window"
|
|
msgstr "Sklonuj do nowego okna"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Nowe okno"
|
|
|
|
#: lazarusidestrconsts.uemdebugword
|
|
msgctxt "lazarusidestrconsts.uemdebugword"
|
|
msgid "Debug"
|
|
msgstr "Odpluskwanie"
|
|
|
|
#: lazarusidestrconsts.uemencoding
|
|
msgid "Encoding"
|
|
msgstr "Kodowanie"
|
|
|
|
#: lazarusidestrconsts.uemevaluatemodify
|
|
msgid "&Evaluate/Modify ..."
|
|
msgstr "&Sprawdź/Modyfikuj..."
|
|
|
|
#: lazarusidestrconsts.uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "&Znajdź deklarację"
|
|
|
|
#: lazarusidestrconsts.uemfindinotherwindow
|
|
msgid "Find in other Window"
|
|
msgstr "Znajdź w innym oknie"
|
|
|
|
#: lazarusidestrconsts.uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Przeskocz do zakładki"
|
|
|
|
#: lazarusidestrconsts.uemgotobookmarks
|
|
msgid "Goto Bookmark ..."
|
|
msgstr "Idź do zakładki ..."
|
|
|
|
#: lazarusidestrconsts.uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr "Podświetlanie"
|
|
|
|
#: lazarusidestrconsts.ueminspect
|
|
msgctxt "lazarusidestrconsts.ueminspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Badaj..."
|
|
|
|
#: lazarusidestrconsts.ueminvertassignment
|
|
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Odwróć przyporządkowanie"
|
|
|
|
#: lazarusidestrconsts.uemlineending
|
|
msgid "Line Ending"
|
|
msgstr "Koniec linii"
|
|
|
|
#: lazarusidestrconsts.uemlockpage
|
|
msgid "&Lock Page"
|
|
msgstr "Zab&lokuj stronę"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleft
|
|
msgid "Move Page Left"
|
|
msgstr "Przesuń stronę w lewo"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleftmost
|
|
msgid "Move Page Leftmost"
|
|
msgstr "Przesuń stronę najbardziej w lewo"
|
|
|
|
#: lazarusidestrconsts.uemmovepageright
|
|
msgid "Move Page Right"
|
|
msgstr "Przesuń stronę w prawo"
|
|
|
|
#: lazarusidestrconsts.uemmovepagerightmost
|
|
msgid "Move Page Rightmost"
|
|
msgstr "Przesuń stronę najbardziej w prawo"
|
|
|
|
#: lazarusidestrconsts.uemmovetonewwindow
|
|
msgid "Move to New Window"
|
|
msgstr "Przenieś do nowego okna"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindow
|
|
msgid "Move to Other Window"
|
|
msgstr "Przenieś do innego okna"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Nowe okno"
|
|
|
|
#: lazarusidestrconsts.uemnextbookmark
|
|
msgid "Goto Next Bookmark"
|
|
msgstr "Przeskocz do następnej zakładki"
|
|
|
|
#: lazarusidestrconsts.uemodified
|
|
msgid "Modified"
|
|
msgstr "Zmienione"
|
|
|
|
#: lazarusidestrconsts.uemopenfileatcursor
|
|
msgid "&Open File at Cursor"
|
|
msgstr "&Otwórz plik jeśli kursor jest przed jego nazwą"
|
|
|
|
#: lazarusidestrconsts.uemprevbookmark
|
|
msgid "Goto Previous Bookmark"
|
|
msgstr "Przeskocz do poprzedniej zakładki"
|
|
|
|
#: lazarusidestrconsts.uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Skocz do procedury"
|
|
|
|
#: lazarusidestrconsts.uemreadonly
|
|
msgctxt "lazarusidestrconsts.uemreadonly"
|
|
msgid "Read Only"
|
|
msgstr "Tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Refaktoryzacja"
|
|
|
|
#: lazarusidestrconsts.uemsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Załóż zakładkę"
|
|
|
|
#: lazarusidestrconsts.uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Pokaż numery wierszy"
|
|
|
|
#: lazarusidestrconsts.uemsource
|
|
msgctxt "lazarusidestrconsts.uemsource"
|
|
msgid "Source"
|
|
msgstr "Źródło"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmark
|
|
msgid "&Toggle Bookmark"
|
|
msgstr "&Załóż zakładkę"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarknset
|
|
#, object-pascal-format
|
|
msgid "Toggle Bookmark &%s: %s"
|
|
msgstr "Przełącz zakładkę &%s: %s"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarknunset
|
|
#, object-pascal-format
|
|
msgid "Toggle Bookmark &%s"
|
|
msgstr "Przełącz zakładkę &%s"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarks
|
|
msgid "Toggle Bookmark ..."
|
|
msgstr "Przełącz zakładkę ..."
|
|
|
|
#: lazarusidestrconsts.uemtogglebreakpoint
|
|
msgid "Toggle &Breakpoint"
|
|
msgstr "&Przełącz pułapkę"
|
|
|
|
#: lazarusidestrconsts.uemviewcallstack
|
|
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Pokaż stos wywołań"
|
|
|
|
#: lazarusidestrconsts.uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Jeszcze nie zaimplementowane"
|
|
|
|
#: lazarusidestrconsts.uepins
|
|
msgid "INS"
|
|
msgstr "WST"
|
|
|
|
#: lazarusidestrconsts.uepovr
|
|
msgid "OVR"
|
|
msgstr "NAD"
|
|
|
|
#: lazarusidestrconsts.uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Tylko do odczytu"
|
|
|
|
#: lazarusidestrconsts.unitdepoptionsforpackage
|
|
msgid "Options for Package graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.unitdepoptionsforunit
|
|
msgid "Options for Unit graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Informacje o wersji"
|
|
|