mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-11-03 18:59:51 +01:00
22274 lines
602 KiB
Plaintext
22274 lines
602 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: Lazarus 1.x\n"
|
|
"POT-Creation-Date: \n"
|
|
"PO-Revision-Date: 2007-09-22 01:16+0700\n"
|
|
"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
|
|
"Language-Team: Indonesian <ade999@gmail.com>\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
|
|
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
|
|
msgid "Select Groups"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
|
|
msgid "Select groups to disable when breakpoint is hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
|
|
msgid "Select groups to enable when breakpoint is hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
|
|
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
|
msgid "Use predefined scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetall
|
|
msgid "Reset all settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetgutter
|
|
msgid "Reset all gutter settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmouseresettext
|
|
msgid "Reset all text settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
|
msgid "Add history point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
|
msgid "Context Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
|
msgid "Context Menu (debug)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
|
msgid "Context Menu (tab)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
|
msgid "Jumps to implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
|
msgid "Jumps to implementation/other block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
|
msgid "History back"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
|
msgid "History forward"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
|
msgid "Toggle extra Caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
|
msgid "Paste"
|
|
msgstr "Paste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
|
msgid "Continue %0:s (Bound to: %1:s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
|
msgid "Continue %0:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
|
msgid "Select text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
|
msgid "Select text (lines)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
|
msgid "Select text (tokens)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
|
msgid "Select text (words)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
|
msgid "Select text (Column mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
|
msgid "Select text (Line mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
|
msgid "Set free bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
|
msgid "Select current Line (Full)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
|
msgid "Select current Line (Text)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
|
msgid "Select current Paragraph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
|
msgid "Select current Word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
|
msgid "Reset zoom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplediff
|
|
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
|
msgid "General"
|
|
msgstr "Umum"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
|
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
|
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
|
msgid "Extended, Actions, right gutter half only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
|
msgid "Use line numbers to select lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
|
msgid "Right mouse includes caret move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
|
msgid "Text"
|
|
msgstr "Teks"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
|
msgid "Alt-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
|
msgid "Alt-Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
|
msgid "Alt Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
|
msgid "Alt Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
|
msgid "Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
|
msgid "Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
|
msgid "Drag selection (copy/paste)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
|
msgid "Extra-1 Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
|
msgid "Extra-2 Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
|
msgid "Alt Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
|
msgid "Ctrl Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
|
msgid "Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
|
msgid "Shift Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
|
msgid "Quad"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
|
msgid "Triple"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
|
msgid "Middle Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
|
msgid "Middle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
|
msgid "Extra 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
|
msgid "Extra 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
|
msgid "Left 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
|
msgid "Left 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
|
msgid "Right"
|
|
msgstr "Right"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
|
msgid "Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
|
msgid "Right Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
|
msgid "Shift-Alt-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
|
msgid "Shift-Alt-Ctrl"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
|
msgid "Shift-Alt Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
|
msgid "Shift-Alt Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
|
msgid "Shift-Ctrl Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
|
msgid "Shift-Ctrl Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
|
msgid "Shift Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
|
msgid "Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
|
msgid "Shift Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewarning
|
|
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
|
msgid "Scroll horizontal (System speed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
|
msgid "Scroll horizontal (Single line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
|
msgid "Scroll horizontal (Page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
|
msgid "Scroll horizontal (Half page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
|
msgid "Scroll horizontal (Page, less one line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
|
msgid "Scroll (System speed)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
|
msgid "Scroll (Single line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
|
msgid "Scroll (Page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
|
msgid "Scroll (Half page)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
|
msgid "Scroll (Page, less one line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
|
msgid "Zoom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfnopredefinedscheme
|
|
msgid "< None >"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfreadonlycolor
|
|
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
|
msgid "Read Only"
|
|
msgstr "Hanya Baca"
|
|
|
|
#: lazarusidestrconsts.dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Huruf kecil, huruf pertama besar"
|
|
|
|
#: lazarusidestrconsts.dlgactivedesktop
|
|
msgid "active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
|
msgid "Brackets highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
|
msgid "Code folding tree"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefault
|
|
msgid "Default Text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
|
msgid "Disabled breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
|
msgid "Enabled breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
|
msgid "Error line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
|
msgid "Execution point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
|
msgid "Folded code marker"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
|
|
msgid "Fold start-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
|
msgid "Global"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
|
msgid "Line"
|
|
msgstr "Baris"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
|
msgid "Syncron Edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
|
msgid "Template Edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
|
msgid "Text"
|
|
msgstr "Teks"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
|
msgid "Gutter Separator"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
|
|
msgid "Hide start-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
|
msgid "Incremental others"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
|
msgid "Highlight current word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
|
msgid "Incremental search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
|
msgid "Invalid breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
|
msgid "Current line highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
|
msgid "Line number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
|
msgid "Modified line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
|
msgid "Mouse link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
|
msgid "Selected Area"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
|
msgid "Active Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
|
msgid "Other Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
|
msgid "Active Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
|
msgid "Other Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
|
msgid "Text block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
|
msgid "Unknown breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
|
msgid "Word-Brackets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
|
msgid "Visualized Special Chars"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddnewmode
|
|
msgid "Add new mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr "Tambah titik koma"
|
|
|
|
#: lazarusidestrconsts.dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Sesuaikan baris atas karena komentar di depan"
|
|
|
|
#: lazarusidestrconsts.dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "Secara alfabetik"
|
|
|
|
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
|
msgid "Always visible cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Aksi file tidak jelas:"
|
|
|
|
#: lazarusidestrconsts.dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Peringatan saat kompilasi"
|
|
|
|
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
|
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgansicommenttab
|
|
msgid "Ansi (* *)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgapplicationsettings
|
|
#, fuzzy
|
|
#| msgid "Application Settings"
|
|
msgid "Application settings"
|
|
msgstr "Seting Aplikasi"
|
|
|
|
#: lazarusidestrconsts.dlgassertcode
|
|
#, fuzzy
|
|
#| msgid "Include Assertion Code"
|
|
msgid "Include assertion code"
|
|
msgstr "Sertakan Kode Assertion"
|
|
|
|
#: lazarusidestrconsts.dlgassociateddebugdesktop
|
|
msgid "Associated debug desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgassociateddebugdesktophint
|
|
msgid "If you select the desktop, the associated debug desktop will be selected as well."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Otomatis-buat form:"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateformshint
|
|
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautocreatenewforms
|
|
#, fuzzy
|
|
#| msgid "When creating new forms, add them to auto-created forms"
|
|
msgid "Auto-create new forms"
|
|
msgstr "ketika pembuatan form baru, tambahkan ke otomatis-buat form"
|
|
|
|
#: lazarusidestrconsts.dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Otomatis menghapus file"
|
|
|
|
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
|
msgid "Auto Display Function Prototypes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautohidecursor
|
|
msgid "Hide mouse when typing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoindent
|
|
msgctxt "lazarusidestrconsts.dlgautoindent"
|
|
msgid "Auto indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoindentlink
|
|
msgid "(Set up smart indent)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoindenttype
|
|
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
|
msgid "Auto indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
|
msgid "Auto remove empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Otomatis mengganti nama file ke huruf kecil"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
|
msgid "Auto save active desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
|
msgid ""
|
|
"Save active desktop on IDE close\n"
|
|
"Save debug desktop on IDE close and debug end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Form tersedia:"
|
|
|
|
#: lazarusidestrconsts.dlgavailableformshint
|
|
msgid "These forms must be created and freed in the program code."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
|
|
msgid "Avoid unnecessary jumps"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Latar belakang"
|
|
|
|
#: lazarusidestrconsts.dlgbaknosubdirectory
|
|
msgid "(no subdirectory)"
|
|
msgstr "(tidak ada sub direktori)"
|
|
|
|
#: lazarusidestrconsts.dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Nama sama (dalam subdirektori)"
|
|
|
|
#: lazarusidestrconsts.dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Disamping metode"
|
|
|
|
#: lazarusidestrconsts.dlgblockgroupoptions
|
|
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
|
msgid "Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindent
|
|
#, fuzzy
|
|
#| msgid "Block indent"
|
|
msgid "Block indent (spaces)"
|
|
msgstr "Indent blok"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentkeys
|
|
msgid "Block indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindentlink
|
|
msgid "(edit keys)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypecopy
|
|
msgid "Space/tab as prev Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypepos
|
|
msgid "Position only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypespace
|
|
msgid "Spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
|
msgid "Tabs, cut off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
|
msgid "Tabs, then spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblocktabindent
|
|
msgid "Block indent (tabs)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
|
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbrackethighlight
|
|
msgid "Bracket highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbracketmatchgroup
|
|
msgid "Matching bracket pairs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
|
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcasesensitive
|
|
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
|
msgid "&Case sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
|
msgid "orphaned file found: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccoresults
|
|
msgid "Results"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotest
|
|
msgctxt "lazarusidestrconsts.dlgccotest"
|
|
msgid "Test"
|
|
msgstr "Uji"
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestmissingppu
|
|
msgid "Test: Checking missing fpc ppu ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgccousingconfigfile
|
|
msgid "using config file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "Urutan Class"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Terakhir"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "huruf kecil"
|
|
|
|
#: lazarusidestrconsts.dlgcdtpreview
|
|
#, fuzzy
|
|
#| msgid "Preview (Max line length = 1)"
|
|
msgid "Preview (max line length = 1)"
|
|
msgstr "Peninjauan (Maks panjang baris = 1)"
|
|
|
|
#: lazarusidestrconsts.dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "Prefiks Read"
|
|
|
|
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "Akhiran Stored"
|
|
|
|
#: lazarusidestrconsts.dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "HURUF BESAR"
|
|
|
|
#: lazarusidestrconsts.dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Prefiks Variable"
|
|
|
|
#: lazarusidestrconsts.dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "Prefiks Write"
|
|
|
|
#: lazarusidestrconsts.dlgcharcasefileact
|
|
#, fuzzy
|
|
#| msgid "Save As - auto rename pascal files lower case"
|
|
msgid "Save As - auto rename Pascal files lower case"
|
|
msgstr "Simpan Sebagai - otomatis mengganti nama file pascal ke huruf kecil"
|
|
|
|
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
|
msgid "Check and Auto Save Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
|
msgid "Check packages on form create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
|
msgid "The form may require a package to work. Install such a package automatically."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Pilih file template kode (*.dci)"
|
|
|
|
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Tampilkan tombol tutup dalam notebook"
|
|
|
|
#: lazarusidestrconsts.dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Skema Warna"
|
|
|
|
#: lazarusidestrconsts.dlgcmacro
|
|
#, fuzzy
|
|
#| msgid "C Style Macros (global)"
|
|
msgid "C style macros (global)"
|
|
msgstr "Gaya Makro C (global)"
|
|
|
|
#: lazarusidestrconsts.dlgcoansistr
|
|
#, fuzzy
|
|
#| msgid "Use ansi strings"
|
|
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Gunakan Ansi Strings"
|
|
|
|
#: lazarusidestrconsts.dlgcoasmstyle
|
|
msgid "Assembler style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
|
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
|
msgid "Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcochecksandassertion
|
|
msgid "Checks and assertion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocompilercommands
|
|
msgid "Compiler Commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcocops
|
|
#, fuzzy
|
|
#| msgid "C Style Operators (*=, +=, /= and -=)"
|
|
msgid "C style operators (*=, +=, /= and -=)"
|
|
msgstr "Operator Gaya C (*=, +=, /= and -=)"
|
|
|
|
#: lazarusidestrconsts.dlgcocreatemakefile
|
|
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Buat Makefile"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugging
|
|
#, fuzzy
|
|
#| msgid "Debugging info"
|
|
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
|
msgid "Debugging"
|
|
msgstr "Debugging:"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Tambahan path Debugger (tidak ada):"
|
|
|
|
#: lazarusidestrconsts.dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Pembuatan Kode"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenableboth
|
|
msgid "Both"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablefold
|
|
msgid "Fold"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablehide
|
|
msgid "Hide"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
|
msgid "Reverse fold-order in Popup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcogdb
|
|
#, fuzzy
|
|
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
|
|
msgid "Generate debugging info for GDB (slower / increases exe-size)"
|
|
msgstr "hasilkan Info Debugging untuk GDB (Kompilasi Lambat)"
|
|
|
|
#: lazarusidestrconsts.dlgcoheaptrc
|
|
#, fuzzy
|
|
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
|
|
msgid "Use Heaptrc unit (check for mem-leaks)"
|
|
msgstr "Gunakan Unit Heaptrc"
|
|
|
|
#: lazarusidestrconsts.dlgcoincfiles
|
|
#, fuzzy
|
|
#| msgid "Include Files (-Fi):"
|
|
msgid "Include files (-Fi):"
|
|
msgstr "File Include (-Fi):"
|
|
|
|
#: lazarusidestrconsts.dlgcoinfoforgdb
|
|
msgid "Info for GDB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Pustaka (-Fl):"
|
|
|
|
#: lazarusidestrconsts.dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Penggabungan"
|
|
|
|
#: lazarusidestrconsts.dlgcoloadsavehint
|
|
#, fuzzy
|
|
#| msgid "Load/Save"
|
|
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
|
|
msgid "Compiler options can be saved to an XML file."
|
|
msgstr "Ambil/Simpan"
|
|
|
|
#: lazarusidestrconsts.dlgcolor
|
|
msgid "Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorlink
|
|
msgid "(Edit Color)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolornotmodified
|
|
msgid "Not modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolors
|
|
msgctxt "lazarusidestrconsts.dlgcolors"
|
|
msgid "Colors"
|
|
msgstr "Warna"
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Parameter baris perintah (tanpa nama aplikasi)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
|
msgid "Make default indent for new line if comment opens at column:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
|
msgid "Limit indent to"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinue
|
|
msgid "Prefix comments on linebreak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematch
|
|
msgid "Match current line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
|
msgid "Match text including \"*\" of token \"(*\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
|
msgid "Match whole line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
|
msgid "Match text after token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
|
msgid "Match text including token \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
|
msgid "Prefix new line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
|
msgid "Align Prefix at indent of previous line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
|
msgid "Align Prefix below start of comment on first comment line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
|
msgid "Do not indent prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
|
msgid "Comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
|
msgid "Extend, if matched or not matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
|
msgid "Extend, if matched or not matched (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
|
msgid "Extend, if matched"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
|
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilationandlinking
|
|
msgid "Compilation and Linking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessage
|
|
msgid "Compiler messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessages
|
|
msgid "Compiler messages language file (*.msg)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcompileroptions
|
|
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
|
msgid "Compiler Options"
|
|
msgstr "Opsi Kompilator"
|
|
|
|
#: lazarusidestrconsts.dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Lengkapi properti"
|
|
|
|
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
|
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigandtarget
|
|
msgid "Config and Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgconfigfiles
|
|
#, fuzzy
|
|
#| msgid "Config Files:"
|
|
msgid "Config files"
|
|
msgstr "File Konfig:"
|
|
|
|
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
|
msgid "Other debugging info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Kelebihan"
|
|
|
|
#: lazarusidestrconsts.dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Penguraian"
|
|
|
|
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
|
msgid "Copy/Paste with fold info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
|
msgid "Copy word on copy none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcorange
|
|
msgctxt "lazarusidestrconsts.dlgcorange"
|
|
msgid "Range"
|
|
msgstr "Jangkauan"
|
|
|
|
#: lazarusidestrconsts.dlgcorelocatable
|
|
msgid "Relocatable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosetasdefault
|
|
msgid "Set compiler options as default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcoshowerr
|
|
#, fuzzy
|
|
#| msgid "Show Errors"
|
|
msgid "Show errors"
|
|
msgstr "Tampilkan Kesalahan"
|
|
|
|
#: lazarusidestrconsts.dlgcoshowoptions
|
|
#, fuzzy
|
|
#| msgid "Show Options"
|
|
msgid "&Show Options"
|
|
msgstr "Tampilkan Opsi"
|
|
|
|
#: lazarusidestrconsts.dlgcosmartlinkable
|
|
#, fuzzy
|
|
#| msgid "Smart Linkable"
|
|
msgid "Smart linkable"
|
|
msgstr "Linkable Pintar"
|
|
|
|
#: lazarusidestrconsts.dlgcosources
|
|
#, fuzzy
|
|
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Sumber Lain (file .pp/.pas, hanya digunakan oleh IDE bukan oleh kompilator)"
|
|
|
|
#: lazarusidestrconsts.dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Tumpukan"
|
|
|
|
#: lazarusidestrconsts.dlgcostrip
|
|
#, fuzzy
|
|
#| msgid "Strip Symbols From Executable"
|
|
msgid "Strip symbols from executable"
|
|
msgstr "Hilangkan Simbol Dari Eksekutabel"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltype
|
|
msgid "Type of debug info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypeauto
|
|
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
|
msgid "Automatic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
|
msgid "Dwarf2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
|
msgid "Dwarf with sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
|
msgid "Dwarf3 (beta)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypestabs
|
|
msgid "Stabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcotrashvariables
|
|
msgid "Trash variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcounitstyle
|
|
#, fuzzy
|
|
#| msgid "Unit Style"
|
|
msgid "Unit style"
|
|
msgstr "Gaya Unit:"
|
|
|
|
#: lazarusidestrconsts.dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Hasilkan kode untuk valgrind"
|
|
|
|
#: lazarusidestrconsts.dlgcoverbosity
|
|
msgid "Verbosity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcppinline
|
|
#, fuzzy
|
|
#| msgid "C++ Styled INLINE"
|
|
msgid "C++ styled INLINE"
|
|
msgstr "Gaya C++ INLINE"
|
|
|
|
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
|
|
msgid "Create new Run Parameters settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
|
|
msgid "Ctrl-middle-click on tab closes all others"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcurlycommenttab
|
|
msgid "Curly { }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
|
msgid "Currently respected by messages window, jump history and search results."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Kursor setelah EOL"
|
|
|
|
#: lazarusidestrconsts.dlgcursorgroupoptions
|
|
msgid "Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipsselection
|
|
msgid "Cursor skips selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipstab
|
|
msgid "Cursor skips tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Ekstensi ditetapkan pemakai (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts.dlgdebugdesktop
|
|
msgid "debug"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Path dan Tipe Debugger"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Font editor default"
|
|
|
|
#: lazarusidestrconsts.dlgdefvaluecolor
|
|
msgid "Default Value"
|
|
msgstr "Nilai default"
|
|
|
|
#: lazarusidestrconsts.dlgdeletemode
|
|
msgid "Delete mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Hapus template"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopbuttons
|
|
msgid "Buttons - "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktophints
|
|
msgid "Hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopmenus
|
|
msgid "Menus - "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopname
|
|
msgid "Desktop name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsexported
|
|
msgid "%d desktop(s) successfully exported to \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsimported
|
|
msgid "%d desktop(s) successfully imported from \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
|
|
msgid "Different values background"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Arah"
|
|
|
|
#: lazarusidestrconsts.dlgdisableantialiasing
|
|
msgid "Disable anti-aliasing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
|
msgid "Distance between grid points is the smallest step when moving a control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividercolordefault
|
|
msgid "Use right margin color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividerdrawdepth
|
|
msgid "Draw divider level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolor
|
|
msgid "Nested line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolor
|
|
msgid "Line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasbeginendname
|
|
msgid "Begin/End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasprocedurename
|
|
msgid "Procedure/Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
|
msgid "Class/Struct"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
|
msgid "Class/Struct (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpastryname
|
|
msgid "Try/Except"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
|
msgid "Unit sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasusesname
|
|
msgid "Uses clause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
|
msgid "Var/Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
|
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
|
msgid "Var/Type (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
|
msgid "Draw the component's name below it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedback
|
|
msgid "Back"
|
|
msgstr "Kembali"
|
|
|
|
#: lazarusidestrconsts.dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Tebal"
|
|
|
|
#: lazarusidestrconsts.dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Sub direktori"
|
|
|
|
#: lazarusidestrconsts.dlgedcodetempl
|
|
#, fuzzy
|
|
#| msgid "Code templates"
|
|
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
|
msgid "Code Templates"
|
|
msgstr "Template kode"
|
|
|
|
#: lazarusidestrconsts.dlgedcompleteblocks
|
|
msgid "Add close statement for Pascal blocks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Ekstensi ditetapkan pemakai"
|
|
|
|
#: lazarusidestrconsts.dlgeddelayinsec
|
|
msgid "(%s sec delay)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Tampilan"
|
|
|
|
#: lazarusidestrconsts.dlgedfiles
|
|
#, fuzzy
|
|
#| msgid "Editor files"
|
|
msgid "Editor Files"
|
|
msgstr "File Editor"
|
|
|
|
#: lazarusidestrconsts.dlgedidcomlet
|
|
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
|
msgid "Identifier completion"
|
|
msgstr "Pelengkapan pengenal"
|
|
|
|
#: lazarusidestrconsts.dlgedinvert
|
|
msgid "Invert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
|
msgid "Ignore Locks, use longest unused editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
|
msgid "Ignore Locks, if editor is current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
|
msgid "Ignore Locks, if editor in current window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
|
msgid "Locked, if text in view"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
|
msgid "Unlocked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
|
msgid "Unlocked, if text in centered view"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
|
msgid "New tab, existing or new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
|
msgid "New tab in new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
|
msgid "New tab in existing window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
|
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
|
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
|
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
|
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
|
msgid "This option will use any not locked Editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
|
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
|
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedital
|
|
msgid "Italic"
|
|
msgstr "Miring"
|
|
|
|
#: lazarusidestrconsts.dlgeditorfontsize
|
|
msgid "Editor font size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditoroptions
|
|
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
|
msgid "Editor options"
|
|
msgstr "Opsi Editor"
|
|
|
|
#: lazarusidestrconsts.dlgeditschemdefaults
|
|
msgid "Scheme globals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedmisc
|
|
msgid "Misc"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedoff
|
|
msgid "Off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedon
|
|
msgid "On"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedtabindent
|
|
msgid "Tab and Indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Garis bawah"
|
|
|
|
#: lazarusidestrconsts.dlgelementattributes
|
|
msgid "Element Attributes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
|
msgid "End key jumps to nearest end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Tanya"
|
|
|
|
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Catatan: File Proyek adalah semua file dalam direktori proyek"
|
|
|
|
#: lazarusidestrconsts.dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Backup"
|
|
|
|
#: lazarusidestrconsts.dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "File"
|
|
|
|
#: lazarusidestrconsts.dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Grid"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguage
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
|
msgid "Language"
|
|
msgstr "Bahasa"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguagehint
|
|
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Garis Pemandu"
|
|
|
|
#: lazarusidestrconsts.dlgenvmisc
|
|
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Lain-lain"
|
|
|
|
#: lazarusidestrconsts.dlgenvnone
|
|
msgctxt "lazarusidestrconsts.dlgenvnone"
|
|
msgid "None"
|
|
msgstr "Tidak ada"
|
|
|
|
#: lazarusidestrconsts.dlgenvotherfiles
|
|
#, fuzzy
|
|
#| msgid "Other files"
|
|
msgid "Other Files"
|
|
msgstr "File Lain"
|
|
|
|
#: lazarusidestrconsts.dlgenvproject
|
|
#, fuzzy
|
|
#| msgid "Project"
|
|
msgid "Tabs for project"
|
|
msgstr "Proyek"
|
|
|
|
#: lazarusidestrconsts.dlgenvtype
|
|
msgctxt "lazarusidestrconsts.dlgenvtype"
|
|
msgid "Type"
|
|
msgstr "Tipe"
|
|
|
|
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
|
|
msgid "Focus messages at compilation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgextracharspacing
|
|
msgid "Extra char spacing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgextralinespacing
|
|
msgid "Extra line spacing"
|
|
msgstr "baris spasi ekstra"
|
|
|
|
#: lazarusidestrconsts.dlgextsymb
|
|
msgid "Use external gdb debug symbols file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Ekstensi file"
|
|
|
|
#: lazarusidestrconsts.dlgfiles
|
|
msgid "%s files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterall
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterall"
|
|
msgid "All files"
|
|
msgstr "Semua file"
|
|
|
|
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
|
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
|
msgid "CodeTools template file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdcifile
|
|
msgid "DCI file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiform
|
|
msgid "Delphi form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphipackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
|
msgid "Delphi package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiproject
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
|
msgid "Delphi project"
|
|
msgstr "Proyek Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
|
msgid "Delphi unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterexecutable
|
|
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
|
msgid "Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
|
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
|
|
msgid "FPC message file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterhtml
|
|
msgid "HTML files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
|
msgid "Bitmap images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespixmap
|
|
msgid "Pixmap images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespng
|
|
msgid "PNG images"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Seting Desktop Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
|
|
msgid "Editor file types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusfile
|
|
#, fuzzy
|
|
#| msgid "Lazarus File"
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
|
|
msgid "Lazarus file"
|
|
msgstr "File Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusform
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
|
|
msgid "Lazarus form"
|
|
msgstr "Form Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
|
|
msgid "Lazarus include file"
|
|
msgstr "File include Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
|
|
msgid "Lazarus other file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
|
|
msgid "Lazarus package"
|
|
msgstr "Paket Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusproject
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
|
|
msgid "Lazarus project"
|
|
msgstr "Proyek Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
|
|
msgid "Lazarus project source"
|
|
msgstr "Sumber proyek Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarussession
|
|
msgid "Lazarus session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusunit
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
|
|
msgid "Lazarus unit"
|
|
msgstr "Unit Lazarus"
|
|
|
|
#: lazarusidestrconsts.dlgfilterpascalfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
|
|
msgid "Pascal file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterprograms
|
|
msgctxt "lazarusidestrconsts.dlgfilterprograms"
|
|
msgid "Programs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterxml
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgfilterxml"
|
|
msgid "XML files"
|
|
msgstr "File XML"
|
|
|
|
#: lazarusidestrconsts.dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Cari teks di kursor"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunk
|
|
msgid "Chunk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunksect
|
|
msgid "Chunk section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlasp
|
|
msgid "ASP"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
|
msgid "Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
|
msgid "Node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmitem
|
|
msgid "Item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmlist
|
|
msgid "List <>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmobject
|
|
msgid "Object (inherited, inline)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
|
msgid "Var/Type (local)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasansicomment
|
|
msgid "Comment (* *)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasasm
|
|
msgid "Asm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasbeginend
|
|
msgid "Begin/End (nested)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasborcomment
|
|
msgid "Comment { }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpascase
|
|
msgid "Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclass
|
|
msgid "Class/Object"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclasssection
|
|
msgid "public/private"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasexcept
|
|
msgid "Except/Finally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasfordo
|
|
msgid "For/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifdef
|
|
msgid "{$IfDef}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifthen
|
|
msgid "If/Then/Else"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
|
msgid "Nested Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
|
msgid "Begin/End (procedure)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocedure
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedure"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprogram
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecord
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
|
msgid "Record"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrepeat
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
|
msgid "Repeat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
|
msgid "Comment //"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpastry
|
|
msgid "Try"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunit
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
|
msgid "Unit"
|
|
msgstr "Unit"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunitsection
|
|
msgid "Unit section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuserregion
|
|
msgid "{%Region}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuses
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasvartype
|
|
msgid "Var/Type (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswhiledo
|
|
msgid "While/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswithdo
|
|
msgid "With/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcdata
|
|
msgid "CData"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
|
msgid "Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmldoctype
|
|
msgid "DocType"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
|
msgid "Node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlprocess
|
|
msgid "Processing Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
|
msgid "The running Lazarus instance cannot accept any files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforecolor
|
|
msgid "Foreground"
|
|
msgstr "Warna latar depan"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
|
|
msgid "Change Object Inspector contents on clicking form title bar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
|
|
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Kebijakan penyisipan Procedure"
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Biarkan urutan dari procedure"
|
|
|
|
#: lazarusidestrconsts.dlgfpcexecutable
|
|
msgid "Compiler executable (e.g. %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "Direktori sumber FPC"
|
|
|
|
#: lazarusidestrconsts.dlgframecolor
|
|
msgid "Text-mark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Editor Form"
|
|
|
|
#: lazarusidestrconsts.dlgfrombeginning
|
|
msgid "From b&eginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfromcursor
|
|
msgid "&From cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggetposition
|
|
msgid "Get position"
|
|
msgstr "Ambil posisi"
|
|
|
|
#: lazarusidestrconsts.dlgglobal
|
|
msgid "&Global"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Hasilkan kode untuk gprof"
|
|
|
|
#: lazarusidestrconsts.dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Warna Penggengam"
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsdocked
|
|
msgid "Grayed desktops are for docked environment."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
|
msgid "Grayed desktops are for undocked environment."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Warna grid"
|
|
|
|
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
|
msgid "Grid consists of small dots which help aligning controls."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Besar grid X"
|
|
|
|
#: lazarusidestrconsts.dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Besar langkah grid horisontal"
|
|
|
|
#: lazarusidestrconsts.dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Besar grid Y"
|
|
|
|
#: lazarusidestrconsts.dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Besar langkah grid vertikal"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodeexplorer
|
|
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupcodetools
|
|
msgid "Codetools"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupdebugger
|
|
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
|
msgid "Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupeditor
|
|
msgid "Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupenvironment
|
|
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
|
msgid "Environment"
|
|
msgstr "Lingkungan"
|
|
|
|
#: lazarusidestrconsts.dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr "Undi Grup"
|
|
|
|
#: lazarusidestrconsts.dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Tampilkan Garis Pemandu"
|
|
|
|
#: lazarusidestrconsts.dlgguidelineshint
|
|
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutter
|
|
msgctxt "lazarusidestrconsts.dlggutter"
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
|
msgid "Collapsed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguttercolor
|
|
msgid "Gutter Color"
|
|
msgstr "Warna saluran"
|
|
|
|
#: lazarusidestrconsts.dlggutteredgecolor
|
|
msgid "Gutter Edge Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutterseparatorindex
|
|
msgid "Gutter separator index"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Gulung setengah halaman"
|
|
|
|
#: lazarusidestrconsts.dlgheapandstacksize
|
|
msgid "Heap and stack sizes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgheapsize
|
|
#, fuzzy
|
|
#| msgid "Heap Size"
|
|
msgid "Heap size"
|
|
msgstr "Besar Heap"
|
|
|
|
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
|
msgid "Height of one property in the grid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Tinggi:"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrun
|
|
msgid "Hide IDE windows on run"
|
|
msgstr "Sembunyikan jendela IDE saat menjalankan"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrunhint
|
|
msgid "Do not show the IDE at all while program is running."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
|
msgid "Hide tab in single page windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightcolor
|
|
msgid "Highlight Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightfontcolor
|
|
msgid "Highlight Font Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightleftofcursor
|
|
msgid "Left Of Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghighlightrightofcursor
|
|
msgid "Right Of Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlghintsparametersendernotused
|
|
#, fuzzy
|
|
#| msgid "Show Hints for parameter \"Sender\" not used"
|
|
msgid "Show hints for parameter \"Sender\" not used"
|
|
msgstr "Tampilkan Petunjuk untuk parameter \"Sender\" tidak digunakan"
|
|
|
|
#: lazarusidestrconsts.dlghintsunused
|
|
#, fuzzy
|
|
#| msgid "Show Hints for unused units in main source"
|
|
msgid "Show hints for unused units in main"
|
|
msgstr "Tampilkan Petunjuk untuk unit yang tidak digunakan dalam sumber utama"
|
|
|
|
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Kunci Home melompat ke awal terdekat"
|
|
|
|
#: lazarusidestrconsts.dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Aplikasi Induk"
|
|
|
|
#: lazarusidestrconsts.dlgidentifiercompletion
|
|
#, fuzzy
|
|
#| msgid "Identifier completion"
|
|
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
|
msgid "Identifier Completion"
|
|
msgstr "Pelengkapan pengenal"
|
|
|
|
#: lazarusidestrconsts.dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Kebijakan pengenal"
|
|
|
|
#: lazarusidestrconsts.dlgideoptions
|
|
msgid "IDE Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockactive
|
|
msgid "Active $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockinactive
|
|
msgid "Inactive $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
|
msgid "Included mixed state $IFDEF code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeactive
|
|
msgid "Active $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeinactive
|
|
msgid "Inactive $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
|
msgid "Included mixed state $IFDEF node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgimportdesktopexists
|
|
msgid ""
|
|
"A desktop with the same name already exists.\n"
|
|
"Please confirm the desktop name:\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Sertakan variabel sistem"
|
|
|
|
#: lazarusidestrconsts.dlgindentsindentgroupoptions
|
|
msgid "Indent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
|
msgid "Tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Di depan metode"
|
|
|
|
#: lazarusidestrconsts.dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Nama Constructor harus 'init' (destructor harus 'done')"
|
|
|
|
#: lazarusidestrconsts.dlginsertclassparts
|
|
msgid "Insert class parts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertimplementation
|
|
msgid "Implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertinterface
|
|
msgid "Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertmethods
|
|
msgid "Insert method implementations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsertsection
|
|
msgid "Insert into Uses section of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Sisipkan spasi setelah"
|
|
|
|
#: lazarusidestrconsts.dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Sisipkan spasi di depan"
|
|
|
|
#: lazarusidestrconsts.dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Interval dalam detik"
|
|
|
|
#: lazarusidestrconsts.dlgjumpcodeblockpos
|
|
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Lompatan (contoh Lompatan Metode)"
|
|
|
|
#: lazarusidestrconsts.dlgjumpsinglelinepos
|
|
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgjumptomethodbody
|
|
msgid "Jump directly to method body"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeepcursorx
|
|
msgid "Keep cursor X position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeylink
|
|
msgid "(Edit Key)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Pemetaan Kunci"
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Pemetaan kunci salah"
|
|
|
|
#: lazarusidestrconsts.dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Kebijakan Kata kunci"
|
|
|
|
#: lazarusidestrconsts.dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "Ijinkan LABEL dan GOTO"
|
|
|
|
#: lazarusidestrconsts.dlglang
|
|
msgctxt "lazarusidestrconsts.dlglang"
|
|
msgid "Language"
|
|
msgstr "Bahasa"
|
|
|
|
#: lazarusidestrconsts.dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Terakhir (contoh di akhir dari sumber)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Direktori Lazarus (default untuk semua proyek)"
|
|
|
|
#: lazarusidestrconsts.dlgleftpos
|
|
msgid "Left:"
|
|
msgstr "Kiri:"
|
|
|
|
#: lazarusidestrconsts.dlglefttopclr
|
|
#, fuzzy
|
|
#| msgid "Guid lines Left,Top"
|
|
msgid "Guide lines Left,Top"
|
|
msgstr "warna untuk kiri, atas"
|
|
|
|
#: lazarusidestrconsts.dlglevel1opt
|
|
#, fuzzy
|
|
#| msgid "Level 1 (quick and debugger friendly)"
|
|
msgid "1 (quick, debugger friendly)"
|
|
msgstr "Tingkat 1 (cepat dan ramah debugger)"
|
|
|
|
#: lazarusidestrconsts.dlglevel2opt
|
|
msgid "2 (-O1 + quick optimizations)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevel3opt
|
|
#, fuzzy
|
|
#| msgid "3 (slow optimizations)"
|
|
msgid "3 (-O2 + slow optimizations)"
|
|
msgstr "Tingkat 3 (Tingkat 2 + optimasi lambat)"
|
|
|
|
#: lazarusidestrconsts.dlglevel4opt
|
|
msgid "4 (-O3 + aggressive optimizations, beware)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglevelnoneopt
|
|
#, fuzzy
|
|
#| msgid "Level 0 (no extra optimizations)"
|
|
msgid "0 (no optimization)"
|
|
msgstr "Tingkat 0 (tidak ada Optimasi ekstra)"
|
|
|
|
#: lazarusidestrconsts.dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Pemisahan Baris"
|
|
|
|
#: lazarusidestrconsts.dlglinksmart
|
|
#, fuzzy
|
|
#| msgid "Link Smart"
|
|
msgid "Link smart"
|
|
msgstr "Link Pintar"
|
|
|
|
#: lazarusidestrconsts.dlglnumsbct
|
|
#, fuzzy
|
|
#| msgid "Display Line Numbers in Run-time Error Backtraces"
|
|
msgid "Display line numbers in run-time error backtraces"
|
|
msgstr "Tampilkan Nomor Baris dalam Penelusuran Kesalahan Run-time"
|
|
|
|
#: lazarusidestrconsts.dlgmainmenu
|
|
msgid "Main Menu"
|
|
msgstr "Menu Utama"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewforms
|
|
#, fuzzy
|
|
#| msgid "View project forms"
|
|
msgid "View Project Forms"
|
|
msgstr "Lihat form proyek"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewframes
|
|
msgid "View Project Frames"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmainviewunits
|
|
#, fuzzy
|
|
#| msgid "View project units"
|
|
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
|
msgid "View Project Units"
|
|
msgstr "Lihat unit proyek"
|
|
|
|
#: lazarusidestrconsts.dlgmakeexecutable
|
|
msgid "\"Make\" executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmanagedesktops
|
|
msgid "Manage desktops"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Margin dan saluran"
|
|
|
|
#: lazarusidestrconsts.dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Warna Penanda"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupgroup
|
|
msgid "Highlight of Word under Caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutline
|
|
msgid "Outline (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefined
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
|
msgid "User defined markup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
|
msgid "Delete"
|
|
msgstr "Hapus"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
|
msgid "Delete list \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
|
msgid "Add Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
|
msgid "Remove Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
|
msgid "Toggle Word or Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
|
msgid "Duplicate Term"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
|
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
|
msgid "Add/Remove in all editors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
|
msgid "Delete list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
|
msgid "Name"
|
|
msgstr "Nama"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
|
msgid "Add list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
|
msgid "Case sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
|
msgid "Set bound at term end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
|
msgid "Set bound at term start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
|
msgid "Ignore bounds for terms longer than"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
|
msgid "selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
|
msgid "current word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
|
msgid "Settings for terms added by key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
|
msgid "Smart match selection bounds"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
|
msgid "New list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
|
msgid "No lists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
|
msgid "Select ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
|
msgid "Key Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
|
msgid "Main settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordbracket
|
|
msgid "Word Brackets on caret (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
|
msgid "Match whole words, if length is less or equal to:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
|
msgid "Ignore keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
|
msgid "Disable timer for markup current word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordtrim
|
|
msgid "Trim spaces (when highlighting current selection)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Penghitung maksimum"
|
|
|
|
#: lazarusidestrconsts.dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Maks panjang baris:"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Maks file terbaru"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Maks file proyek terbaru"
|
|
|
|
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Campur metode dan properti"
|
|
|
|
#: lazarusidestrconsts.dlgmode
|
|
msgid "Mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseaction
|
|
msgid "Mouse Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
|
msgid "Single"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
|
msgid "Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn3
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
|
msgid "Triple"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn4
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
|
msgid "Quad"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnany
|
|
msgid "Any"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
|
msgid "Extra 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
|
msgid "Extra 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
|
msgid "Left"
|
|
msgstr "Left"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
|
msgid "Middle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
|
msgid "Make Fallback"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnright
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
|
msgid "Right"
|
|
msgstr "Right"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
|
msgid "Wheel down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
|
msgid "Wheel up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcapture
|
|
msgid "Capture"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
|
msgid "Move Caret (extra)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
|
msgid "Act on Mouse up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescaction
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
|
msgid "Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
|
msgid "Click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
|
msgid "Edit Mouse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrordup
|
|
msgid "Duplicate Entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
|
msgid "This entry conflicts with an existing entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
|
msgid "Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
|
msgid "Caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
|
msgid "Context"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcount
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
|
msgid "Click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
|
msgid "Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddir
|
|
msgid "Up/Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadopt
|
|
msgid "Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadorder
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
|
msgid "Order"
|
|
msgstr "Urutan"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
|
msgid "Priority"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptions
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
|
msgid "Mouse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsadv
|
|
msgid "Advanced"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
|
msgid "IDE-Command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
|
msgid "n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
|
msgid "-"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
|
msgid "Y"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
|
msgid "Y"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeall
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
|
msgid "All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
|
msgid "Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
|
msgid "Line Changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
|
msgid "Fold Tree"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
|
msgid "Collapsed [+]"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
|
msgid "Expanded [-]"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
|
|
msgid "Overview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
|
|
msgid "Overview Mark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
|
msgid "Line Numbers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodemain
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
|
msgid "Text"
|
|
msgstr "Teks"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
|
msgid "Selection"
|
|
msgstr "Pemilihan"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptopt2label
|
|
msgid "Opt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheract
|
|
msgid "Other actions using the same button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
|
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
|
msgid "Filter Mod-Keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
|
msgid "Priority"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgs
|
|
msgctxt "lazarusidestrconsts.dlgmsgs"
|
|
msgid "Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
|
msgid "Debug"
|
|
msgstr "Debug"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
|
msgid "Error"
|
|
msgstr "Salah"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
|
msgid "Fatal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
|
msgid "Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
|
msgid "Important"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
|
msgid "Normal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
|
msgid "Note"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
|
msgid "Time and statistics"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
|
msgid "Verbose 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
|
msgid "Verbose 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
|
msgid "Warning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
|
msgid "Multi-caret (column-select) move with cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretmode
|
|
msgid "Multi-caret move with cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
|
msgid "Enable multi caret for column selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances
|
|
msgid "Multiple Lazarus instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
|
msgid "always start a new instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
|
msgid "do not allow multiple instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
|
msgid "open files in a running instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr "Pilihan Multi"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
|
msgid "Find Editor for Jump Targets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
|
msgid "Order to use for editors matching the same criteria"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
|
msgid "Most recent focused editor for this file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
|
msgid "Editor (for file) in most recent focused window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
|
msgid "Priority list of criteria to choose an editor:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinoptions
|
|
msgid "Pages and Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmultiwintabgroup
|
|
msgid "Notebook Tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Penamaan"
|
|
|
|
#: lazarusidestrconsts.dlgnewdesktop
|
|
msgid "New desktop ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
|
#, fuzzy
|
|
#| msgid "no automatic renaming"
|
|
msgid "No automatic renaming"
|
|
msgstr "Tanpa otomatis penggantian nama"
|
|
|
|
#: lazarusidestrconsts.dlgnoavailableunits
|
|
msgid "No available units to add."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnobrackethighlight
|
|
msgid "No Highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotebooktabpos
|
|
msgid "Source notebook tabs position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlineafter
|
|
#, fuzzy
|
|
#| msgid "Do not split line after:"
|
|
msgid "Do not split line after"
|
|
msgstr "Jangan pisah baris setelah:"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlinefront
|
|
#, fuzzy
|
|
#| msgid "Do not split line In front of:"
|
|
msgid "Do not split line in front of"
|
|
msgstr "Jangan pisah baris Di depan dari:"
|
|
|
|
#: lazarusidestrconsts.dlgobjinsp
|
|
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
|
msgid "Object Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoiitemheight
|
|
#, fuzzy
|
|
#| msgid "Item height"
|
|
msgid "Item height (0 = auto)"
|
|
msgstr "Tinggi item"
|
|
|
|
#: lazarusidestrconsts.dlgoimiscellaneous
|
|
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Lain-lain"
|
|
|
|
#: lazarusidestrconsts.dlgoispeedsettings
|
|
msgid "Speed settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
|
msgid "Use default Delphi settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
|
msgid "Use default Lazarus settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptimizationlevels
|
|
msgid "Optimization levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgotheroptimizations
|
|
msgid "Other optimizations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgotherunitfiles
|
|
#, fuzzy
|
|
#| msgid "Other unit files (-Fu) (delimiter is semicolon):"
|
|
msgid "Other unit files (-Fu):"
|
|
msgstr "File Unit Lain (-Fu) (Pemisah adalah titik koma):"
|
|
|
|
#: lazarusidestrconsts.dlgoverwriteblock
|
|
msgid "Overwrite block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoverwritedesktop
|
|
msgid ""
|
|
"Desktop with the name \"%s\" was found.\n"
|
|
"Should the old desktop be overwritten?\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Petunjuk untuk palet komponen"
|
|
|
|
#: lazarusidestrconsts.dlgpasext
|
|
#, fuzzy
|
|
#| msgid "Default pascal extension"
|
|
msgid "Default Pascal extension"
|
|
msgstr "Ekstensi pascal default"
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywords
|
|
msgid "Highlight control statements as keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
|
msgid "Extended Pascal Keyword Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmarkup
|
|
msgid "Markup (on caret)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
|
msgid "Matching Keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsoutline
|
|
msgid "Outline"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpassoptslinker
|
|
#, fuzzy
|
|
#| msgid "Pass options to linker (delimiter is space)"
|
|
msgid "Pass options to linker with \"-k\", delimiter is space"
|
|
msgstr "Opsi Operan Ke Penggabung (Pemisah adalah spasi)"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywords
|
|
msgid "Highlight \"String\" keyword(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
|
msgid "Default"
|
|
msgstr "Default"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
|
msgid "None"
|
|
msgstr "Tidak ada"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
|
msgid "Only \"String\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentblock
|
|
msgid "Persistent block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursor
|
|
msgid "Persistent cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Aplikasi"
|
|
|
|
#: lazarusidestrconsts.dlgpoasinvoker
|
|
msgid "as invoker (asInvoker)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoclearicon
|
|
msgid "&Clear Icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodefaulticon
|
|
msgid "Load &Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawareness
|
|
msgid "DPI awareness"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
|
msgid "off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
|
msgid "Vista-8: off, 8.1+: per monitor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
|
msgid "Vista-8: on, 8.1+: per monitor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
|
|
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenesson
|
|
msgid "on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoexecutionlevel
|
|
msgid "Execution Level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Forms"
|
|
|
|
#: lazarusidestrconsts.dlgpohighestavailable
|
|
msgid "highest available (highestAvailable)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoicon
|
|
msgid "Icon:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoicondesc
|
|
msgid "(size: %d:%d, bpp: %d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoicondescnone
|
|
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
|
msgid "(none)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoloadicon
|
|
msgid "&Load Icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpomisc
|
|
msgctxt "lazarusidestrconsts.dlgpomisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Lain-lain"
|
|
|
|
#: lazarusidestrconsts.dlgporequireadministrator
|
|
msgid "require administrator (requireAdministrator)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgporesources
|
|
msgid "Resources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgposaveicon
|
|
msgid "&Save Icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Sesi"
|
|
|
|
#: lazarusidestrconsts.dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Judul:"
|
|
|
|
#: lazarusidestrconsts.dlgpouiaccess
|
|
msgid "UI Access (uiAccess)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpouseappbundle
|
|
#, fuzzy
|
|
#| msgid "Use Application Bundle for running and debugging (Darwin only)"
|
|
msgid "Use Application Bundle for running and debugging"
|
|
msgstr "Gunakan Bundel Aplikasi untuk menjalankan dan debugging (hanya darwin)"
|
|
|
|
#: lazarusidestrconsts.dlgpouselclscaling
|
|
msgid "Use LCL scaling (Hi-DPI)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpousemanifest
|
|
#, fuzzy
|
|
#| msgid "Use manifest file to enable themes"
|
|
msgid "Use manifest resource (and enable themes)"
|
|
msgstr "Gunakan file manifest untuk menghidupkan tema (hany windows)"
|
|
|
|
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
|
msgid "Prefer double-click over single-click"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpriorities
|
|
msgid "Priorities"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgproject
|
|
msgctxt "lazarusidestrconsts.dlgproject"
|
|
msgid "Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptions
|
|
msgid "Project Options"
|
|
msgstr "Opsi Proyek"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptionsfor
|
|
msgid "Options for Project: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojfiles
|
|
#, fuzzy
|
|
#| msgid "Project files"
|
|
msgid "Project Files"
|
|
msgstr "File Proyek"
|
|
|
|
#: lazarusidestrconsts.dlgpromptonreplace
|
|
msgid "&Prompt on replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "Melengkapi properti"
|
|
|
|
#: lazarusidestrconsts.dlgpropnamecolor
|
|
msgid "Property Name"
|
|
msgstr "Nama properti"
|
|
|
|
#: lazarusidestrconsts.dlgqopenlastprj
|
|
#, fuzzy
|
|
#| msgid "Open last project at start"
|
|
msgid "Open last project and packages at start"
|
|
msgstr "Buka proyek terakhir saat mulai"
|
|
|
|
#: lazarusidestrconsts.dlgqshowborderspacing
|
|
msgid "Show border spacing"
|
|
msgstr "Tampilan ruang batas"
|
|
|
|
#: lazarusidestrconsts.dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Tampilkan grid"
|
|
|
|
#: lazarusidestrconsts.dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Menempel ke grid"
|
|
|
|
#: lazarusidestrconsts.dlgreallydeletedesktop
|
|
msgid "Really delete desktop \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr "Referensi"
|
|
|
|
#: lazarusidestrconsts.dlgregularexpressions
|
|
msgid "Regular e&xpressions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrenamedesktop
|
|
msgid "Rename desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "Ganti &Semua"
|
|
|
|
#: lazarusidestrconsts.dlgreplacewith
|
|
#, fuzzy
|
|
#| msgid "&Replace with"
|
|
msgid "Replace wit&h"
|
|
msgstr "&Ganti Dengan"
|
|
|
|
#: lazarusidestrconsts.dlgreport
|
|
msgid "Report"
|
|
msgstr "Laporan"
|
|
|
|
#: lazarusidestrconsts.dlgrightbottomclr
|
|
#, fuzzy
|
|
#| msgid "color for right, bottom"
|
|
msgid "Guide lines Right,Bottom"
|
|
msgstr "warna untuk kanan, bawah"
|
|
|
|
#: lazarusidestrconsts.dlgrightclickselects
|
|
#, fuzzy
|
|
#| msgid "Right Click selects"
|
|
msgid "Right click selects"
|
|
msgstr "Klik Kanan memilih"
|
|
|
|
#: lazarusidestrconsts.dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "Margin kanan"
|
|
|
|
#: lazarusidestrconsts.dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Direktori Pekerjaan"
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
|
msgid "Select grandchildren"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
|
#, fuzzy
|
|
#| msgid "Creation"
|
|
msgid "Rubberband Creation"
|
|
msgstr "Pembuatan"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
|
#, fuzzy
|
|
#| msgid "Selection"
|
|
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
|
msgid "Rubberband Selection"
|
|
msgstr "Pemilihan"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
|
msgid ""
|
|
"The running Lazarus instance cannot accept any files.\n"
|
|
"Do you want to open them in a new IDE instance?\n"
|
|
"\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
|
msgid "Lazarus instance is running but not responding."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Tampilan (tidak untuk win32, contoh 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
|
|
#: lazarusidestrconsts.dlgrunoenvironment
|
|
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
|
msgid "Environment"
|
|
msgstr "Lingkungan"
|
|
|
|
#: lazarusidestrconsts.dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Lokal"
|
|
|
|
#: lazarusidestrconsts.dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Variabel sistem"
|
|
|
|
#: lazarusidestrconsts.dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Gunakan tampilan"
|
|
|
|
#: lazarusidestrconsts.dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Penolakan pemakai"
|
|
|
|
#: lazarusidestrconsts.dlgrunparameters
|
|
#, fuzzy
|
|
#| msgid "Run parameters"
|
|
msgid "Run Parameters"
|
|
msgstr "Parameter Menjalankan"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
|
msgid "Save current desktop as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavedlinecolor
|
|
msgid "Saved line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Simpan info editor untuk file yang ditutup"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
|
msgid "The files are available in the \"Open Recent\" history list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Simpan info editor hanya untuk file proyek"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
|
msgid "Only files that belong to this project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavein
|
|
msgid "Save in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Gulung dengan kurang satu"
|
|
|
|
#: lazarusidestrconsts.dlgscrollgroupoptions
|
|
msgid "Scrolling"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollhint
|
|
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
|
msgid "Show scroll hint"
|
|
msgstr "Tampilkan petunjuk menggulung"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Gulung ke akhir file"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendline
|
|
#, fuzzy
|
|
#| msgid "Scroll past end of line"
|
|
msgid "Caret past end of line"
|
|
msgstr "Gulung ke akhir baris"
|
|
|
|
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
|
msgid "Search directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Pencarian dibatalkan oleh pemakai."
|
|
|
|
#: lazarusidestrconsts.dlgsearchcaption
|
|
#, fuzzy
|
|
#| msgid "Searching..."
|
|
msgid "Searching ..."
|
|
msgstr "Pencarian..."
|
|
|
|
#: lazarusidestrconsts.dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Path"
|
|
|
|
#: lazarusidestrconsts.dlgsearchscope
|
|
msgid "Search scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectallchildcontrols
|
|
msgid "Select all child controls together with their parent."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectedtext
|
|
msgid "&Selected text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktop
|
|
msgid "Set active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Set semua elemen ke default"
|
|
|
|
#: lazarusidestrconsts.dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Set elemen ke default"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "Set property Variable"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
|
msgid "The parameter name for the default setter procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
|
msgid "is prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
|
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
|
msgid "use const"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
|
msgid "If checked, the setter parameter is marked with \"const\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowallunits
|
|
msgid "Show all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
|
msgid "Show captions of non-visual components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Tampilkan procedure yang dikompilasi"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Tampilkan kondisional"
|
|
|
|
#: lazarusidestrconsts.dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Tampilkan info debug"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhints
|
|
msgid "Show designer hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
|
msgid "Hint shows control's position or size while moving or resizing it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Tampilkan apapun"
|
|
|
|
#: lazarusidestrconsts.dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Tampilkan info eksekutabel (hanya Win32)"
|
|
|
|
#: lazarusidestrconsts.dlgshowfilenameincaption
|
|
msgid "Show file name in caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Tampilkan info umum"
|
|
|
|
#: lazarusidestrconsts.dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Tampilkan petunjuk saluran"
|
|
|
|
#: lazarusidestrconsts.dlgshowhint
|
|
#, fuzzy
|
|
#| msgid "Show Hints"
|
|
msgctxt "lazarusidestrconsts.dlgshowhint"
|
|
msgid "Show hints"
|
|
msgstr "Tampilkan Petunjuk"
|
|
|
|
#: lazarusidestrconsts.dlgshowingwindows
|
|
msgid "Showing Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshowlinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Tampilkan nomor baris"
|
|
|
|
#: lazarusidestrconsts.dlgshowmessagesicons
|
|
msgid "Show Messages Icons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgshownotes
|
|
#, fuzzy
|
|
#| msgid "Show Notes"
|
|
msgid "Show notes"
|
|
msgstr "Tampilkan Catatan"
|
|
|
|
#: lazarusidestrconsts.dlgshowsummary
|
|
msgid "Show summary"
|
|
msgstr "Tampilkan ringkasan"
|
|
|
|
#: lazarusidestrconsts.dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Tampilkan file yang dicoba"
|
|
|
|
#: lazarusidestrconsts.dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Tampilkan file yang digunakan"
|
|
|
|
#: lazarusidestrconsts.dlgshowwarnings
|
|
#, fuzzy
|
|
#| msgid "Show Warnings"
|
|
msgid "Show warnings"
|
|
msgstr "Tampilkan Peringatan"
|
|
|
|
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
|
msgid "Show single button in TaskBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
|
msgid "Skip forward class declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgslashcommenttab
|
|
msgid "Slash //"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr "Tab pintar"
|
|
|
|
#: lazarusidestrconsts.dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Simbol dibelakang (.pp~)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Penghitung (.pp;1)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Simbol didepan (.~pp)"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "Menempel ke Garis Pemandu"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelineshint
|
|
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
|
msgid "Multiline tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgspacenotcosmos
|
|
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
|
msgid "Space"
|
|
msgstr "Spasi"
|
|
|
|
#: lazarusidestrconsts.dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Petunjuk untuk tombol cepat utama (buka, simpan, ...)"
|
|
|
|
#: lazarusidestrconsts.dlgsrcedit
|
|
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
|
msgid "Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Asalnya"
|
|
|
|
#: lazarusidestrconsts.dlgstacksize
|
|
msgid "Stack size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstatickeyword
|
|
#, fuzzy
|
|
#| msgid "Static Keyword in Objects"
|
|
msgid "Static keyword in objects"
|
|
msgstr "Kata kunci statik dalam Objek"
|
|
|
|
#: lazarusidestrconsts.dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Hentikan setelah sejumlah kesalahan:"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoappend
|
|
msgid "Append text to close string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringautoprefix
|
|
msgid "Prefix string on new line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringbreakindenttab
|
|
msgid "String ''"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringenableautocontinue
|
|
msgid "Extend strings on linebreak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsubpropcolor
|
|
msgid "SubProperties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Opsi sintaks"
|
|
|
|
#: lazarusidestrconsts.dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tab memajukan blok"
|
|
|
|
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
|
msgid "Show tab numbers in notebook"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Tab ke spasi"
|
|
|
|
#: lazarusidestrconsts.dlgtabwidths
|
|
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
|
msgid "Tab widths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtargetcpufamily
|
|
msgid "Target CPU family"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtargetos
|
|
msgctxt "lazarusidestrconsts.dlgtargetos"
|
|
msgid "Target OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtargetplatform
|
|
#, fuzzy
|
|
#| msgid "Target Platform"
|
|
msgid "Target platform"
|
|
msgstr "Target Platform:"
|
|
|
|
#: lazarusidestrconsts.dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtargetspecificoptions
|
|
msgid "Target-specific options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Direktori untuk pembangunan proyek tes"
|
|
|
|
#: lazarusidestrconsts.dlgtexttofind
|
|
#, fuzzy
|
|
#| msgid "&Text to Find"
|
|
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
|
msgid "&Text to find"
|
|
msgstr "&Teks yang Dicari"
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktop
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtopinfohint
|
|
msgid "Current Class/Proc Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtoppos
|
|
msgid "Top:"
|
|
msgstr "Atas:"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
|
msgid "Trim spaces style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
|
msgid "Caret or Edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
|
msgid "Line Edited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
|
msgid "Leave line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
|
msgid "Position Only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Hapus sisa spasi"
|
|
|
|
#: lazarusidestrconsts.dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Undo setelah menyimpan"
|
|
|
|
#: lazarusidestrconsts.dlgundogroupoptions
|
|
msgid "Undo / Redo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Batas Undo"
|
|
|
|
#: lazarusidestrconsts.dlgunitdepcaption
|
|
#, fuzzy
|
|
#| msgid "Unit dependencies"
|
|
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Ketergantungan unit"
|
|
|
|
#: lazarusidestrconsts.dlgunitdeprefresh
|
|
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
|
msgid "Refresh"
|
|
msgstr "Segarkan"
|
|
|
|
#: lazarusidestrconsts.dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr "Direktori output unit (-FU):"
|
|
|
|
#: lazarusidestrconsts.dlgunsavedlinecolor
|
|
msgid "Unsaved line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusecodefolding
|
|
#, fuzzy
|
|
#| msgid "Code folding"
|
|
msgid "Code Folding"
|
|
msgstr "Lipatan kode"
|
|
|
|
#: lazarusidestrconsts.dlgusecustomconfig
|
|
msgid "Use additional compiler config file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusedividerdraw
|
|
msgid "Divider Drawing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusefpccfg
|
|
#, fuzzy
|
|
#| msgid "Use standard Compiler Config File (fpc.cfg)"
|
|
msgid "Use standard compiler config file (fpc.cfg)"
|
|
msgstr "Gunakan File Konfig Kompilator standar (fpc.cfg)"
|
|
|
|
#: lazarusidestrconsts.dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Gunakan aplikasi peluncuran"
|
|
|
|
#: lazarusidestrconsts.dlguseminimumime
|
|
msgid "IME handled by System"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguserschemeerror
|
|
msgid "Failed to load user-scheme file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseschemedefaults
|
|
msgid "Use (and edit) global scheme settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseschemelocal
|
|
msgid "Use local scheme settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Gunakan penerangan sintaks"
|
|
|
|
#: lazarusidestrconsts.dlgusetabshistory
|
|
msgid "Use tab history when closing tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseunitcaption
|
|
msgid "Add unit to Uses section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgvaluecolor
|
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
|
msgid "Value"
|
|
msgstr "Nilai"
|
|
|
|
#: lazarusidestrconsts.dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Perlihatkan selama kompilasi:"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Nampak saluran"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Nampak margin kanan"
|
|
|
|
#: lazarusidestrconsts.dlgwholewordsonly
|
|
msgid "&Whole words only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Panjang:"
|
|
|
|
#: lazarusidestrconsts.dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwindow
|
|
msgctxt "lazarusidestrconsts.dlgwindow"
|
|
msgid "Window"
|
|
msgstr "Jendela"
|
|
|
|
#: lazarusidestrconsts.dlgwinpos
|
|
#, fuzzy
|
|
#| msgid "Window Positions"
|
|
msgid "Window positions"
|
|
msgstr "Posisi Jendela"
|
|
|
|
#: lazarusidestrconsts.dlgwordexceptions
|
|
msgid "Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgwordspolicies
|
|
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
|
msgid "Words"
|
|
msgstr "Kata"
|
|
|
|
#: lazarusidestrconsts.dlgwrdpreview
|
|
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
|
msgid "Preview"
|
|
msgstr "Peninjauan"
|
|
|
|
#: lazarusidestrconsts.dlgwritefpclogo
|
|
#, fuzzy
|
|
#| msgid "Write an FPC logo"
|
|
msgid "Write FPC logo"
|
|
msgstr "Tulis logo FPC"
|
|
|
|
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Pemilihan multi komponen harus dari form tunggal."
|
|
|
|
#: lazarusidestrconsts.fdmalignmenu
|
|
msgid "Align ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmdeleteselection
|
|
#, fuzzy
|
|
#| msgid "Delete selection"
|
|
msgid "Delete Selection"
|
|
msgstr "Penilihan penghapusan"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorhorizontal
|
|
#, fuzzy
|
|
#| msgid "Mirror horizontal"
|
|
msgid "Mirror Horizontal"
|
|
msgstr "Cerminkan horisontal"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorvertical
|
|
#, fuzzy
|
|
#| msgid "Mirror vertical"
|
|
msgid "Mirror Vertical"
|
|
msgstr "Cerminkan vertikal"
|
|
|
|
#: lazarusidestrconsts.fdmorderbackone
|
|
#, fuzzy
|
|
#| msgid "Back one"
|
|
msgid "Back One"
|
|
msgstr "Mundur satu"
|
|
|
|
#: lazarusidestrconsts.fdmorderforwardone
|
|
#, fuzzy
|
|
#| msgid "Forward one"
|
|
msgid "Forward One"
|
|
msgstr "Maju satu"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetoback
|
|
#, fuzzy
|
|
#| msgid "Move to back"
|
|
msgid "Move to Back"
|
|
msgstr "Pindahkan ke belakang"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetofront
|
|
#, fuzzy
|
|
#| msgid "Move to front"
|
|
msgid "Move to Front"
|
|
msgstr "Pindahkan ke depan"
|
|
|
|
#: lazarusidestrconsts.fdmresetmenu
|
|
msgid "Reset ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsaveformasxml
|
|
#, fuzzy
|
|
#| msgid "Save form as XML"
|
|
msgid "Save Form as XML"
|
|
msgstr "Simpan form sebagai xml"
|
|
|
|
#: lazarusidestrconsts.fdmscalemenu
|
|
msgid "Scale ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Skala"
|
|
|
|
#: lazarusidestrconsts.fdmselectall
|
|
msgctxt "lazarusidestrconsts.fdmselectall"
|
|
msgid "Select All"
|
|
msgstr "Pilih Semua"
|
|
|
|
#: lazarusidestrconsts.fdmsizemenu
|
|
msgid "Size ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Ukuran"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Opsi: Menempel ke grid"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Opsi: Menempel ke garis pemandu"
|
|
|
|
#: lazarusidestrconsts.fdmzorder
|
|
msgid "Z-order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
|
msgid "On Both Sides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnclearhint
|
|
msgid "Clear all snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnenablehint
|
|
msgid "Toggle view snapshot or current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnmakesnaphint
|
|
msgid "Take Snapshot"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnpowerhint
|
|
msgid "Switch on/off automatic snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnremovehint
|
|
msgid "Remove selected entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnshowhisthint
|
|
msgid "View history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgbtnshowsnaphint
|
|
msgid "View Snapshots"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgcolumnloc
|
|
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
|
|
msgid "Location"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgcolumntime
|
|
msgid "Time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.histdlgformname
|
|
msgctxt "lazarusidestrconsts.histdlgformname"
|
|
msgid "History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
|
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Tambah File"
|
|
|
|
#: lazarusidestrconsts.lisa2paddfilestopackage
|
|
#, fuzzy
|
|
#| msgid "Add files to package"
|
|
msgid "Add Files to Package"
|
|
msgstr "Tambah file ke paket"
|
|
|
|
#: lazarusidestrconsts.lisa2paddtopackage
|
|
msgid "Add to package"
|
|
msgstr "Tambah file ke paket"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Tipe Karuhun Dwimakna"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Nama Class Dwimakna"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Nama Unit Dwimakna"
|
|
|
|
#: lazarusidestrconsts.lisa2pancestortype
|
|
msgid "Ancestor Type"
|
|
msgstr "Tipe Karuhun"
|
|
|
|
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Dependensi Rusak"
|
|
|
|
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Nama Class sudah ada"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
|
msgid "Create New Component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewfile
|
|
#, fuzzy
|
|
#| msgid "Create new file"
|
|
msgid "Create New File"
|
|
msgstr "Buat file baru"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewreq
|
|
msgid "Create New Requirement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Dependensi"
|
|
|
|
#: lazarusidestrconsts.lisa2pexistingfile2
|
|
msgid "Existing file: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "File sudah ada"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
|
msgid "File \"%s\" already exists in the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "File sudah digunakan"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename2
|
|
#, fuzzy
|
|
#| msgid "Filename"
|
|
msgid "Filename/URL"
|
|
msgstr "Nama file"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "File bukan unit"
|
|
|
|
#: lazarusidestrconsts.lisa2piconandsize
|
|
msgid "Icon (maximum 24x24):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Tipe Karuhun tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
|
msgid "Invalid Circular Dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Nama Class tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "File tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Nama file tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Nama Unit tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is not a valid unit name."
|
|
msgid "\"%s\" is not a valid unit name."
|
|
msgstr "%s%s%s bukan nama unit yang benar."
|
|
|
|
#: lazarusidestrconsts.lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Nama class baru:"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewcomponent
|
|
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Komponen Baru"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "File Baru"
|
|
|
|
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
#, fuzzy,badformat
|
|
#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
|
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
|
msgstr "Tidak ada paket ditemukan untuk dependensi %s%s%s.%sSilahkan pilih paket yang sudah ada."
|
|
|
|
#: lazarusidestrconsts.lisa2ppackageorproject
|
|
msgid "Package/Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Nama Halaman terlalu panjang"
|
|
|
|
#: lazarusidestrconsts.lisa2ppalettepage
|
|
msgid "Palette Page:"
|
|
msgstr "Halaman Palet:"
|
|
|
|
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
|
msgid "Pascal units must have the extension .pp or .pas"
|
|
msgstr "Unit pascal harus mempunyai ekstensi .pp atau .pas"
|
|
|
|
#: lazarusidestrconsts.lisa2psavefiledialog
|
|
msgid "Save file dialog"
|
|
msgstr "Simpan dialog file"
|
|
|
|
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr "Nama file pendek atau panjang"
|
|
|
|
#: lazarusidestrconsts.lisa2pshowall
|
|
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Tampilkan semua"
|
|
|
|
#: lazarusidestrconsts.lisa2pswitchpaths
|
|
msgid "Switch Paths"
|
|
msgstr "Tukar Path"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
|
#, fuzzy,badformat
|
|
#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Tipe karuhun %s%s%s mempunyai nama yang sama dengan%sunit %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
|
|
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Tipe karuhun %s%s%s bukan pengenal pascal yang benar."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
|
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
|
msgstr "Nama class %s%s%s dan tipe karuhun %s%s%s sama."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
|
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
|
msgstr "Nama class %s%s%s sudah ada dalam%sPaket %s%s%sFile: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Nama class %s%s%s mempunyai nama yang sama dengan%sunit %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The class name %s%s%s is not a valid Pascal identifier."
|
|
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Nama class %s%s%s bukan pengenal pascal yang benar."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "File %s%s%s adalah bagian dari proyek saat ini.%sAdalah ide buruk untuk membagi file diantara proyek dan paket."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
#, fuzzy,badformat
|
|
#| msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr "Nama file %s%s%s dwimakna, karena paket belum mempunyai direktori default. %sSilahkan tetapkan nama file dengan path penuh."
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
|
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
|
#, fuzzy,badformat
|
|
#| msgid "The package already has a dependency on the package %s%s%s."
|
|
msgid "The package already has a dependency on the package \"%s\"."
|
|
msgstr "Paket sudah mempunyai dependensi untuk paket %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
|
#, fuzzy,badformat
|
|
#| msgid "The page name %s%s%s is too long (max 100 chars)."
|
|
msgid "The page name \"%s\" is too long (max 100 chars)."
|
|
msgstr "Nama halaman %s%s%s terlalu panjang (maks 100 karakter)."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The unitname %s%s%s already exists in the package:%s%s"
|
|
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
|
msgstr "Nama unit %s%s%s sudah ada dalam paket:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The unitname %s%s%s already exists in this package."
|
|
msgid "The unitname \"%s\" already exists in this package."
|
|
msgstr "Nama unit %s%s%s sudah ada dalam paket ini."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
|
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
|
msgstr "Nama unit %s%s%s dan nama file %s%s%s berbeda."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s does not correspond to the filename."
|
|
msgid "The unit name \"%s\" does not correspond to the filename."
|
|
msgstr "Nama unit %s%s%s tidak terkait ke nama file."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgstr "Nama unit %s%s%s sama dengan komponen terdaftar.%sMenggunakan ini bisa menyebabkan pesan kesalahan aneh."
|
|
|
|
#: lazarusidestrconsts.lisa2punitfilename2
|
|
msgid "Unit File Name:"
|
|
msgstr "Nama File Unit:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitname
|
|
msgid "Unit Name:"
|
|
msgstr "Nama Unit:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Nama unit sudah ada"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnameinvalid
|
|
msgid "Unit Name Invalid"
|
|
msgstr "Nama Unit tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabort
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisabort"
|
|
msgid "Abort"
|
|
msgstr "Batalkan"
|
|
|
|
#: lazarusidestrconsts.lisabortall
|
|
msgid "Abort all"
|
|
msgstr "Gugurkan semua"
|
|
|
|
#: lazarusidestrconsts.lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr "Batalkan semua pengambilan"
|
|
|
|
#: lazarusidestrconsts.lisaborted
|
|
msgid "Aborted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Batalkan pengambilan proyek"
|
|
|
|
#: lazarusidestrconsts.lisabortwholeloading
|
|
msgid "Abort whole loading"
|
|
msgstr "Batalkan seluruh pengambilan"
|
|
|
|
#: lazarusidestrconsts.lisabout
|
|
msgctxt "lazarusidestrconsts.lisabout"
|
|
msgid "About"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisabout2
|
|
msgid "About %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutdocumentation
|
|
msgid "Documentation:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutide
|
|
msgid "About IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "Tentang Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarusmsg
|
|
#, fuzzy
|
|
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgstr "Lisensi: GPL/LGPL%sLazarus adalah IDE untuk membuat aplikasi (grafis dan konsol) dengan Free Pascal. Free Pascal adalah (L)GPL kompilator Pascal dan Object Pascal yang berjalan pada Windows, Linux, Mac OS X, FreeBSD dan banyak lagi.%sLazarus adalah bagian yang hilang dari teka-teki yang akan membolehkan anda mengembangkan program untuk semua platform di atas dalam lingkungan mirip Delphi. IDE adalah piranti RAD yang menyertakan desainer formulir.%sKarena Lazarus berkembang kami memerlukan lebih banyak para pengembang."
|
|
|
|
#: lazarusidestrconsts.lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Tidak menemukan daftar kontributor."
|
|
|
|
#: lazarusidestrconsts.lisaboutofficial
|
|
msgid "Official:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
#, fuzzy
|
|
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
|
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
|
|
msgstr "%s tidak bisa menampung TControls.%sAnda hanya bisa menaruh komponen visual diatasnya."
|
|
|
|
#: lazarusidestrconsts.lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr "Pengakuan"
|
|
|
|
#: lazarusidestrconsts.lisaction
|
|
msgid "Action:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactions
|
|
msgid "Actions:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivate
|
|
msgid "Activate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr "Aktifkan aturan ekspresi reguler untuk teks dan penggantian (mirip sekali dengan perl)"
|
|
|
|
#: lazarusidestrconsts.lisactivateselected
|
|
msgid "Activate Selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactive
|
|
msgid "Active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisactivefilter
|
|
msgid "Active Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadd
|
|
msgctxt "lazarusidestrconsts.lisadd"
|
|
msgid "Add"
|
|
msgstr "Tambah"
|
|
|
|
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
|
|
msgid "Add a new separator above selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
|
|
msgid "Add a new separator below selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefine
|
|
msgid "Add defines simulating Delphi7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefinehint
|
|
msgid "Useful when the code has checks for supported compiler versions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
|
msgid "Added missing object \"%s\" to pascal source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddedpropertysfors
|
|
msgid "Added property \"%s\" for %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8
|
|
msgid "Add -FcUTF8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8hint
|
|
msgid "May be needed if source files have non-ansistring literals."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfilesindirectory
|
|
msgid "Add Files in Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddfilter
|
|
msgid "Add Filter ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
|
msgid "Addition does not fit the current message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
|
msgid "Addition fits the current message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisadditions
|
|
msgid "Additions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddkeyworddo
|
|
msgid "Add keyword \"do\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
|
msgid "Add new build mode, copying settings from \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewmacro
|
|
msgid "Add new macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewset
|
|
msgid "Add new set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagerequirement
|
|
msgid "Add package requirement?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
|
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject
|
|
msgid "Add package %s to project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject2
|
|
msgid "Add package to project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddparameterbrackets
|
|
msgid "Add parameter brackets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddress
|
|
msgid "Address:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddressbreakpoint
|
|
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
|
|
msgid "&Address Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
|
msgid "Add to include search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoproject
|
|
msgid "Add %s to project?"
|
|
msgstr "Tambah %s ke proyek?"
|
|
|
|
#: lazarusidestrconsts.lisaddtostartupcomponents
|
|
msgid "Add to startup components?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddunitinterfaces
|
|
msgid "Add unit interfaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddunitnotrecommended
|
|
msgid "Add unit (not recommended)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddvaluetomacro
|
|
msgid "Add value to macro %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
|
#, fuzzy
|
|
#| msgid "Add file to a package"
|
|
msgid "Add File to Package"
|
|
msgstr "Tambah file ke paket"
|
|
|
|
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
|
#, fuzzy
|
|
#| msgid "Destination Package"
|
|
msgid "Destination package"
|
|
msgstr "Paket Tujuan"
|
|
|
|
#: lazarusidestrconsts.lisaf2pfiletype
|
|
#, fuzzy
|
|
#| msgid "File Type"
|
|
msgid "File type"
|
|
msgstr "Tipe File"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Paket Tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
|
#, fuzzy,badformat
|
|
#| msgid "Invalid package ID: %s%s%s"
|
|
msgid "Invalid package ID: \"%s\""
|
|
msgstr "ID paket tidak benar: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Paket hanya baca"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "Package %s%s%s not found."
|
|
msgid "Package \"%s\" not found."
|
|
msgstr "Paket %s%s%s tidak ditemukan."
|
|
|
|
#: lazarusidestrconsts.lisaf2pshowall
|
|
#, fuzzy
|
|
#| msgid "Show All"
|
|
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Tampilkan Semua"
|
|
|
|
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
|
msgid "The package %s is read only."
|
|
msgstr "Paket %s hanya baca."
|
|
|
|
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
|
#, fuzzy,badformat
|
|
#| msgid "A file %s%s%s already exists.%sReplace it?"
|
|
msgid "A file \"%s\" already exists.%sReplace it?"
|
|
msgstr "File %s%s%s sudah ada.%sTimpa saja?"
|
|
|
|
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
|
msgid "A filter with the name \"%s\" already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
|
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Penjajaran"
|
|
|
|
#: lazarusidestrconsts.lisallblockslooksok
|
|
#, fuzzy
|
|
#| msgid "All blocks looks ok."
|
|
msgid "All blocks look ok."
|
|
msgstr "Seluruh blok terlihat ok."
|
|
|
|
#: lazarusidestrconsts.lisallbuildmodes
|
|
msgid "<All build modes>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallinheritedoptions
|
|
msgid "All inherited options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalloptions
|
|
msgid "All Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallowfunctio
|
|
msgid "Allow Function Calls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr "Ijinkan pencarian untuk multipel baris"
|
|
|
|
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
|
msgid "All parameters of this function are already set at this call. Nothing to add."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
|
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalpha
|
|
msgid "Alpha"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalways
|
|
msgid "Always"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
|
msgid "Always convert suggested default file name to lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
|
msgid "Always draw selected items focused"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalwaysignore
|
|
msgid "Always ignore"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
|
msgid "A macro with this name already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "File dwimakna ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
#, fuzzy,badformat
|
|
#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
|
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
|
msgstr "File yang tidak jelas ditemukan: %s%s%s%sFile ini mungkin salah dengan %s%s%s%s%sHapus file tidak jelas?"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilesfound
|
|
msgid "Ambiguous files found"
|
|
msgstr "File yang meragukan ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisambiguousunitfound
|
|
#, fuzzy
|
|
#| msgid "Ambiguous Unit found"
|
|
msgid "Ambiguous unit found"
|
|
msgstr "Unit Dwimakna ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
|
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtotopside
|
|
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr "Editor Anchor - tidak ada kontrol dipilih"
|
|
|
|
#: lazarusidestrconsts.lisanchorenabledhint
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttoleftside
|
|
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttorightside
|
|
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttoleftside
|
|
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttorightside
|
|
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorsof
|
|
msgid "Anchors of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr "Anchor dari kontrol yang dipilih"
|
|
|
|
#: lazarusidestrconsts.lisanchortoptobottomside
|
|
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanchortoptotopside
|
|
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
|
#, fuzzy,badformat
|
|
#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
|
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
|
msgstr "Kesalahan terjadi saat terakhir startup ketika mengambil %s!%s%sAmbil proyek ini lagi?"
|
|
|
|
#: lazarusidestrconsts.lisapplicationclassname
|
|
msgid "&Application class name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
|
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapply
|
|
msgctxt "lazarusidestrconsts.lisapply"
|
|
msgid "Apply"
|
|
msgstr "Terapkan"
|
|
|
|
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
|
msgid "apply build flags (-B) to dependencies too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplyconventions
|
|
msgid "Apply conventions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisapplyconventionshint
|
|
msgid "Adjust name extension and character case for platform and file type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
|
msgid "A project unit can not be used by other packages/projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr "Batas spasi sekeliling kontrol. Batas spasi ke empat lainnya ditambahkan ke nilai ini"
|
|
|
|
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr "Tanya sebelum mengganti setiap teks yang ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
|
msgid "Ask before saving project's session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
|
msgid "Ask for component name after putting it on a designer form."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
|
msgid "Ask for file name on new file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisasknameoncreate
|
|
msgid "Ask name on create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
|
|
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheight
|
|
msgid "Automatically adjust IDE main window height"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
|
msgid "Show complete component palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
|
msgid "If component palette spans over more lines, show them all and not only one."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocheckmodifiedfiles
|
|
msgid "Automatically check (select) modified files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocompletionoff
|
|
msgid "Auto completion: off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocompletionon
|
|
msgid "Auto completion: on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautocontinueafter
|
|
msgid "Auto continue after:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomarkup
|
|
msgid "Markup and Matches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomatic
|
|
msgctxt "lazarusidestrconsts.lisautomatic"
|
|
msgid "Automatic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomatically
|
|
msgid "Automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
|
msgid "Automatically convert .lfm files to .lrs resource files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
|
msgid "do not complete selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
|
msgid "Automatically invoke after point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyontab
|
|
msgid "tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
|
msgid "Automatically use single possible identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticfeatures
|
|
#, fuzzy
|
|
#| msgid "Automatic features"
|
|
msgid "Completion and Hints"
|
|
msgstr "Fitur otomatis"
|
|
|
|
#: lazarusidestrconsts.lisautoshowobjectinspector
|
|
msgid "Auto show"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisavailableforinstallation
|
|
msgid "Available for installation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
|
msgid "Available project build modes:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbackupchangedfiles
|
|
msgid "Make backup of changed files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Mem-backup file gagal"
|
|
|
|
#: lazarusidestrconsts.lisbackuphint
|
|
msgid "Creates a Backup directory under project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Pengubahan nama paket atau versi memisahkan dependensi. Apakah dependensi ini diubah juga?%sPilih Ya untuk mengubah semua dependensi terdaftar.%sPilih Abaikan untuk memisahkan dependensi dan melanjutkan."
|
|
|
|
#: lazarusidestrconsts.lisbegins
|
|
msgid "begins"
|
|
msgstr "mulai"
|
|
|
|
#: lazarusidestrconsts.lisbehindrelated
|
|
msgid "Behind related"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
|
msgid "be less verbose, can be given multiple times"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
|
msgid "be more verbose, can be given multiple times"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
|
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
|
#, fuzzy
|
|
#| msgid "Always Build before Run"
|
|
msgid "Always build before run"
|
|
msgstr "Selalu Membangun sebelum Dijalankan"
|
|
|
|
#: lazarusidestrconsts.lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr "Perintah Bangun"
|
|
|
|
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr "Saat membangun proyek sebaliknya menjalankan perintah Bangun File"
|
|
|
|
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr "Saat menjalankan proyek sebaliknya menjalankan perintah Jalankan File"
|
|
|
|
#: lazarusidestrconsts.lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr "Jalankan Perintah"
|
|
|
|
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
|
#, fuzzy
|
|
#| msgid "When this file is active in source editor ..."
|
|
msgid "When this file is active in source editor"
|
|
msgstr "Ketika file ini aktif dalam editor sumber ..."
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
|
#, fuzzy
|
|
#| msgid "Working directory (Leave empty for file path)"
|
|
msgid "Working directory (leave empty for file path)"
|
|
msgstr "Direktori kerja (biarkan kosong untuk path file)"
|
|
|
|
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
|
msgid "Bold non default values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisborderspace
|
|
#, fuzzy
|
|
#| msgid "BorderSpace"
|
|
msgid "Border space"
|
|
msgstr "BatasSpasi"
|
|
|
|
#: lazarusidestrconsts.lisbottom
|
|
msgctxt "lazarusidestrconsts.lisbottom"
|
|
msgid "Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr "Batas spasi Bawah. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dibawah kontrol."
|
|
|
|
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Anchor Bawah"
|
|
|
|
#: lazarusidestrconsts.lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr "Bawah"
|
|
|
|
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
|
#, fuzzy
|
|
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Ini adalah kontrol terdekat dimana sisi bawah dianchor. Biarkan kosong untuk parent."
|
|
|
|
#: lazarusidestrconsts.lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr "Bawah spasi secara sama"
|
|
|
|
#: lazarusidestrconsts.lisbreak
|
|
msgctxt "lazarusidestrconsts.lisbreak"
|
|
msgid "Break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbreakpointproperties
|
|
msgid "Breakpoint Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbrowseandselectacompiler
|
|
msgid "Browse and select a compiler (e.g. ppcx64"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnadd
|
|
msgctxt "lazarusidestrconsts.lisbtnadd"
|
|
msgid "&Add"
|
|
msgstr "T&ambah"
|
|
|
|
#: lazarusidestrconsts.lisbtnclose
|
|
msgctxt "lazarusidestrconsts.lisbtnclose"
|
|
msgid "&Close"
|
|
msgstr "&Tutup"
|
|
|
|
#: lazarusidestrconsts.lisbtndelete
|
|
msgctxt "lazarusidestrconsts.lisbtndelete"
|
|
msgid "&Delete"
|
|
msgstr "&Hapus"
|
|
|
|
#: lazarusidestrconsts.lisbtndlgadd
|
|
msgid "&Add ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtndlgreplace
|
|
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
|
msgid "&Replace ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnenabled
|
|
msgctxt "lazarusidestrconsts.lisbtnenabled"
|
|
msgid "&Enabled"
|
|
msgstr "&Dihidupkan"
|
|
|
|
#: lazarusidestrconsts.lisbtnfind
|
|
msgid "&Find"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnquit
|
|
#, fuzzy
|
|
#| msgid "Quit"
|
|
msgctxt "lazarusidestrconsts.lisbtnquit"
|
|
msgid "&Quit"
|
|
msgstr "Keluar"
|
|
|
|
#: lazarusidestrconsts.lisbtnremove
|
|
msgctxt "lazarusidestrconsts.lisbtnremove"
|
|
msgid "&Remove"
|
|
msgstr "&Hapus"
|
|
|
|
#: lazarusidestrconsts.lisbtnrename
|
|
msgid "&Rename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnreplace
|
|
msgid "&Replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuild
|
|
msgctxt "lazarusidestrconsts.lisbuild"
|
|
msgid "Build"
|
|
msgstr "Bangun"
|
|
|
|
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
|
msgid "build all files of project/package/IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildcaption
|
|
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
|
msgid "Build"
|
|
msgstr "Bangun"
|
|
|
|
#: lazarusidestrconsts.lisbuildfollowingmodes
|
|
msgid "Build the following modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildide
|
|
msgid "Build IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildidewithpackages
|
|
msgid "build IDE with packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuilding
|
|
msgid "Building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
|
msgid "Building Lazarus failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmode
|
|
msgid "Build Mode: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
|
msgid "Differences between build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
|
msgid "Differences from other build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffmode
|
|
msgid "Mode:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodeintitleinexample
|
|
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildmodes
|
|
msgid "Build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Bangun proyek baru"
|
|
|
|
#: lazarusidestrconsts.lisbuildnumber
|
|
#, fuzzy
|
|
#| msgid "Build Number"
|
|
msgid "Build number"
|
|
msgstr "Angka Buatan"
|
|
|
|
#: lazarusidestrconsts.lisbuildstage
|
|
msgctxt "lazarusidestrconsts.lisbuildstage"
|
|
msgid "Build"
|
|
msgstr "Bangun"
|
|
|
|
#: lazarusidestrconsts.lisbusy
|
|
msgid "Busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbyte
|
|
msgid "%s byte"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
|
msgid "Calling %s to create Makefile from %s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscallstacknotevaluated
|
|
msgid "Stack not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscancel
|
|
msgctxt "lazarusidestrconsts.liscancel"
|
|
msgid "Cancel"
|
|
msgstr "Batal"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr "Batalkan pengambilan komponen ini"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Batalkan pengambilan unit"
|
|
|
|
#: lazarusidestrconsts.liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr "Batalkan penggantian nama"
|
|
|
|
#: lazarusidestrconsts.liscannotcompileproject
|
|
msgid "Cannot compile project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
|
#, fuzzy
|
|
#| msgid "Can not copy top level component."
|
|
msgid "Cannot copy top level component."
|
|
msgstr "Tidak bisa meng-copy komponen tingkat teratas."
|
|
|
|
#: lazarusidestrconsts.liscannotcreatefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Cannot create file %s%s%s"
|
|
msgid "Cannot create file \"%s\""
|
|
msgstr "Tidak bisa membuat file %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liscannotdeletelastmode
|
|
msgid "Cannot delete last mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotexecute
|
|
msgid "cannot execute \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfind
|
|
msgid "Cannot find %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfindexecutable
|
|
msgid "cannot find executable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
|
#, fuzzy
|
|
#| msgid "Cannot find lazarus starter:%s%s"
|
|
msgid "Cannot find Lazarus starter:%s%s"
|
|
msgstr "Tidak bisas menemukan starter lazarus:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscannotfindunit
|
|
msgid "Cannot find unit %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotopenform
|
|
msgid "Cannot open form \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotsaveform
|
|
msgid "Cannot save form \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannotsubstitutemacros
|
|
msgid "Cannot substitute macro \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
|
msgid "Cannot test the compiler while debugging or compiling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr "Hanya bisa mengubah kelas dari TComponents."
|
|
|
|
#: lazarusidestrconsts.liscantfindavalidppu
|
|
msgid "Can't find a valid %s.ppu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscaptioncomparefiles
|
|
msgid "Compare files (not for creating patches)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscbpfiles
|
|
msgid "%s (%s files)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
|
msgid "Really delete %s source files%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccdchangeclassof
|
|
msgid "Change Class of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccdnoclass
|
|
msgid "no class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccochecktestdir
|
|
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocompilernotanexe
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocontains
|
|
msgid "contains "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccodatesdiffer
|
|
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoerrorcaption
|
|
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
|
msgid "Error"
|
|
msgstr "Salah"
|
|
|
|
#: lazarusidestrconsts.lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomsgppunotfound
|
|
msgid "compiled FPC unit not found: %s.ppu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppuexiststwice
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
|
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoseveralcompilers
|
|
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccoskip
|
|
msgid "Skip"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
|
msgid "Unable to create Test Pascal file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccowarningcaption
|
|
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
|
msgid "Warning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscecategories
|
|
msgid "Categories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscecomplexitygroup
|
|
msgid "Complexity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceconstants
|
|
msgid "Constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyblocks
|
|
msgid "Empty blocks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyclasssections
|
|
msgid "Empty class sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptygroup
|
|
msgid "Empty constructs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceemptyprocedures
|
|
msgid "Empty procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscefilter
|
|
#, fuzzy
|
|
#| msgid "(Filter)"
|
|
msgid "(filter)"
|
|
msgstr "(Filter)"
|
|
|
|
#: lazarusidestrconsts.liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr "Mengikuti kursor"
|
|
|
|
#: lazarusidestrconsts.liscein
|
|
msgctxt "lazarusidestrconsts.liscein"
|
|
msgid "%s in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceisarootcontrol
|
|
msgid "Is a root control"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongparamlistcount
|
|
msgid "Parameters count treated as \"many\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongprocedures
|
|
msgid "Long procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscelongproclinecount
|
|
msgid "Line count of procedure treated as \"long\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemanynestedprocedures
|
|
msgid "Many nested procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemanyparameters
|
|
msgid "Many parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenestedproccount
|
|
msgid "Nested procedures count treated as \"many\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenteralostwindow
|
|
msgid "Center a lost window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
|
#, fuzzy
|
|
#| msgid "Center control horizontally relative to the given sibling"
|
|
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Tengahkan kontrol secara horisontal relatif ke yang terdekat"
|
|
|
|
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
|
#, fuzzy
|
|
#| msgid "Center control vertically relative to the given sibling"
|
|
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Tengahkan kontrol secara vertikal relatif ke yang terdekat"
|
|
|
|
#: lazarusidestrconsts.liscenterform
|
|
msgid "Center Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Tengah dalam jendela"
|
|
|
|
#: lazarusidestrconsts.liscenters
|
|
msgid "Centers"
|
|
msgstr "Tengah"
|
|
|
|
#: lazarusidestrconsts.lisceomode
|
|
msgid "Preferred exhibition mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceomodecategory
|
|
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
|
msgid "Category"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceomodesource
|
|
msgctxt "lazarusidestrconsts.lisceomodesource"
|
|
msgid "Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Tidak pernah, hanya secara manual"
|
|
|
|
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "Saat menganggur"
|
|
|
|
#: lazarusidestrconsts.lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Segarkan secara otomatis"
|
|
|
|
#: lazarusidestrconsts.lisceothergroup
|
|
msgctxt "lazarusidestrconsts.lisceothergroup"
|
|
msgid "Other"
|
|
msgstr "Lainnya"
|
|
|
|
#: lazarusidestrconsts.lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Mutahirkan"
|
|
|
|
#: lazarusidestrconsts.lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Saat menukar file dalam editor sumber"
|
|
|
|
#: lazarusidestrconsts.lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceproperties
|
|
msgctxt "lazarusidestrconsts.lisceproperties"
|
|
msgid "Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
|
msgid "Published properties without default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceshowcodeobserver
|
|
msgid "Show observations about"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscestylegroup
|
|
msgctxt "lazarusidestrconsts.liscestylegroup"
|
|
msgid "Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscesurrounding
|
|
msgid "Surrounding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscetodos
|
|
msgid "ToDos"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscetypes
|
|
msgid "Types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunnamedconstants
|
|
msgid "Unnamed constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunsortedmembers
|
|
msgid "Unsorted members"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceunsortedvisibility
|
|
msgid "Unsorted visibility"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisceuses
|
|
msgctxt "lazarusidestrconsts.lisceuses"
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscevariables
|
|
msgid "Variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscewrongindentation
|
|
msgid "Wrong indentation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
|
|
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecancelloadingthisresource
|
|
msgid "Cancel loading this resource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeclassnotfound
|
|
msgid "%s%sClass \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecomponent
|
|
msgid "%s%sComponent: %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecomponentclass
|
|
msgid "%s%sComponent Class: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfecontinueloading
|
|
msgid "Continue loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
|
msgid "Do not know how to copy this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
|
msgid "Do not know how to cut this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
|
msgid "Do not know how to delete this form editing selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
|
msgid "Error creating component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
|
msgid "Error creating component: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
|
msgid "Error destroying component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
|
msgid "Error destroying component of type %s of unit %s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
|
msgid "Error destroying mediator"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
|
msgid "Error destroying mediator %s of unit %s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeerrorreading
|
|
msgid "Error reading %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeinfile
|
|
msgid "In file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
|
msgid "Invalid component owner"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscferoot
|
|
msgid "%sRoot=%s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestopallloading
|
|
msgid "Stop all loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestream
|
|
msgid "%sStream=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfestreamposition
|
|
msgid "%s%sStream position: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
|
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
|
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
|
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
|
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
|
msgid "The component of type %s failed to set its owner to %s:%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
|
msgid "Unable to clear the form editing selection%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischange
|
|
msgctxt "lazarusidestrconsts.lischange"
|
|
msgid "Change"
|
|
msgstr "Ubah"
|
|
|
|
#: lazarusidestrconsts.lischangebuildmode
|
|
msgid "Change build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Ubah Kelas"
|
|
|
|
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
|
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangefile
|
|
msgid "Change file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangeparent
|
|
#, fuzzy
|
|
#| msgid "Change Parent..."
|
|
msgid "Change Parent"
|
|
msgstr "Ubah leluhur ..."
|
|
|
|
#: lazarusidestrconsts.lischangeswerenotsaved
|
|
msgid "Changes were not saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangetounix
|
|
msgid "Change to Unix /"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischangetowindows
|
|
msgid "Change to Windows \\"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischaracter
|
|
msgid "Character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischaractermap
|
|
msgid "Character Map"
|
|
msgstr "Peta Karakter"
|
|
|
|
#: lazarusidestrconsts.lischeckall
|
|
msgid "Check All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
|
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
|
|
msgid "Check for disk file changes via content rather than timestamp"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
|
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
|
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
|
|
msgid ". Check if package %s is in the dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
|
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckoptions
|
|
msgid "Check options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
|
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
|
|
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
|
|
msgid "Check the next token in source and add a semicolon if needed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
|
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckuncheckall
|
|
msgid "Check/uncheck all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname
|
|
msgid "Choose a different name"
|
|
msgstr "Pilih nama yang berbeda"
|
|
|
|
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
|
msgid "Choose a file with CodeTools templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseanameforthecomponent
|
|
msgid "Choose a name for the component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseanexamplefile
|
|
msgid "Choose an example file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
|
msgid "Choose an FPC message file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
|
msgid "Choose a Pascal file for indentation examples"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosecompilerexecutable
|
|
msgid "Choose compiler executable (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosecompilermessages
|
|
msgid "Choose compiler messages file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
|
msgid "Choose debugger executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Pilih unit Delphi (*.pas)"
|
|
|
|
#: lazarusidestrconsts.lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Pilih direktori"
|
|
|
|
#: lazarusidestrconsts.lischooseexecutable
|
|
msgid "Choose an executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "Pilih direktori sumber FPC"
|
|
|
|
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Pilih Direktori Lazarus"
|
|
|
|
#: lazarusidestrconsts.lischoosemakeexecutable
|
|
msgid "Choose \"make\" executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischoosename
|
|
msgid "Choose name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr "Pilih satu dari item-item ini untuk membuat File baru"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr "Pilih satu dari item-item ini untuk membuat Paket baru"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr "Pilih satu dari item-item ini untuk membuat Proyek baru"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Pilih sumber program (*.pp,*.pas,*.lpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Pilih struktur untuk menyertakan pilihan"
|
|
|
|
#: lazarusidestrconsts.lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscirculardependencydetected
|
|
msgid "Circular dependency detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclass
|
|
msgid "&Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclasscompletion
|
|
msgid "Class Completion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
|
msgid "Classes and properties exist. Values were not checked."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
|
#, fuzzy,badformat
|
|
#| msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
|
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
|
msgstr "Class %s%s%s tidak terdaftar sebagai kompnen class.%sTidak bisa mem- paste."
|
|
|
|
#: lazarusidestrconsts.lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Class tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisclassnotfoundat
|
|
msgid "Class %s not found at %s(%s,%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclassofmethodnotfound
|
|
msgid "Class \"%s\" of method \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldirclean
|
|
msgid "Clean"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr "Bersihkan Direktori"
|
|
|
|
#: lazarusidestrconsts.liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Bersihkan sub direktori"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Biarkan semua file teks"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Biarkan file yang memenuhi filter"
|
|
|
|
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Hapus file yang memenuhi filter"
|
|
|
|
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Sintaks Sederhana (contoh. * instead of .*)"
|
|
|
|
#: lazarusidestrconsts.liscleanall
|
|
msgid "Clean all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleancommonfiles
|
|
msgid "Clean common files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Bersihkan Sumber Lazarus"
|
|
|
|
#: lazarusidestrconsts.liscleanonlyonce
|
|
msgid "Switch after building to automatically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanup
|
|
msgid "Clean up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuildproject
|
|
msgid "Clean up and build project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanuppackage
|
|
msgid "Clean up package \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr "bersihkan path unit?"
|
|
|
|
#: lazarusidestrconsts.lisclear
|
|
msgctxt "lazarusidestrconsts.lisclear"
|
|
msgid "Clear"
|
|
msgstr "Clear"
|
|
|
|
#: lazarusidestrconsts.liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclearthefilterforoptions
|
|
msgid "Clear the filter for options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclicktoseethechoices
|
|
msgid "Click to see the choices"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
|
msgid "Click to Select Palette Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclone
|
|
msgid "Clone"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclose
|
|
#, fuzzy
|
|
#| msgid "&Close"
|
|
msgctxt "lazarusidestrconsts.lisclose"
|
|
msgid "Close"
|
|
msgstr "&Tutup"
|
|
|
|
#: lazarusidestrconsts.liscloseall
|
|
msgctxt "lazarusidestrconsts.liscloseall"
|
|
msgid "Close All"
|
|
msgstr "Tutup Semua"
|
|
|
|
#: lazarusidestrconsts.liscloseallchecked
|
|
msgid "Close All Checked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsclose
|
|
msgid "Close files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabshide
|
|
msgctxt "lazarusidestrconsts.lisclosealltabshide"
|
|
msgid "Hide window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsquestion
|
|
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclosealltabstitle
|
|
msgid "Close Source Editor Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "Opsi khusus Antarmuka LCL"
|
|
|
|
#: lazarusidestrconsts.liscmparameter
|
|
msgid "Parameter"
|
|
msgstr "Parameter"
|
|
|
|
#: lazarusidestrconsts.liscmplstcomponents
|
|
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
|
msgid "Components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstlist
|
|
msgid "List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmppages
|
|
msgid "Pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmppalettevisible
|
|
msgid "Palette is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscmprestoredefaults
|
|
msgid "&Restore defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr "File konfig kompilator tambahan tidak jelas"
|
|
|
|
#: lazarusidestrconsts.liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Panggilan pada:"
|
|
|
|
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
|
#, fuzzy
|
|
#| msgid "%s%sClick OK if you are sure to do that."
|
|
msgid "%s%sClick OK if you definitely want to do that."
|
|
msgstr "%s%sKlik OK jika anda yakin akan melakukannya."
|
|
|
|
#: lazarusidestrconsts.liscocommand
|
|
msgctxt "lazarusidestrconsts.liscocommand"
|
|
msgid "Command:"
|
|
msgstr "Perintah:"
|
|
|
|
#: lazarusidestrconsts.liscode
|
|
msgid "Code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodebrowser
|
|
#, fuzzy
|
|
#| msgid "Code browser"
|
|
msgctxt "lazarusidestrconsts.liscodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Browser Kode"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogcaption
|
|
msgid "Code creation options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogclasssection
|
|
msgid "Class section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialoglocation
|
|
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
|
|
msgid "Location"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodegenerationoptions
|
|
msgid "Code generation options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Tambah path"
|
|
|
|
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
|
msgid "Browse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Hapus path"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdescrtag
|
|
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
|
msgid "Description"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelperrorstag
|
|
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
|
msgid "Errors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Contoh"
|
|
|
|
#: lazarusidestrconsts.liscodehelpgroupbox
|
|
msgid "FPDoc settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr "Sisipkan tag format kode"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr "Sisipkan tag format miring"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr "Sisipkan tag format catatan"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr "Sisipkan tag format garis bawah"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr "Sisipkan tag format var"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinherited
|
|
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
|
msgid "Inherited"
|
|
msgstr "Diturunkan"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpmainformcaption
|
|
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
|
msgid "FPDoc Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
|
msgid "(no inherited description found)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<TIDAK ADA>"
|
|
|
|
#: lazarusidestrconsts.liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Lihat juga"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr "Pendek"
|
|
|
|
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
|
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
|
msgid "Ignore constants in next functions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobscharconst
|
|
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
|
msgid "Search for unnamed char constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobserver
|
|
msgid "Code Observer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
|
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
|
msgid "Ignore next unnamed constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetempladd
|
|
#, fuzzy
|
|
#| msgid "Add"
|
|
msgctxt "lazarusidestrconsts.liscodetempladd"
|
|
msgid "Add template"
|
|
msgstr "Tambah"
|
|
|
|
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Tambah template kode"
|
|
|
|
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
|
#, fuzzy,badformat
|
|
#| msgid " A token %s%s%s already exists! "
|
|
msgid " A token \"%s\" already exists! "
|
|
msgstr " Token %s%s%s sudah ada! "
|
|
|
|
#: lazarusidestrconsts.liscodetemplautocompleteon
|
|
msgid "Auto complete on"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplchange
|
|
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
|
msgid "Change"
|
|
msgstr "Ubah"
|
|
|
|
#: lazarusidestrconsts.liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Komentar:"
|
|
|
|
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Edit template kode"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerror
|
|
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
|
msgid "Error"
|
|
msgstr "Salah"
|
|
|
|
#: lazarusidestrconsts.liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Token:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsaction
|
|
msgid "Action: %s"
|
|
msgstr "Aksi: %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
|
#, fuzzy
|
|
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
|
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Node otomatis dibuat tidak bisa diedit,%stidak juga mempunyai node anak yang tidak otomatis dibuat."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, otomatis dibuat"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
|
#, fuzzy
|
|
#| msgid "Auto generated nodes can not be edited."
|
|
msgid "Auto generated nodes cannot be edited."
|
|
msgstr "Node yang otomatis dibuat tidak bisa diedit."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Blok"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "Editor Definisi CodeTools"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
|
#, fuzzy
|
|
#| msgid "compiler path"
|
|
msgid "Compiler path"
|
|
msgstr "path kompilator"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Konversi node"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Buat Defines untuk Direktori %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Buat Defines untuk Kompilator Free Pasal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgstr "Buat Defines untuk Sumber Free Pascal SVN"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Buat Defines untuk Proyek %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "Buat Makro FPC dan path untuk direktori proyek fpc"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Definiskan"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Definisikan Berulang"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Hapus node"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Direktori utama %s, %sdimana Borland telah menginstalasi semua sumber %s.%sSebagai contoh: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s,%syang digunakan oleh proyek %s ini.%sSebagai contoh: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Deskripsi:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
|
msgid "%s directory"
|
|
msgstr "direktori %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr "Else"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr "ElseIf"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
|
msgid "Exit without Save"
|
|
msgstr "Keluar tanpa Menyimpan"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
|
msgid "FPC SVN source directory"
|
|
msgstr "Direktori sumber FPC SVN"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr "If"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr "IfNDef"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Direktori"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Sisipkan Template Kompilator Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Sisipkan Template Direktori Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Sisipkan Template Proyek Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Sisipkan Template Kompilator Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Sisipkan Template Direktori Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Sisipkan Template Proyek Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Sisipkan Template Kompilator Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Sisipkan Template Direktori Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Sisipkan Template Proyek Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Sisipkan Template Kompilator Free Pascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Sisipkan Template Proyek Free Pascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
|
msgid "Insert Free Pascal SVN Source Template"
|
|
msgstr "Sisipkan Template Sumber SVN Free Pascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Sisipkan Template Kompilator Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Sisipkan Template Direktori Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Sisipkan Template Proyek Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Sisipkan node sebagai anak"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Sisipkan node dibawah"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Sisipkan Template"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Induk tidak benar"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Node induk tidak benar"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Node sebelumnya tidak benar"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s.%sContoh: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s,%syang digunakan oleh proyek %s ini.%sSebagai contoh: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Turunkan node"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Turunkan node selangkah"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Naikkan node selangkah"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Naikkan node"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsname
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
|
msgid "Name:"
|
|
msgstr "Nama:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "NodeBaru"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Node hanya-baca"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "tidak ada yang dipilih"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
|
#, fuzzy
|
|
#| msgid "Parent node can not contain child nodes."
|
|
msgid "Parent node cannot contain child nodes."
|
|
msgstr "Node induk tidak bisa berisi node anak."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Node sebelumnya tidak bisa berisi anak node."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
|
msgid "%s project directory"
|
|
msgstr "Direktori proyek %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
|
msgid "Read error"
|
|
msgstr "Pembacaan salah"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
|
msgid "Save and Exit"
|
|
msgstr "Simpan dan Keluar"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Node Terpilih:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
#, fuzzy
|
|
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
|
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
|
|
msgstr "Direktori sumber Free Pascal SVN. Tidak diperlukan. Ini akan meningkatkan pencarian deklarasi dan debugging."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "Direktori proyek Free Pascal."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
|
msgid "The Free Pascal SVN source directory."
|
|
msgstr "Direktori sumber Free Pascal SVN."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
#, fuzzy
|
|
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr "Path ke kompilator free pascal. %s Sebagai contoh %s/usr/bin/%s -n%s atau %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
#, fuzzy
|
|
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgstr "Path ke kompilator free pascal. Hanya diperlukan jika anda menset sumber FPC SVN dibawah ini. Digunakan untuk pembuatan makro otomatis."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
|
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "Direktori proyek %s,%syang berisi file .dpr, dpk."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "Tidak didefiniskan"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "Tidak didefinisikan Semua"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Tidak didefinisikan Berulang"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Nilai sebagai Teks"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
|
msgid "%s:%svalue \"%s\" is invalid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Variabel:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
|
msgid "Write error"
|
|
msgstr "Penulisan salah"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr "Di"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
|
msgid "Bracket"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscaret
|
|
msgid "Caret (^)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Titik dua"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Koma"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Pengenal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
|
msgid "Keyword"
|
|
msgstr "Kata kunci"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Baris baru"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnone
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
|
msgid "None"
|
|
msgstr "Tidak ada"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Nomor"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Titik"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Titik koma"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsspace
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
|
msgid "Space"
|
|
msgstr "Spasi"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "Konstan string"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Simbol"
|
|
|
|
#: lazarusidestrconsts.liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Jalankan setelah"
|
|
|
|
#: lazarusidestrconsts.liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Jalankan sebelum"
|
|
|
|
#: lazarusidestrconsts.liscoladdress
|
|
msgid "Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscolclass
|
|
msgid "Class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseall
|
|
msgid "Collapse All (/)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr "Sempitkan semua kelas"
|
|
|
|
#: lazarusidestrconsts.liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr "Sempitkan semua paket"
|
|
|
|
#: lazarusidestrconsts.liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr "Sempitkan semua unit"
|
|
|
|
#: lazarusidestrconsts.liscolreturns
|
|
msgid "Returns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscolvisibility
|
|
msgid "Visibility"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandafter
|
|
msgid "Command after"
|
|
msgstr "Perintah setelah"
|
|
|
|
#: lazarusidestrconsts.liscommandafterinvalid
|
|
msgid "Command after invalid"
|
|
msgstr "Perintah seteleahnya tidak benar"
|
|
|
|
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
|
msgid "Command after publishing module"
|
|
msgstr "Perintah setelah mempublikasikan modul"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparameters
|
|
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
|
msgid "Command line parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Parameter baris perintah dari program"
|
|
|
|
#: lazarusidestrconsts.liscompile
|
|
msgctxt "lazarusidestrconsts.liscompile"
|
|
msgid "Compile"
|
|
msgstr "Kompilasi"
|
|
|
|
#: lazarusidestrconsts.liscompileproject
|
|
msgid "Compile Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Kompilator"
|
|
|
|
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
|
msgid "Compiler \"%s\" does not support target %s-%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Salah: kompilator tidak benar: %s"
|
|
|
|
#: lazarusidestrconsts.liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Nama file kompilator"
|
|
|
|
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
|
#, fuzzy
|
|
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
|
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgstr "Petunjuk: anda bisa menset path kompilator dalam Lingkungan->Opsi Lingkungan->File->Path Kompilator"
|
|
|
|
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
|
msgid "Compiler messages file not found:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "CATATAN: file konfig codetools tidak ditemukan - menggunakan default"
|
|
|
|
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "CATATAN: pengambilan file opsi codetools lama:"
|
|
|
|
#: lazarusidestrconsts.liscompilestage
|
|
msgctxt "lazarusidestrconsts.liscompilestage"
|
|
msgid "Compile"
|
|
msgstr "Kompilasi"
|
|
|
|
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
|
msgid "Compile with -vd for more details. Check for duplicates."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompiling
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (kompilasi ...)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
|
msgid "Show long line hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
|
msgid "Extend far left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
|
msgid "Extend some left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
|
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
|
msgid "Never"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
|
msgid "Extend right only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
|
msgid "Component name \"%s\" is a Pascal keyword."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomponentnameiskeyword
|
|
#, fuzzy,badformat
|
|
#| msgid "Component name %s%s%s is keyword"
|
|
msgid "Component name \"%s\" is keyword"
|
|
msgstr "Nama kompionen %s%s%s adalah kata kunci"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "Component name %s%s%s is not a valid identifier"
|
|
msgid "Component name \"%s\" is not a valid identifier"
|
|
msgstr "Nama komponen %s%s%s bukan pengenal yang benar"
|
|
|
|
#: lazarusidestrconsts.liscomppalcomponentlist
|
|
msgid "View All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Buka paket"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Buka unit"
|
|
|
|
#: lazarusidestrconsts.liscomptest
|
|
#, fuzzy
|
|
#| msgid "Test"
|
|
msgctxt "lazarusidestrconsts.liscomptest"
|
|
msgid "&Test"
|
|
msgstr "Uji"
|
|
|
|
#: lazarusidestrconsts.liscondition
|
|
msgid "Condition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconditionals
|
|
msgctxt "lazarusidestrconsts.lisconditionals"
|
|
msgid "Conditionals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Direktori konfig Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisconfigfileofadditions
|
|
msgid "Config file of additions:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuild
|
|
msgid "Configure Build %s"
|
|
msgstr "Konfigurasi Pembangunan %s"
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
|
msgid "Configure Toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfigurelazaruside
|
|
msgid "Configure Lazarus IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirm
|
|
msgid "Confirm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmation
|
|
msgid "Confirmation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
|
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr "Konfirmasi perubahan"
|
|
|
|
#: lazarusidestrconsts.lisconfirmdelete
|
|
msgid "Confirm delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
|
#, fuzzy,badformat
|
|
#| msgid "Do you want to rebuild Lazarus with profile: %s ?"
|
|
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
|
msgstr "Anda ingin membangun ulang Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageaction
|
|
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
|
msgid "Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
|
msgid "New package set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
|
msgid "Old package set"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconflict
|
|
msgid "Conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconflictdetected
|
|
msgid "Conflict detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr "Aplikasi Konsol"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
|
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconstructorcode
|
|
msgid "Constructor code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontains
|
|
msgid "contains"
|
|
msgstr "berisi"
|
|
|
|
#: lazarusidestrconsts.liscontextsensitive
|
|
msgid "Context sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinue
|
|
msgctxt "lazarusidestrconsts.liscontinue"
|
|
msgid "Continue"
|
|
msgstr "Lanjutkan"
|
|
|
|
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
|
msgid "Continue and do not ask again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinuebuilding
|
|
msgid "Continue building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr "Lanjutkan tanpa pengambilan form"
|
|
|
|
#: lazarusidestrconsts.liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Kontributor"
|
|
|
|
#: lazarusidestrconsts.liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr "Kontrol membutuhkan leluhurnya"
|
|
|
|
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
|
msgid "Add comment after replacement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvaddingflagforregister
|
|
msgid "Adding flag for \"Register\" procedure in unit %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
|
msgid "\")\" is missing from replacement function: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvbracketnotfound
|
|
msgid "Bracket not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvconvertedfrom
|
|
msgid " { *Converted from %s* }"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvcoordhint
|
|
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvcoordoffs
|
|
msgid "Coordinate offsets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdeletedfile
|
|
msgid "Deleted file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
|
msgid "Added defines %s in custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
|
msgid "Added Package %s as a dependency."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
|
|
msgid "Added unit \"%s\" to uses section."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
|
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
|
msgid "All sub-directories will be scanned for unit files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
|
msgid "BeginCodeTools failed!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphicategories
|
|
msgid "Categories:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
|
msgid "Changed encoding from %s to UTF-8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
|
msgid "Conversion Aborted."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionready
|
|
msgid "Conversion Ready."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
|
msgid "Conversion took: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
|
msgid "Convert Delphi package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
|
msgid "Convert Delphi project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
|
msgid "Convert Delphi unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
|
msgid "*** Converting unit files found during conversion ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
|
msgid "*** Converting unit files belonging to project/package ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphierror
|
|
msgid "Error=\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
|
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
|
msgid "Failed converting unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
|
msgid "Failed to convert unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
|
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
|
msgid "Found all unit files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifunc
|
|
msgid "Delphi Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
|
msgid "%s(%s,%s) missing include file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiname
|
|
msgid "Delphi Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
|
msgid "Package name exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
|
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
|
msgid "Omitted unit %s from project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
|
|
msgid "Removed unit \"%s\" from uses section."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
|
msgid "*** Fixing used units and Repairing form files ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
|
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
|
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
|
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
|
msgid "Unitname exists in LCL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
|
msgid "Units to replace in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
|
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
|
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr "Konversi salah"
|
|
|
|
#: lazarusidestrconsts.lisconvert
|
|
msgid "Convert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertencoding
|
|
msgid "Convert Encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
|
msgid "Convert encoding of projects/packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertotherhint
|
|
msgid "Other options affecting the conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvertprojectorpackage
|
|
msgid "Convert project or package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttarget
|
|
msgid "Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
|
msgid "Cross-platform"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
|
msgid "Cross-platform versus Windows-only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargethint
|
|
msgid "Converter adds conditional compilation to support different targets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
|
msgid "Use the same DFM form file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
|
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
|
msgid "Support Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
|
msgid "Use conditional compilation to support Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfixedunitname
|
|
msgid "Fixed unit name from %s to %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplacements
|
|
msgid "Function Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplhint
|
|
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
|
msgid "Some Delphi functions can be replaced with LCL function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvfuncstoreplace
|
|
msgid "Functions / procedures to replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvleftoff
|
|
msgid "Left offset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvnewname
|
|
msgid "New Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvparentcontainer
|
|
msgid "Parent Container"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
|
msgid "Problems when trying to find all units from project file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
|
msgid "Problems when fixing include files in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
|
msgid "Problems when repairing form file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
|
msgid "Repairing include files : "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvreplacedcall
|
|
msgid "Replaced call %s with %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
|
msgid "Replacement function parameter number should be >= 1: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
|
msgid "\"$\" should be followed by a number: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
|
msgid "Stopped because there already is a package with the same name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvthislogwassaved
|
|
msgid "This log was saved to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtopoff
|
|
msgid "Top offset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplacements
|
|
msgid "Type Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplhint
|
|
msgid "Unknown types in form file (DFM/LFM)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvtypestoreplace
|
|
msgid "Types to replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplacements
|
|
msgid "Unit Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplhint
|
|
msgid "Unit names in uses section of a source unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunitstoreplace
|
|
msgid "Units to replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvunknownprops
|
|
msgid "Unknown properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
|
msgid "User selected to end conversion with file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
|
msgid "Add/Config/Delete Toolbar(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaradddivider
|
|
msgid "Add Divider"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddselected
|
|
msgid "Add selected item to toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaravailablecommands
|
|
msgid "Available commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyle
|
|
msgid "Toolbars border style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
|
msgid "None"
|
|
msgstr "Tidak ada"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
|
msgid "Single"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodetemplates
|
|
#, fuzzy
|
|
#| msgid "Code templates"
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
|
msgid "Code Templates"
|
|
msgstr "Template kode"
|
|
|
|
#: lazarusidestrconsts.liscoolbarconfigure
|
|
msgid "&Configure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
|
msgid "Are you sure you want to delete the selected toolbar?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletewarning
|
|
msgid "There must be at least one toolbar!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbardesigner
|
|
msgid "Designer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargeneralsettings
|
|
msgid "General Coolbar Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyle
|
|
msgid "Toolbars grab style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
|
msgid "Simple"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
|
msgid "Double"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
|
msgid "HorLines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
|
msgid "VerLines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
|
msgid "Gripper"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
|
msgid "Button"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabwidth
|
|
msgid "Grab width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaridemainmenu
|
|
msgid "IDE Main Menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarmessages
|
|
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
|
msgid "Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
|
msgid "Move selected toolbar item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
|
msgid "Move selected toolbar item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbaroptions
|
|
msgid "IDE CoolBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditor
|
|
msgid "Package Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
|
msgid "Package Editor Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarremoveselected
|
|
msgid "Remove selected item from toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
|
msgid "Restore defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
|
msgid "Please select a toolbar first!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourceeditor
|
|
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourcetab
|
|
msgid "Source Tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
|
msgid "Toolbar commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarvisible
|
|
msgid "Coolbar is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarwidth
|
|
msgid "Coolbar width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopy
|
|
msgctxt "lazarusidestrconsts.liscopy"
|
|
msgid "Copy"
|
|
msgstr "Copy"
|
|
|
|
#: lazarusidestrconsts.liscopyall
|
|
msgid "Copy All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
|
msgid "Copy All Items to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
|
msgid "Copy All/Original Messages to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyalloutputclipboard
|
|
msgid "Copy all output to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
|
msgid "Copy All Shown Messages to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopydescription
|
|
msgid "Copy description to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyerror
|
|
msgid "Copy Error"
|
|
msgstr "Copy Salah"
|
|
|
|
#: lazarusidestrconsts.liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Copy salah"
|
|
|
|
#: lazarusidestrconsts.liscopyfilename
|
|
msgid "Copy Filename %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
|
msgid "Copy File Name to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyidentifier
|
|
msgid "Copy \"%s\" to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr "Meng-copy seluruh form tidak diimplementasikan."
|
|
|
|
#: lazarusidestrconsts.liscopyitemtoclipboard
|
|
msgid "Copy Item to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopymovefiletodirectory
|
|
msgid "Copy/Move File to Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
|
msgid "Copy Selected Items to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
|
#, fuzzy
|
|
#| msgid "Copy selected messages to clipboard"
|
|
msgid "Copy Selected Messages to Clipboard"
|
|
msgstr "Copy pesan yang dipilih ke clipboard"
|
|
|
|
#: lazarusidestrconsts.liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Cari pesan FPC"
|
|
|
|
#: lazarusidestrconsts.liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Cari pesan Make"
|
|
|
|
#: lazarusidestrconsts.liscoscanformessages
|
|
msgid "Scan for messages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoskipcallingcompiler
|
|
#, fuzzy
|
|
#| msgid "Skip calling Compiler"
|
|
msgid "Skip calling compiler"
|
|
msgstr "Lewati pemanggilan Kompilator"
|
|
|
|
#: lazarusidestrconsts.liscouldnotadditomainsource
|
|
msgid "Could not add \"{$I %s}\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
|
msgid "Could not add \"{$R %s}\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
|
msgid "Could not add \"%s\" to main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
|
msgid "Could not remove \"%s\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
|
msgid "Could not remove \"{$I %s}\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
|
msgid "Could not remove \"{$R %s}\" from main source!"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
#, fuzzy
|
|
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr "Peringatan: file konfig kompilator tambahan mempunyai nama sama, seperti salah satu dari nama file konfig standar yang dicari kompilator FreePascal. Ini bisa berhasil HANYA penguraian konfig tambahan dan melewatkan konfig standar."
|
|
|
|
#: lazarusidestrconsts.liscpopenpackage
|
|
msgid "Open Package %s"
|
|
msgstr "Buka Paket %s"
|
|
|
|
#: lazarusidestrconsts.liscpopenunit
|
|
msgid "Open Unit %s"
|
|
msgstr "Buka Unit %s"
|
|
|
|
#: lazarusidestrconsts.liscpu
|
|
msgid ", CPU: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Buat proyek dulu!"
|
|
|
|
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
|
msgid "Create Debug and Release modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefilter
|
|
msgid "Create Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefunction
|
|
msgid "Create function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatehelpnode
|
|
msgid "Create Help node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateit
|
|
msgid "Create it"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatelocalvariable
|
|
msgid "Create local variable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewaddition
|
|
msgid "Create new addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackage
|
|
msgid "(Create new package)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
|
msgid "Create new package component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateproject
|
|
msgid "Create project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
|
msgid "Create/update .po file when saving a lfm file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
|
msgid "Creating file index of FPC sources %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscsbottom
|
|
msgctxt "lazarusidestrconsts.liscsbottom"
|
|
msgid "Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscstop
|
|
msgctxt "lazarusidestrconsts.liscstop"
|
|
msgid "Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Pilih Direktori"
|
|
|
|
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "Nilai Direktori CodeTools"
|
|
|
|
#: lazarusidestrconsts.lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Definisikan template"
|
|
|
|
#: lazarusidestrconsts.lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<tidak ada variabel dipilih>"
|
|
|
|
#: lazarusidestrconsts.lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Buka Peninjauan"
|
|
|
|
#: lazarusidestrconsts.lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Piranti"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariable
|
|
msgid "Variable: %s"
|
|
msgstr "Variabel: %s"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Nama Variabel"
|
|
|
|
#: lazarusidestrconsts.lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Template"
|
|
|
|
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
|
msgid "Update all method signatures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
|
msgid "Update multiple procedure signatures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr "silahkan pilih makro"
|
|
|
|
#: lazarusidestrconsts.lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr "Pilih Makro Kode"
|
|
|
|
#: lazarusidestrconsts.liscurrent
|
|
msgctxt "lazarusidestrconsts.liscurrent"
|
|
msgid "Current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscurrentlclwidgetset
|
|
msgid "Current LCL widgetset: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscurrentstate
|
|
msgid "Current state: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Kolom kursor dalam editor saat ini"
|
|
|
|
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Baris kursor dalam editor saat ini"
|
|
|
|
#: lazarusidestrconsts.liscustomopthint
|
|
msgid "These options are passed to the compiler after macros are replaced."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "opsi kustom"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Opsi Kustom"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions3
|
|
msgid "Custom Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr "Program Kustom"
|
|
|
|
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
|
msgid "A Custom Free Pascal program."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscut
|
|
msgctxt "lazarusidestrconsts.liscut"
|
|
msgid "Cut"
|
|
msgstr "Cut"
|
|
|
|
#: lazarusidestrconsts.lisdadattach
|
|
msgid "Attach"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadimagename
|
|
msgid "Image Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadpid
|
|
msgid "PID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadrunningprocesses
|
|
msgid "Running Processes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdatamodule
|
|
msgid "Data Module"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdate
|
|
msgid "Date"
|
|
msgstr "Tanggal"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdelete
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
|
|
msgid "Delete all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdeletehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
|
|
msgid "Delete all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdisable
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
|
|
msgid "Disable all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdisablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
|
|
msgid "Disable all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemenable
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
|
|
msgid "Enable all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemenablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
|
|
msgid "Enable all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
|
|
msgid "Copy to Clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
|
|
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
|
|
msgid "Breakpoint Properties ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgemexpression
|
|
msgid "&Expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgemnewvalue
|
|
msgid "&New value:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgemresult
|
|
msgid "&Result:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
|
msgid "Breakpoint Evaluation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
|
msgid "Breakpoint Hit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
|
msgid "Breakpoint Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
|
msgid "Breakpoint Stack Dump"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgendefaultcolor
|
|
msgid "Default Color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenexceptionraised
|
|
msgid "Exception Raised"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleload
|
|
msgid "Module Load"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleunload
|
|
msgid "Module Unload"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
|
msgid "Output Debug String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessexit
|
|
msgid "Process Exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessstart
|
|
msgid "Process Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadexit
|
|
msgid "Thread Exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadstart
|
|
msgid "Thread Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
|
msgid "Windows Message Posted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
|
msgid "Windows Message Sent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdeletehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
|
msgid "Delete"
|
|
msgstr "Hapus"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdisable
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
|
|
msgid "Disable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdisablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
|
|
msgid "Disable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemenable
|
|
msgctxt "lazarusidestrconsts.lisdbgitemenable"
|
|
msgid "Enable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgitemenablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
|
|
msgid "Enable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Debugger tidak ditetapkan"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr "Tetap set titikpisah"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
#, fuzzy
|
|
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
|
msgstr "Tidak ada debugger ditetapkan.%sSeting titikpisah tidak berpengaruh sampai anda menyiapkan Debugger dalam opsi dialog debugger dalam menu."
|
|
|
|
#: lazarusidestrconsts.lisdbgwinpower
|
|
msgid "On/Off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdbgwinpowerhint
|
|
msgid "Disable/Enable updates for the entire window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebug
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisdebug"
|
|
msgid "Debug"
|
|
msgstr "Debug"
|
|
|
|
#: lazarusidestrconsts.lisdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugger"
|
|
msgid "Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgstr "Kesalahan Debugger%sOoops, debugger masuk ke keadaan salah%sSimpan pekerjaan anda sekarang !%sTekan Hentikan, dan harapan terbaik, kami mencabut colokan."
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackerror
|
|
msgid "Debugger Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
|
|
msgid "Debugger Information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
|
|
msgid "Debugger Warning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Debugger tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisdebugging
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (debugging ...)"
|
|
|
|
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
|
msgid "Automatic typecast for objects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
|
msgid "Add Exception"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Tambahan path pencarian"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Titik pisah"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "bersihkan log saat dijalankan"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
|
msgid "Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Opsi umum Debugger"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Opsi spesifik Debugger (tergantung pada tipe dari debugger)"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
|
msgid "Duplicate Exception name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
|
msgid "Enter the name of the exception"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
|
msgid "Event Log"
|
|
msgstr "Log Event"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr "Ditangani oleh"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr "Ditangani oleh Debugger"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr "Ditangani oleh Program"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Abaikan eksepsi ini"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Eksepsi Bahasa"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
|
#, fuzzy
|
|
#| msgid "Limit linecount to"
|
|
msgid "Limit line count to"
|
|
msgstr "Batasi hitungan baris ke"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
|
msgid "Module"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
|
msgid "Notify on Lazarus Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr "Eksepsi OS"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr "Output"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Proses"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
|
msgid "Reset Debugger after each run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
|
msgid "Resume"
|
|
msgstr "Jalankan lagi"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
|
msgid "Resume Handled"
|
|
msgstr "Jalankan lagi yang Ditangani"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
|
msgid "Resume Unhandled"
|
|
msgstr "Jalankan lagi yang Tidak ditangani"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Tampilkan pesan saat berhenti"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Sinyal"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Thread"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
|
msgid "Use event log colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
|
msgid "Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Tidak bisa mengambil file"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to load file %s%s%s."
|
|
msgid "Unable to load file \"%s\"."
|
|
msgstr "Tidak bisa mengambil file %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisdecimal
|
|
msgctxt "lazarusidestrconsts.lisdecimal"
|
|
msgid "Decimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefault
|
|
msgctxt "lazarusidestrconsts.lisdefault"
|
|
msgid "Default"
|
|
msgstr "Default"
|
|
|
|
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
|
|
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
|
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultplaceholder
|
|
msgid "(default)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdefaultsectionofmethods
|
|
msgid "Default section of methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
|
msgid "Delay for long line hints in completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
|
|
msgid "Delay for hints and completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelete
|
|
msgctxt "lazarusidestrconsts.lisdelete"
|
|
msgid "Delete"
|
|
msgstr "Hapus"
|
|
|
|
#: lazarusidestrconsts.lisdelete2
|
|
msgid "Delete?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteaddition
|
|
msgid "Delete addition \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
|
msgid "Delete all breakpoints?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
|
msgid "Delete all breakpoints in file \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallinsamesource
|
|
msgid "Delete All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
|
msgid "Delete all selected breakpoints?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Hapus semua file ini?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Hapus file yang tidak jelas?"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpoint
|
|
msgid "Delete Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointatline
|
|
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointforaddress
|
|
msgid "Delete breakpoint for address %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointforwatch
|
|
msgid "Delete watchpoint for \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletefilefailed
|
|
msgid "Delete file failed"
|
|
msgstr "Penghapusan file gagal"
|
|
|
|
#: lazarusidestrconsts.lisdeletemacro
|
|
msgid "Delete macro \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletemode
|
|
msgid "Delete mode \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Delete old file %s%s%s?"
|
|
msgid "Delete old file \"%s\"?"
|
|
msgstr "Hapus file lama %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile2
|
|
msgid "Delete old file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedfiles
|
|
msgid "Delete selected files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedmacro
|
|
msgid "Delete selected macro?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletethisaddition
|
|
msgid "Delete this addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue
|
|
msgid "Delete value \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue2
|
|
msgid "Delete value %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdeletingoffilefailed
|
|
#, fuzzy,badformat
|
|
#| msgid "Deleting of file %s%s%s failed."
|
|
msgid "Deleting of file \"%s\" failed."
|
|
msgstr "Penghapusan file %s%s%s gagal."
|
|
|
|
#: lazarusidestrconsts.lisdelimiterissemicolon
|
|
msgid "Delimiter is semicolon."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelphicompatibleresources
|
|
msgid "Delphi compatible resources. Recommended."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
|
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdesktops
|
|
msgid "Desktops ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Direktori Tujuan"
|
|
|
|
#: lazarusidestrconsts.lisdestructorcode
|
|
msgid "Destructor code"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Huruf Diabaikan"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile1
|
|
msgid "File1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile2
|
|
msgid "File2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Abaikan jika baris kosong saat ditambahkan atau dihapus"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Abaikan perbedaan dalam akhir baris (contoh. #10 = #13#10)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Abaikan besar dari karakter spasi"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Abaikan spasi (karakter baris baru tidak disertakan)."
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Abaikan spasi diakhir baris"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Abaikan spasi diawal baris"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Hanya pilihan"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
|
#, fuzzy
|
|
#| msgid "Open Diff in editor"
|
|
msgid "Open difference in editor"
|
|
msgstr "Buka Diff dalam editor"
|
|
|
|
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
|
msgid "different unit %s found at new position \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdigits
|
|
msgid "Digits:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectives
|
|
msgid "Directives"
|
|
msgstr "Direktif"
|
|
|
|
#: lazarusidestrconsts.lisdirectivesfornewunit
|
|
msgid "Directives for new unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectories
|
|
msgid "Directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectory
|
|
msgid "Directory: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound
|
|
msgid "Directory \"%s\" not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound2
|
|
msgid "directory %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotwritable
|
|
msgid "Directory not writable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
|
msgid "Directory where the IDE puts the .po files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableallinsamesource
|
|
msgid "Disable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablebreakpoint
|
|
msgid "Disable Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisabled
|
|
msgid "Disabled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablegroups
|
|
msgid "Disable Groups"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisablei18nforlfm
|
|
msgid "Disable I18N for LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg
|
|
msgid "Disable Option -Xg?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg2
|
|
msgid "Disable option -Xg"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassassembler
|
|
msgctxt "lazarusidestrconsts.lisdisassassembler"
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotoaddress
|
|
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
|
|
msgid "Goto Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotoaddresshint
|
|
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
|
|
msgid "Goto Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotocurrentaddress
|
|
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
|
|
msgid "Goto Current Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
|
|
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
|
|
msgid "Goto Current Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Abaikan perubahan"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesall
|
|
msgid "Discard all changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
|
msgid "Discard changes and open project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandquit
|
|
msgid "Discard changes and quit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
|
msgid "Discard changes, create new project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Klik pada salah satu item diatas untuk melihat perbedaan"
|
|
|
|
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
|
msgid "Error reading file: %s"
|
|
msgstr "Kesalahan pembacaan file: %s"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
|
|
msgid "Ignore all disk changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
|
|
msgid "Reload checked files from disk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Beberapa file telah berubah pada disk:"
|
|
|
|
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr "Bedakan huruf besar dan kecil contoh A dan a"
|
|
|
|
#: lazarusidestrconsts.lisdlgadd
|
|
#, fuzzy
|
|
#| msgid "Add..."
|
|
msgctxt "lazarusidestrconsts.lisdlgadd"
|
|
msgid "Add ..."
|
|
msgstr "Tambah..."
|
|
|
|
#: lazarusidestrconsts.lisdlgalloptions
|
|
msgid "All options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgchangeclass
|
|
msgid "Change Class ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgdefines
|
|
msgid "Defines ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgedit
|
|
#, fuzzy
|
|
#| msgid "Edit..."
|
|
msgctxt "lazarusidestrconsts.lisdlgedit"
|
|
msgid "Edit ..."
|
|
msgstr "Edit..."
|
|
|
|
#: lazarusidestrconsts.lisdlgexport
|
|
msgctxt "lazarusidestrconsts.lisdlgexport"
|
|
msgid "Export ..."
|
|
msgstr "Ekspor ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgimport
|
|
msgctxt "lazarusidestrconsts.lisdlgimport"
|
|
msgid "Import ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgmore
|
|
msgctxt "lazarusidestrconsts.lisdlgmore"
|
|
msgid "More ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgopen
|
|
msgctxt "lazarusidestrconsts.lisdlgopen"
|
|
msgid "Open ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdlgsave
|
|
msgctxt "lazarusidestrconsts.lisdlgsave"
|
|
msgid "Save ..."
|
|
msgstr "Simpan ..."
|
|
|
|
#: lazarusidestrconsts.lisdoesnotexists
|
|
msgid "%s does not exist: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotchange
|
|
msgid "Do not change"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
|
msgid "%sDo not check if another IDE instance is already running"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr "Jangan tutup proyek"
|
|
|
|
#: lazarusidestrconsts.lisdonotcompiledependencies
|
|
msgid "do not compile dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen"
|
|
msgstr "Jangan tampilkan layar splash"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
|
msgid "Do not show this dialog for this project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
|
msgid "Do not show this message again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
|
|
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdonwloadonlinepackages
|
|
msgid ""
|
|
"The following package(s) are not available locally: %s.\n"
|
|
"In order to install it, you must download them first. Download now?\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdown
|
|
msgctxt "lazarusidestrconsts.lisdown"
|
|
msgid "Down"
|
|
msgstr "Turun"
|
|
|
|
#: lazarusidestrconsts.lisdowngrade
|
|
msgid "Downgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdowngradeconfiguration
|
|
msgid "Downgrade configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdownload
|
|
msgid "Download"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
|
msgid "Do you still want to create the new project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
|
msgid "Do you still want to open another project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
|
msgid "Do you still want to quit?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
|
msgid "Draw grid lines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
|
msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Copy komponen yang dipilih ke clipboard"
|
|
|
|
#: lazarusidestrconsts.lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Potong komponen yang dipilih ke clipboard"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr "Pindahkan komponen selangkah kebelakang"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr "Pindahkan komponen selangkah kedepan"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr "Pindahkan komponen ke belakang"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr "Pindahkan komponen ke depan"
|
|
|
|
#: lazarusidestrconsts.lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Paste komponen yang dipilih dari clipboard"
|
|
|
|
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Pilih komponen leluhurnya"
|
|
|
|
#: lazarusidestrconsts.lisduplicate
|
|
msgid "Duplicate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateentry
|
|
msgid "Duplicate entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatefilename
|
|
msgid "Duplicate File Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
|
msgid "Duplicate found of value \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatemodename
|
|
msgid "Mode \"%s\" is already present in the list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatename
|
|
msgid "Duplicate Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
#, fuzzy,badformat
|
|
#| msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
|
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
|
msgstr "Duplikasi nama: Komponen bernama %s%s%ssudah ada dalam komponen inherited %s"
|
|
|
|
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
|
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatesearchpath
|
|
msgid "Duplicate search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
|
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateunit
|
|
msgid "Duplicate Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisduplicateunitin
|
|
msgid "Duplicate unit \"%s\" in \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedit
|
|
msgctxt "lazarusidestrconsts.lisedit"
|
|
msgid "Edit"
|
|
msgstr "Edit"
|
|
|
|
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
|
msgid "Edit additional help for messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditcontexthelp
|
|
msgid "Edit context help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedithelp
|
|
msgid "Edit help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditkey
|
|
msgid "Edit Key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditorcolors
|
|
msgid "Editor Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditormacros
|
|
msgid "Editor macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditortoolbar
|
|
msgid "Editor ToolBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarsettings
|
|
msgid "Editor Toolbar Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarvisible
|
|
msgid "Editor Toolbar is &visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedoptsloadascheme
|
|
msgid "Load a scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefallpackages
|
|
msgid "All packages"
|
|
msgstr "Semua paket"
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Proyek Saat Ini"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsallprojects
|
|
msgid "All projects"
|
|
msgstr "Semua proyek"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
|
msgid "set FPC mode to DELPHI"
|
|
msgstr "set mode FPC ke DELPHI"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
|
msgid "set FPC mode to FPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
|
msgid "set FPC mode to GPC"
|
|
msgstr "set mode FPC ke GPC"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
|
msgid "set FPC mode to MacPas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
|
msgid "set FPC mode to TP"
|
|
msgstr "set mode FPC ke TP"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
|
msgid "set IOCHECKS on"
|
|
msgstr "set IOCHECKS on"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
|
msgid "set OVERFLOWCHECKS on"
|
|
msgstr "set OVERFLOWCHECKS on"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
|
msgid "set RANGECHECKS on"
|
|
msgstr "set RANGECHECKS on"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
|
msgid "use HeapTrc unit"
|
|
msgstr "gunakan unit HeapTrc"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
|
msgid "use LineInfo unit"
|
|
msgstr "gunakan unit LineInfo"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Piranti yang benar membutuhkan setidaknya judul dan nama file."
|
|
|
|
#: lazarusidestrconsts.lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Edit Piranti"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolkey
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
|
msgid "Key"
|
|
msgstr "Kunci"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolmacros
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
|
msgid "Macros"
|
|
msgstr "Makro"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parameters:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr "Namafileprogram:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
#, fuzzy
|
|
#| msgid "Scan output for Free Pascal Compiler messages"
|
|
msgid "Scan output for FPC messages"
|
|
msgstr "Pindai output untuk pesan Kompilator Free Pascal"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
|
#, fuzzy
|
|
#| msgid "Scan output for make messages"
|
|
msgid "Scan output for \"make\" messages"
|
|
msgstr "Pindai output untuk pesan make"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Dibutuhkan Nama file dan Judul"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Direktori Kerja:"
|
|
|
|
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
|
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdall
|
|
msgctxt "lazarusidestrconsts.lisemdall"
|
|
msgid "All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdemptymethods
|
|
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
|
msgid "Empty Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdnoclass
|
|
msgid "No class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdnoclassat
|
|
msgid "No class at %s(%s,%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdpublic
|
|
msgid "Public"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdpublished
|
|
msgid "Published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
|
msgid "Unable to show empty methods of the current class, because%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisempty
|
|
msgid "Empty"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableall
|
|
msgid "&Enable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableallinsamesource
|
|
msgid "Enable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablebreakpoint
|
|
msgid "Enable Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenabled
|
|
msgctxt "lazarusidestrconsts.lisenabled"
|
|
msgid "Enabled"
|
|
msgstr "Hidupkan"
|
|
|
|
#: lazarusidestrconsts.lisenabledonlyforpackages
|
|
msgid "Enabled only for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
|
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablegroups
|
|
msgid "Enable Groups"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablei18nforlfm
|
|
msgid "Enable I18N for LFM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
|
msgid "Enable internationalization and translation support"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Hidupkan makro"
|
|
|
|
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
|
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenclose
|
|
msgid "Enclose"
|
|
msgstr "Sertakan"
|
|
|
|
#: lazarusidestrconsts.lisencloseinifdef
|
|
msgid "Enclose in $IFDEF"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
|
msgid "Number of files failed to convert: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
|
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisendlessloopinmacros
|
|
msgid "Endless loop in macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenternewnameformacros
|
|
msgid "Enter new name for Macro \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
|
msgid "Environment variable, name as parameter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
|
msgid "Directory not found"
|
|
msgstr "Direktori tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Nama file debugger tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "File debugger \"%s\" bukan eksekutabel."
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Direktori Tes \"%s\" tidak ditemukan."
|
|
|
|
#: lazarusidestrconsts.liserrinvalidoption
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr "Opsi tidak benar di posisi %d: \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrnooptionallowed
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr "Opsi di posisi %d tidak membolehkan argumen: %s"
|
|
|
|
#: lazarusidestrconsts.liserroptionneeded
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr "Opsi di posisi %d tidak membolehkan argumen: %s"
|
|
|
|
#: lazarusidestrconsts.liserror
|
|
msgid "Error: "
|
|
msgstr "Salah:"
|
|
|
|
#: lazarusidestrconsts.liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Kesalahan pembuatan file"
|
|
|
|
#: lazarusidestrconsts.liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Kesalahan penghapusan file"
|
|
|
|
#: lazarusidestrconsts.liserrorin
|
|
msgid "Error in %s"
|
|
msgstr "Kesalahan dalam %s"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
|
msgid "Error in the compiler file name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
|
msgid "Error in the custom compiler options (Other):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
|
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
|
msgid "Error in the \"Debugger path addition\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
|
msgid "Error in the search path for \"Include files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
|
msgid "Error in the search path for \"Libraries\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
|
msgid "Error in the search path for \"Object files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
|
msgid "Error in the search path for \"Other sources\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
|
msgid "Error in the search path for \"Other unit files\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
|
msgid "Error in the \"unit output directory\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
|
msgid "Error: (lazarus) invalid build mode \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile2
|
|
msgid "Error loading file \"%s\":"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfrom
|
|
msgid "Error loading %s from%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr "Kesalahan pemindahan komponen"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent2
|
|
msgid "Error moving component %s:%s"
|
|
msgstr "Kesalahan pemindahan komponen %s:%s"
|
|
|
|
#: lazarusidestrconsts.liserrornamingcomponent
|
|
msgid "Error naming component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserroropeningform
|
|
msgid "Error opening form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr "Pemindaian aliran komponen lfm salah."
|
|
|
|
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
|
#, fuzzy,badformat
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr "Pembacaan daftar paket salah dari file %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxmlfile
|
|
msgid "Error reading xml file \"%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Kesalahan penggantian nama file"
|
|
|
|
#: lazarusidestrconsts.liserrors
|
|
msgctxt "lazarusidestrconsts.liserrors"
|
|
msgid "Errors"
|
|
msgstr "Salah"
|
|
|
|
#: lazarusidestrconsts.liserrors2
|
|
msgid ", Errors: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorsavingform
|
|
msgid "Error saving form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorsavingto
|
|
msgid "Error saving %s to%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
|
msgid "Error setting the name of a component %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingfile
|
|
msgid "Error writing file \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr "Kesalahan penulisan daftar paket ke file%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisevalexpression
|
|
msgctxt "lazarusidestrconsts.lisevalexpression"
|
|
msgid "Eval expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisevaluate
|
|
msgid "E&valuate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisevaluatemodify
|
|
msgid "&Evaluate/Modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogclear
|
|
msgid "Clear Events"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogoptions
|
|
msgid "Event Log Options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventlogsavetofile
|
|
msgid "Save Events to File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventslogaddcomment
|
|
msgid "Add Comment ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseventslogaddcomment2
|
|
msgid "Add Comment"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseverynthlinenumber
|
|
msgid "Every n-th line number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplefile
|
|
msgid "Example file:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesbuildallselected
|
|
msgid "Build all selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
|
msgid "Open first selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexceptiondialog
|
|
msgid "Debugger Exception Notification"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludedatruntime
|
|
msgid "%s excluded at run time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludefilter
|
|
#, fuzzy
|
|
#| msgid "Exclude Filter"
|
|
msgid "Exclude filter"
|
|
msgstr "Filter Kekecualian"
|
|
|
|
#: lazarusidestrconsts.lisexecutableisadirectory
|
|
msgid "executable \"%s\" is a directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
|
msgid "executable \"%s\" lacks the permission to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandafter
|
|
msgid "Executing command after"
|
|
msgstr "Mengeksekusi perintah setelah"
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandbefore
|
|
msgid "Executing command before"
|
|
msgstr "Mengeksekusi perintah sebelum"
|
|
|
|
#: lazarusidestrconsts.lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Eksekusi dihentikan"
|
|
|
|
#: lazarusidestrconsts.lisexit
|
|
msgctxt "lazarusidestrconsts.lisexit"
|
|
msgid "Exit"
|
|
msgstr "Keluar"
|
|
|
|
#: lazarusidestrconsts.lisexitcode
|
|
msgid "Exit code %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandall
|
|
msgid "Expand All (*)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr "Lebarkan semua kelas"
|
|
|
|
#: lazarusidestrconsts.lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr "Lebarkan semua paket"
|
|
|
|
#: lazarusidestrconsts.lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr "Lebarkan semua unit"
|
|
|
|
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Nama file lebar dari file editor saat ini"
|
|
|
|
#: lazarusidestrconsts.lisexport
|
|
#, fuzzy
|
|
#| msgid "Export ..."
|
|
msgctxt "lazarusidestrconsts.lisexport"
|
|
msgid "Export"
|
|
msgstr "Ekspor ..."
|
|
|
|
#: lazarusidestrconsts.lisexportall
|
|
msgid "Export all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportallitemstofile
|
|
msgid "Export All Items to File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
|
msgid "Export environment options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexporthtml
|
|
msgid "Export as HTML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportimport
|
|
msgid "Export / Import"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportlist
|
|
msgid "Export list"
|
|
msgstr "Daftar ekspor"
|
|
|
|
#: lazarusidestrconsts.lisexportpackagelistxml
|
|
msgid "Export package list (*.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportselected
|
|
msgid "Export selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexportsub
|
|
msgid "Export >>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpression
|
|
msgid "Expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
|
|
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
|
|
msgid "Extend include files search path of project with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendincludepath
|
|
msgid "Extend include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitpath
|
|
msgid "Extend unit path?"
|
|
msgstr "Lebarkan path unit?"
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
|
|
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
|
|
msgid "Extend unit search path of project with%s\"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextract
|
|
msgid "Extract"
|
|
msgstr "Ekstrak"
|
|
|
|
#: lazarusidestrconsts.lisextractprocedure
|
|
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
|
msgid "Extract Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextremelyverbose
|
|
msgid "Extremely Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexttoolexternaltools
|
|
#, fuzzy
|
|
#| msgid "External tools"
|
|
msgid "External Tools"
|
|
msgstr "Piranti eksternal"
|
|
|
|
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Piranti Maksimum tercapai"
|
|
|
|
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Terdapat jumlah maksimum %s piranti."
|
|
|
|
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
|
msgid "Failed to add %d not unique resource(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
|
msgid "Failed to create Application Bundle for \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
|
msgid "Failed to load fold state"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
|
msgid "failed to resolve macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfailedtosavefile
|
|
msgid "Failed to save file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfatal
|
|
msgctxt "lazarusidestrconsts.lisfatal"
|
|
msgid "Fatal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
|
msgid "Reduce designer painting"
|
|
msgstr "Kurangi penggambaran pendesain"
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
|
|
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
|
msgstr "Gambar item pendesain hanya saat menganggur (mengurangi kelebihan beban untuk komputer lambat)"
|
|
|
|
#: lazarusidestrconsts.lisfile
|
|
msgctxt "lazarusidestrconsts.lisfile"
|
|
msgid "File"
|
|
msgstr "File"
|
|
|
|
#: lazarusidestrconsts.lisfile2
|
|
msgid "File: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
|
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr "File %s%s%s%ssepertinya bukan file teks.%sBuka saja?"
|
|
|
|
#: lazarusidestrconsts.lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilter
|
|
msgid "File filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilters
|
|
msgid "File Filters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersaddrow
|
|
msgid "Add Row"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
|
msgid "Delete Row"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
|
msgid "Insert Row"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersmask
|
|
msgid "File mask"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
|
msgid "Set defaults"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilefilterstitle
|
|
msgid "These are file filters that will appear in all File Open dialogs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilehaschangedsave
|
|
msgid "File \"%s\" has changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilehasnoproject
|
|
msgid "File has no project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisdirectory
|
|
msgid "File is directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisnotanexecutable
|
|
msgid "File is not an executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisnotwritable
|
|
msgid "File is not writable"
|
|
msgstr "File tidak bisa diulisi"
|
|
|
|
#: lazarusidestrconsts.lisfileissymlink
|
|
msgid "File is symlink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileisvirtual
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s is virtual."
|
|
msgid "File \"%s\" is virtual."
|
|
msgstr "File %s%s%s adalah virtual."
|
|
|
|
#: lazarusidestrconsts.lisfilelinkerror
|
|
msgid "File link error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenameaddress
|
|
msgid "Filename/Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenamestyle
|
|
msgid "Filename Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "File tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound2
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found.%s"
|
|
msgctxt "lazarusidestrconsts.lisfilenotfound2"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "File %s%s%s tidak ditemukan.%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound3
|
|
msgid "file %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound4
|
|
msgid "file not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound5
|
|
msgid "File not found:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
|
msgid "File \"%s\" not found.%sDo you want to create it?"
|
|
msgstr "File %s%s%s tidak ditemukan.%sAnda ingin membuatnya?%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "File tidak dengan huruf kecil"
|
|
|
|
#: lazarusidestrconsts.lisfilenottext
|
|
msgid "File not text"
|
|
msgstr "File bukan teks"
|
|
|
|
#: lazarusidestrconsts.lisfilesettings
|
|
msgid "File Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
|
msgid "File %s has incorrect syntax."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
|
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileshaverightencoding
|
|
msgid "*** All found files already have the right encoding ***"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
|
msgid "Files in ASCII or UTF-8 encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
|
msgid "File %s is converted to text format."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
|
msgid "Files not in ASCII nor UTF-8 encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
|
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgstr "file, dimana output debug ditulisnya. Jika tidak ditetapkan, output debug ditulis ke konsol"
|
|
|
|
#: lazarusidestrconsts.lisfilter
|
|
msgid "Filter"
|
|
msgstr "Filter"
|
|
|
|
#: lazarusidestrconsts.lisfilter3
|
|
msgid "Filter: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
|
msgid "Filter all messages of certain type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
|
msgid "Filter all messages of type %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilteralreadyexists
|
|
msgid "Filter already exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
|
msgid "Filter Debug Messages and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterhintsandbelow
|
|
msgid "Filter Hints and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
|
msgid "Filter Hints without Source Position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
|
msgid "Filter None, do not filter by urgency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternonurgentmessages
|
|
msgid "Filter non urgent Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilternotesandbelow
|
|
msgid "Filter Notes and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiltersets
|
|
msgid "Filter Sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
|
msgid "Filter the available options list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
|
msgid "Filter Verbose Messages and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
|
msgid "Filter Warnings and below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfind
|
|
msgid "Find ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfinddeclarationof
|
|
msgid "Find Declaration of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfiledirectories
|
|
msgid "D&irectories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilefilemask
|
|
msgid "Fi&le mask"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
|
#, fuzzy
|
|
#| msgid "Include sub directories"
|
|
msgid "Include &sub directories"
|
|
msgstr "Sertakan sub direktori"
|
|
|
|
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
|
msgid "Only text files"
|
|
msgstr "Hanya file teks"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
|
msgid "search all files in &project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
|
msgid "search all &open files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
|
msgid "search in &active file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
|
msgid "search in &directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilewhere
|
|
msgid "Where"
|
|
msgstr "Dimana"
|
|
|
|
#: lazarusidestrconsts.lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindmissingunit
|
|
msgid "Find missing unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfirst
|
|
msgid "First"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfirsttest
|
|
msgid "&First test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr "Betulkan file LFM"
|
|
|
|
#: lazarusidestrconsts.lisfloatingpoin
|
|
msgid "Floating Point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfocushint
|
|
msgid "Focus hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr "Paksa penggantian nama"
|
|
|
|
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
|
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisform
|
|
msgid "Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisformacosdarwin
|
|
msgid "For macOS (Darwin)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Format salah"
|
|
|
|
#: lazarusidestrconsts.lisforwindows
|
|
msgid "For Windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfoundversionexpected
|
|
msgid "Found version %s, expected %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpccfgismissing
|
|
msgid "fpc.cfg is missing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
|
msgid "FPC version as one number (e.g. 20701)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmakefailed
|
|
msgid "fpcmake failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagefile2
|
|
msgid "FPC message file:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagesappendix
|
|
msgid "FPC messages: Appendix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcresources
|
|
msgid "FPC resources (.res)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcsources
|
|
msgid "FPC sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpctooold
|
|
msgid "FPC too old"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdoceditor
|
|
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocerrorwriting
|
|
msgid "Error writing \"%s\"%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
|
msgid "FPDoc syntax error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagename
|
|
msgid "FPDoc package name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
|
msgid "FPDoc package name. Default is project file name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
|
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisframe
|
|
msgid "Frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreeingbufferlines
|
|
msgid "freeing buffer lines: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
|
msgid "Free Pascal Compiler messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
|
#, fuzzy
|
|
#| msgid "Freepascal source directory"
|
|
msgid "Free Pascal source directory"
|
|
msgstr "direktori sumber Freepascal"
|
|
|
|
#: lazarusidestrconsts.lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr "File tambahan yang dicari (contoh /path/*.pas;/path2/*.pp)"
|
|
|
|
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Cari atau Ganti nama Pengenal"
|
|
|
|
#: lazarusidestrconsts.lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Cari Referensi"
|
|
|
|
#: lazarusidestrconsts.lisfriidentifier
|
|
msgid "Identifier: %s"
|
|
msgstr "Pengenal: %s"
|
|
|
|
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr "dalam semua paket dan proyek terbuka"
|
|
|
|
#: lazarusidestrconsts.lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "dalam unit saat ini"
|
|
|
|
#: lazarusidestrconsts.lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "dalam proyek utama"
|
|
|
|
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr "dalam proyek/paket pemilik unit saat ini"
|
|
|
|
#: lazarusidestrconsts.lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Pengenal tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr "Ganti nama semua Referensi"
|
|
|
|
#: lazarusidestrconsts.lisfrirenaming
|
|
msgid "Renaming"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrisearch
|
|
msgid "Search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr "Cari dalam komentar juga"
|
|
|
|
#: lazarusidestrconsts.lisfull
|
|
msgid "Full"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfunction
|
|
msgctxt "lazarusidestrconsts.lisfunction"
|
|
msgid "Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneral
|
|
msgctxt "lazarusidestrconsts.lisgeneral"
|
|
msgid "General"
|
|
msgstr "Umum"
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
|
msgid "get word at current cursor position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
|
|
msgid "Get word at current cursor position."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisglobalsettings
|
|
msgid "Global settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgotoline
|
|
msgid "Goto Line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgotoselected
|
|
msgid "Goto selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgplnotice
|
|
#, fuzzy,badformat
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
#| "\n"
|
|
#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
"\n"
|
|
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lisgroup
|
|
msgid "Group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupassignexisting
|
|
msgid "Assign to existing \"%s\" group?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupemptydelete
|
|
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupemptydeletemore
|
|
msgid "%sThere are %d more empty groups, delete all?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgrouplocalvariables
|
|
msgid "Group automatically defined local variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
|
|
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameinput
|
|
msgid "Group name:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupnameinvalid
|
|
msgid "BreakpointGroup name must be a valid Pascal identifier name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsetnew
|
|
msgid "Set new group ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsetnone
|
|
msgid "Clear group(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
|
msgid "Enable or Disable groups of debug output. Valid Options are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishashelp
|
|
msgid "Has Help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisheadercolors
|
|
msgid "Header colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Komentar header untuk class"
|
|
|
|
#: lazarusidestrconsts.lishelp
|
|
msgctxt "lazarusidestrconsts.lishelp"
|
|
msgid "Help"
|
|
msgstr "Panduan"
|
|
|
|
#: lazarusidestrconsts.lishelpentries
|
|
msgid "Help entries"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr "Selektor Panduan"
|
|
|
|
#: lazarusidestrconsts.lishexadecimal
|
|
msgid "Hexadecimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
|
#, fuzzy
|
|
#| msgid "Help for FreePascal Compiler message"
|
|
msgid "Help for Free Pascal Compiler message"
|
|
msgstr "Bantuan untuk pesan Kompilator FreePascal"
|
|
|
|
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
|
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
|
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
|
msgid "Hide message by inserting IDE directive {%H-}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
|
|
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidesearch
|
|
msgid "Hide Search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidewindow
|
|
msgctxt "lazarusidestrconsts.lishidewindow"
|
|
msgid "Hide window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
|
msgid "Hide with package option (-vm%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
|
msgid "Hide with project option (-vm%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishint
|
|
msgctxt "lazarusidestrconsts.lishint"
|
|
msgid "Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
|
msgid "Hint: A default value can be defined in the conditionals."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
|
msgid "A hint at property's name shows its description."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
|
|
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishints
|
|
msgid ", Hints: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintsaveall
|
|
msgid "Save all"
|
|
msgstr "Simpan semua"
|
|
|
|
#: lazarusidestrconsts.lishintstepinto
|
|
msgid "Step Into"
|
|
msgstr "Melangkah kedalam"
|
|
|
|
#: lazarusidestrconsts.lishintstepout
|
|
msgid "Run until function returns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishintstepover
|
|
msgid "Step Over"
|
|
msgstr "Melewati"
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr "Petunjuk: Fungsi Buat Resourcestring mengharapkan konstan string.%sSilahkan pilih ekspresi dan coba lagi."
|
|
|
|
#: lazarusidestrconsts.lishinttoggleformunit
|
|
msgid "Toggle Form/Unit"
|
|
msgstr "Toggle Form/Unit"
|
|
|
|
#: lazarusidestrconsts.lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Lihat Form"
|
|
|
|
#: lazarusidestrconsts.lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Lihat Unit"
|
|
|
|
#: lazarusidestrconsts.lishitcount
|
|
msgid "Hitcount"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Database"
|
|
|
|
#: lazarusidestrconsts.lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Opsi Panduan"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Properti:"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Peninjauan"
|
|
|
|
#: lazarusidestrconsts.lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "Path FPC Doc HTML"
|
|
|
|
#: lazarusidestrconsts.lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Horisontal"
|
|
|
|
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
|
msgid "Horizontal lines between properties."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisid
|
|
msgctxt "lazarusidestrconsts.lisid"
|
|
msgid "ID"
|
|
msgstr "ID"
|
|
|
|
#: lazarusidestrconsts.lisidcaddition
|
|
msgid "Addition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidcopening
|
|
msgid "Opening"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liside
|
|
msgid "IDE"
|
|
msgstr "IDE"
|
|
|
|
#: lazarusidestrconsts.lisidebuildoptions
|
|
msgid "IDE build options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidecompileandrestart
|
|
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
|
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
|
msgid "Creating Makefile for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
|
|
msgid "Error: running 'compile after' tool failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
|
msgid "Information about the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
|
|
msgid "WARNING: unit name invalid %s, package=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemacros
|
|
msgid "IDE Macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
|
|
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
|
msgid "The IDE maintains the title in main unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifier
|
|
msgid "identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr "Pengenal dimulai dengan ..."
|
|
|
|
#: lazarusidestrconsts.lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr "Pengenal berisi ..."
|
|
|
|
#: lazarusidestrconsts.lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "Opsi IDE"
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsbuildmode
|
|
msgid "IDE title shows selected build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsprojectdir
|
|
msgid "IDE title shows project directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
|
msgid "IDE title starts with project name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoallbuildmodes
|
|
msgid "All build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecocompileroptionsof
|
|
msgid "Compiler options of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
|
msgid "Current build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxml
|
|
msgid "Error opening XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
|
msgid "Error opening XML file \"%s\":%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
|
msgid "Export Compiler Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr "File ekspor sudah ada"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
#, fuzzy,badformat
|
|
#| msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr "File ekspor %s%s%s sudah ada.%sBuka file dan hanya timpa opsi kompilator?%s(Seting lain akan disimpan.)"
|
|
|
|
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
|
msgid "Import Compiler Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Ambil dari file"
|
|
|
|
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
|
msgid "File \"%s\" does not contain compiler options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiecorecentfiles
|
|
msgid "Recent files"
|
|
msgstr "File Terbaru"
|
|
|
|
#: lazarusidestrconsts.lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Simpan ke file"
|
|
|
|
#: lazarusidestrconsts.lisifnotchecked
|
|
msgid "If not checked:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
|
msgid "If only the session info changed, ask about saving it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
|
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignore
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisignore"
|
|
msgid "Ignore"
|
|
msgstr "Abaikan"
|
|
|
|
#: lazarusidestrconsts.lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreandcontinue
|
|
msgid "Ignore and continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignorebinaries
|
|
msgid "Ignore binaries"
|
|
msgstr "Abaikan biner"
|
|
|
|
#: lazarusidestrconsts.lisignoreexceptiontype
|
|
msgid "Ignore this exception type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisignoreuseasancestor
|
|
msgid "Ignore, use %s as ancestor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
|
msgid "Imitate indentation of current unit, project or package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimplementationcommentforclass
|
|
msgid "Implementation comment for class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimport
|
|
msgctxt "lazarusidestrconsts.lisimport"
|
|
msgid "Import"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportant
|
|
msgctxt "lazarusidestrconsts.lisimportant"
|
|
msgid "Important"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
|
msgid "Import environment options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportfromfile
|
|
msgid "Import from File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
|
msgid "Importing BuildModes is not supported for packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimportlist
|
|
msgid "Import list"
|
|
msgstr "Daftar impor"
|
|
|
|
#: lazarusidestrconsts.lisimportpackagelistxml
|
|
msgid "Import package list (*.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisimpossible
|
|
msgid "Impossible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
|
msgid "In a source directory of the package \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
|
msgid "In a source directory of the project. Check for duplicates."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludeallsubdirectories
|
|
msgid "Include all subdirectories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincludefilter
|
|
#, fuzzy
|
|
#| msgid "Include Filter"
|
|
msgid "Include filter"
|
|
msgstr "Filter Include"
|
|
|
|
#: lazarusidestrconsts.lisincludepath
|
|
msgid "include path"
|
|
msgstr "path include"
|
|
|
|
#: lazarusidestrconsts.lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr "Sertakan path"
|
|
|
|
#: lazarusidestrconsts.lisincludesubdirectories
|
|
msgid "Include subdirectories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincompatibleppu
|
|
msgid ", incompatible ppu=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
|
msgid "Incorrect configuration directory found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindentationforpascalsources
|
|
msgid "Indentation for Pascal sources"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindex
|
|
msgid "Index"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinformation
|
|
msgid "Information"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutunit
|
|
msgid "Information about %s"
|
|
msgstr "Informasi tentang %s"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
|
msgid "Information about used FPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
|
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinfrontofrelated
|
|
msgid "In front of related"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinheriteditem
|
|
msgid "Inherited Item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinheritedparameters
|
|
msgid "Inherited parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
|
msgid "Inherited project component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinitializelocalvariable
|
|
msgid "Initialize Local Variable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsert
|
|
msgctxt "lazarusidestrconsts.lisinsert"
|
|
msgid "Insert"
|
|
msgstr "Insert"
|
|
|
|
#: lazarusidestrconsts.lisinsertassignment
|
|
msgid "Insert Assignment %s := ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdate
|
|
msgid "insert date"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtime
|
|
msgid "insert date and time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
|
msgid "Insert date and time. Optional: format string."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
|
msgid "Insert date. Optional: format string."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertendifneeded
|
|
msgid "insert end if needed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
|
|
msgid ""
|
|
"Insert header of current procedure.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
|
|
"WithoutClassKeyword,// without 'class' proc keyword\n"
|
|
"AddClassName, // extract/add ClassName.\n"
|
|
"WithoutClassName, // skip classname\n"
|
|
"WithoutName, // skip function name\n"
|
|
"WithoutParamList, // skip param list\n"
|
|
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
|
|
"WithParameterNames, // extract parameter names\n"
|
|
"WithoutParamTypes, // skip colon, param types and default values\n"
|
|
"WithDefaultValues, // extract default values\n"
|
|
"WithResultType, // extract colon + result type\n"
|
|
"WithOfObject, // extract 'of object'\n"
|
|
"WithCallingSpecs, // extract cdecl; inline;\n"
|
|
"WithProcModifiers, // extract forward; alias; external;\n"
|
|
"WithComments, // extract comments and spaces\n"
|
|
"InUpperCase, // turn to uppercase\n"
|
|
"CommentsToSpace, // replace comments with a single space\n"
|
|
" // (default is to skip unnecessary space,\n"
|
|
" // e.g 'Do ;' normally becomes 'Do;'\n"
|
|
" // with this option you get 'Do ;')\n"
|
|
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
|
|
"WithoutSemicolon, // skip semicolon at end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertmacro
|
|
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
|
msgid "Insert Macro"
|
|
msgstr "Sisipkan Makro"
|
|
|
|
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
|
msgid "Insert name of current procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag
|
|
msgid "Insert PrintShort tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag2
|
|
msgid "Insert printshort tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurehead
|
|
msgid "insert procedure head"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurename
|
|
msgid "insert procedure name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertsemicolonifneeded
|
|
msgid "Insert semicolon if needed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserttime
|
|
msgid "insert time"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
|
msgid "Insert time. Optional: format string."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinserturltag
|
|
msgid "Insert url tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsession
|
|
msgid "In session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspect
|
|
msgid "&Inspect"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectclassinherit
|
|
msgid "%s : Class %s inherits from %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectdata
|
|
msgid "Data"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectdialog
|
|
msgid "Debug Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectmethods
|
|
msgid "Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectpointerto
|
|
msgid "Pointer to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectproperties
|
|
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
|
msgid "Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcolclass
|
|
msgid "Show class column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcoltype
|
|
msgid "Show type column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcolvisibility
|
|
msgid "Show visibility column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectunavailable
|
|
msgid "%s : unavailable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectuseinstance
|
|
msgid "Instance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinspectuseinstancehint
|
|
msgid "Use instance class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallationfailed
|
|
msgid "Installation failed"
|
|
msgstr "Instalasi gagal"
|
|
|
|
#: lazarusidestrconsts.lisinstalled
|
|
msgid "installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallitilikethefat
|
|
msgid "Install it, I like the fat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallpackagesmsg
|
|
msgid ""
|
|
"The following packages are not installed, but available in the main repository: %s.\n"
|
|
"Do you wish to install missing packages?\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Pilihan Instalasi"
|
|
|
|
#: lazarusidestrconsts.lisinstalluninstallpackages
|
|
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
|
msgid "Install/Uninstall Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
|
msgid "Instead of compile package create a simple Makefile."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsufficientencoding
|
|
msgid "Insufficient encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinteractive
|
|
msgid "Interactive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinternalerror
|
|
msgid "internal error: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidcommand
|
|
msgid "Invalid command"
|
|
msgstr "Perintah tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr "Penghapusan tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutable
|
|
msgid "Invalid Executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
|
msgid "The file \"%s\" is not executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpression
|
|
msgid "Invalid expression:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Ekspresi tidak benar.%sPetunjuk: Fungsi Make Resourcestring mengharapkan konstan string dalam file tunggal. Silahkan pilih ekspresi dan coba lagi."
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
|
msgid "Invalid line, column in message%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosin
|
|
msgid "Invalid macros in \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
|
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
|
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
|
msgid "Invalid macro name \"%s\". The name is a keyword."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmask
|
|
msgid "Invalid Mask"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmode
|
|
msgid "Invalid mode %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr "Pemilihan multi tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisinvalidoff
|
|
msgid "Invalid (Off)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidon
|
|
msgid "Invalid (On)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Pengenal Pascal Tidak Benar"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiername
|
|
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr "nama proc tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Nama file proyek tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
|
msgid "Invalid publishing Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr "Pilihan tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisinvalidversionin
|
|
msgid "invalid version in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s sudah merupakan bagian dari Proyek."
|
|
|
|
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "%s%s%sbukan nama proyek yang benar.%sSilahkan pilih yang lain (contoh. project1.lpi)"
|
|
|
|
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
|
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisisddirectorynotfound
|
|
msgid "directory not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisissues
|
|
msgid "Issues"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
|
msgid "I wonder how you did that. Error in the %s:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
|
msgid "I wonder how you did that: Error in the base directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjhjumphistory
|
|
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
|
msgid "Jump History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoerror
|
|
msgid "Jump to error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
|
msgid "When an error in the sources is found at identifier completion, jump to it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisjumptoprocedure
|
|
msgid "Jump to procedure %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskb
|
|
msgid "%s KB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeep2
|
|
msgid "Keep"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepfileopen
|
|
msgid "Keep converted files open in editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepfileopenhint
|
|
msgid "All project files will be open in editor after conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepininstalllist
|
|
msgid "Keep in install list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Biarkan nama"
|
|
|
|
#: lazarusidestrconsts.liskeepopen
|
|
msgid "Keep open"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
|
msgid "Keep relative indentation of multi line template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepsubindentation
|
|
msgid "Keep indentation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr "Biarkan mereka dan lanjutkan"
|
|
|
|
#: lazarusidestrconsts.liskey
|
|
msgctxt "lazarusidestrconsts.liskey"
|
|
msgid "Key"
|
|
msgstr "Kunci"
|
|
|
|
#: lazarusidestrconsts.liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Perintah Kustom"
|
|
|
|
#: lazarusidestrconsts.liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Perintah Desainer"
|
|
|
|
#: lazarusidestrconsts.liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr "Perintah Inspektor Objek"
|
|
|
|
#: lazarusidestrconsts.liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr "Batalkan pembuatan"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpaddress
|
|
msgid "Add Address Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddbpsource
|
|
msgid "Add Source Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
|
msgid "Add Data/WatchPoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmaddwatch
|
|
msgid "Add watch"
|
|
msgstr "Tambah pengawasan"
|
|
|
|
#: lazarusidestrconsts.liskmbuildmanymodes
|
|
msgid "Build many modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr "Bangun proyek/program"
|
|
|
|
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Klasik"
|
|
|
|
#: lazarusidestrconsts.liskmcleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Tutup proyek"
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmcompileprojectprogram
|
|
msgid "Compile project/program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmconfigbuildfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Config %sBuild File%s"
|
|
msgid "Config \"Build File\""
|
|
msgstr "Konfig %sBuild File%s"
|
|
|
|
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
|
#, fuzzy
|
|
#| msgid "Configure custom components"
|
|
msgid "Configure Custom Components"
|
|
msgstr "Konfigurasi komponen kustom"
|
|
|
|
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr "Bantuan sensitif konteks"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Ubah paket Delphi ke paket Lazarus"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi project to Lazarus project"
|
|
msgid "Convert Delphi Project to Lazarus Project"
|
|
msgstr "Ubah proyek Delphi ke proyek Lazarus"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi unit to Lazarus unit"
|
|
msgid "Convert Delphi Unit to Lazarus Unit"
|
|
msgstr "Ubah unit Delphi ke unit Lazarus"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
|
#, fuzzy
|
|
#| msgid "Convert DFM file to LFM"
|
|
msgid "Convert DFM File to LFM"
|
|
msgstr "Ubah file DFM ke LFM"
|
|
|
|
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
|
#, fuzzy
|
|
#| msgid "Copy selected Components to clipboard"
|
|
msgid "Copy selected components"
|
|
msgstr "Copy Komponen yang dipilih ke clipboard"
|
|
|
|
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
|
#, fuzzy
|
|
#| msgid "Cut selected Components to clipboard"
|
|
msgid "Cut selected components"
|
|
msgstr "Cut Komponen yang dipilih ke clipboard"
|
|
|
|
#: lazarusidestrconsts.liskmdefaulttoosx
|
|
msgid "Default adapted to macOS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Hapus karakter terakhir"
|
|
|
|
#: lazarusidestrconsts.liskmdiffeditorfiles
|
|
#, fuzzy
|
|
#| msgid "Diff editor files"
|
|
msgid "Diff Editor Files"
|
|
msgstr "File editor Diff"
|
|
|
|
#: lazarusidestrconsts.liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr "Edit Template Kode"
|
|
|
|
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr "Edit Bantuan sensitif konteks"
|
|
|
|
#: lazarusidestrconsts.liskmencloseselection
|
|
#, fuzzy
|
|
#| msgid "Enclose selection"
|
|
msgid "Enclose Selection"
|
|
msgstr "Tutupi pilihan"
|
|
|
|
#: lazarusidestrconsts.liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr "Evaluasi/Ubah"
|
|
|
|
#: lazarusidestrconsts.liskmexampleprojects
|
|
msgid "Example Projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr "Seting Piranti Eksternal"
|
|
|
|
#: lazarusidestrconsts.liskmfindincremental
|
|
#, fuzzy
|
|
#| msgid "Find incremental"
|
|
msgid "Find Incremental"
|
|
msgstr "Cari inkremental"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker0
|
|
#, fuzzy
|
|
#| msgid "Go to marker 0"
|
|
msgid "Go to bookmark 0"
|
|
msgstr "Pergi ke penanda 0"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker1
|
|
#, fuzzy
|
|
#| msgid "Go to marker 1"
|
|
msgid "Go to bookmark 1"
|
|
msgstr "Pergi ke penanda 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker2
|
|
#, fuzzy
|
|
#| msgid "Go to marker 2"
|
|
msgid "Go to bookmark 2"
|
|
msgstr "Pergi ke penanda 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker3
|
|
#, fuzzy
|
|
#| msgid "Go to marker 3"
|
|
msgid "Go to bookmark 3"
|
|
msgstr "Pergi ke penanda 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker4
|
|
#, fuzzy
|
|
#| msgid "Go to marker 4"
|
|
msgid "Go to bookmark 4"
|
|
msgstr "Pergi ke penanda 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker5
|
|
#, fuzzy
|
|
#| msgid "Go to marker 5"
|
|
msgid "Go to bookmark 5"
|
|
msgstr "Pergi ke penanda 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker6
|
|
#, fuzzy
|
|
#| msgid "Go to marker 6"
|
|
msgid "Go to bookmark 6"
|
|
msgstr "Pergi ke penanda 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker7
|
|
#, fuzzy
|
|
#| msgid "Go to marker 7"
|
|
msgid "Go to bookmark 7"
|
|
msgstr "Pergi ke penanda 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker8
|
|
#, fuzzy
|
|
#| msgid "Go to marker 8"
|
|
msgid "Go to bookmark 8"
|
|
msgstr "Pergi ke penanda 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker9
|
|
#, fuzzy
|
|
#| msgid "Go to marker 9"
|
|
msgid "Go to bookmark 9"
|
|
msgstr "Pergi ke penanda 9"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor1
|
|
msgid "Go to source editor 1"
|
|
msgstr "Pergi ke editor sumber 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor10
|
|
msgid "Go to source editor 10"
|
|
msgstr "Pergi ke editor sumber 10"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor2
|
|
msgid "Go to source editor 2"
|
|
msgstr "Pergi ke editor sumber 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor3
|
|
msgid "Go to source editor 3"
|
|
msgstr "Pergi ke editor sumber 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor4
|
|
msgid "Go to source editor 4"
|
|
msgstr "Pergi ke editor sumber 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor5
|
|
msgid "Go to source editor 5"
|
|
msgstr "Pergi ke editor sumber 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor6
|
|
msgid "Go to source editor 6"
|
|
msgstr "Pergi ke editor sumber 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor7
|
|
msgid "Go to source editor 7"
|
|
msgstr "Pergi ke editor sumber 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor8
|
|
msgid "Go to source editor 8"
|
|
msgstr "Pergi ke editor sumber 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor9
|
|
msgid "Go to source editor 9"
|
|
msgstr "Pergi ke editor sumber 9"
|
|
|
|
#: lazarusidestrconsts.liskminsertdateandtime
|
|
msgid "Insert date and time"
|
|
msgstr "Sisipkan tanggal dan jam"
|
|
|
|
#: lazarusidestrconsts.liskminsertusername
|
|
msgid "Insert username"
|
|
msgstr "Sisipkan nama pengguna"
|
|
|
|
#: lazarusidestrconsts.liskminspect
|
|
msgid "Inspect"
|
|
msgstr "Inspeksi"
|
|
|
|
#: lazarusidestrconsts.liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr "Skema Pemetaan tombol"
|
|
|
|
#: lazarusidestrconsts.liskmlazarusdefault
|
|
msgid "Lazarus default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmmacosxapple
|
|
msgid "macOS, Apple style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmmacosxlaz
|
|
msgid "macOS, Lazarus style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnewpackage
|
|
msgid "New package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Proyek baru"
|
|
|
|
#: lazarusidestrconsts.liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Proyek baru dari file"
|
|
|
|
#: lazarusidestrconsts.liskmnewunit
|
|
msgctxt "lazarusidestrconsts.liskmnewunit"
|
|
msgid "New Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
|
msgid "Note: All keys will be set to the values of the chosen scheme."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr "Buka file paket"
|
|
|
|
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
|
#, fuzzy
|
|
#| msgid "Paste Components from clipboard"
|
|
msgid "Paste Components"
|
|
msgstr "Paste Komponen dari clipboard"
|
|
|
|
#: lazarusidestrconsts.liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr "Istirahatkan program"
|
|
|
|
#: lazarusidestrconsts.liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Terbitkan proyek"
|
|
|
|
#: lazarusidestrconsts.liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
|
msgid "Remove Active File from Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Jalankan program"
|
|
|
|
#: lazarusidestrconsts.liskmsaveall
|
|
msgid "SaveAll"
|
|
msgstr "Simpan Semua"
|
|
|
|
#: lazarusidestrconsts.liskmsaveas
|
|
msgid "SaveAs"
|
|
msgstr "SimpanS ebagai"
|
|
|
|
#: lazarusidestrconsts.liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Simpan proyek"
|
|
|
|
#: lazarusidestrconsts.liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr "Simpan proyek sebagai"
|
|
|
|
#: lazarusidestrconsts.liskmselectlineend
|
|
#, fuzzy
|
|
#| msgid "Select line end"
|
|
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
|
msgid "Select Line End"
|
|
msgstr "Pilih akhir baris"
|
|
|
|
#: lazarusidestrconsts.liskmselectlinestart
|
|
#, fuzzy
|
|
#| msgid "Select line start"
|
|
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Pilih awal baris"
|
|
|
|
#: lazarusidestrconsts.liskmselectpagebottom
|
|
#, fuzzy
|
|
#| msgid "Select page bottom"
|
|
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Pilih bawah halaman"
|
|
|
|
#: lazarusidestrconsts.liskmselectpagetop
|
|
#, fuzzy
|
|
#| msgid "Select page top"
|
|
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Pilih atas halaman"
|
|
|
|
#: lazarusidestrconsts.liskmselectwordleft
|
|
#, fuzzy
|
|
#| msgid "Select word left"
|
|
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Pilih kata ke kiri"
|
|
|
|
#: lazarusidestrconsts.liskmselectwordright
|
|
#, fuzzy
|
|
#| msgid "Select word right"
|
|
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Pilih kata ke kanan"
|
|
|
|
#: lazarusidestrconsts.liskmsetfreebookmark
|
|
msgid "Set free Bookmark"
|
|
msgstr "Setel Bookmark bebas"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker0
|
|
#, fuzzy
|
|
#| msgid "Set marker 0"
|
|
msgid "Set bookmark 0"
|
|
msgstr "Set penanda 0"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker1
|
|
#, fuzzy
|
|
#| msgid "Set marker 1"
|
|
msgid "Set bookmark 1"
|
|
msgstr "Set penanda 1"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker2
|
|
#, fuzzy
|
|
#| msgid "Set marker 2"
|
|
msgid "Set bookmark 2"
|
|
msgstr "Set penanda 2"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker3
|
|
#, fuzzy
|
|
#| msgid "Set marker 3"
|
|
msgid "Set bookmark 3"
|
|
msgstr "Set penanda 3"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker4
|
|
#, fuzzy
|
|
#| msgid "Set marker 4"
|
|
msgid "Set bookmark 4"
|
|
msgstr "Set penanda 4"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker5
|
|
#, fuzzy
|
|
#| msgid "Set marker 5"
|
|
msgid "Set bookmark 5"
|
|
msgstr "Set penanda 5"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker6
|
|
#, fuzzy
|
|
#| msgid "Set marker 6"
|
|
msgid "Set bookmark 6"
|
|
msgstr "Set penanda 6"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker7
|
|
#, fuzzy
|
|
#| msgid "Set marker 7"
|
|
msgid "Set bookmark 7"
|
|
msgstr "Set penanda 7"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker8
|
|
#, fuzzy
|
|
#| msgid "Set marker 8"
|
|
msgid "Set bookmark 8"
|
|
msgstr "Set penanda 8"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker9
|
|
#, fuzzy
|
|
#| msgid "Set marker 9"
|
|
msgid "Set bookmark 9"
|
|
msgstr "Set penanda 9"
|
|
|
|
#: lazarusidestrconsts.liskmstopprogram
|
|
#, fuzzy
|
|
#| msgid "Stop program"
|
|
msgid "Stop Program"
|
|
msgstr "Hentikan program"
|
|
|
|
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr "Toggle antara Unit dan Form"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker0
|
|
msgid "Toggle bookmark 0"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker1
|
|
msgid "Toggle bookmark 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker2
|
|
msgid "Toggle bookmark 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker3
|
|
msgid "Toggle bookmark 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker4
|
|
msgid "Toggle bookmark 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker5
|
|
msgid "Toggle bookmark 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker6
|
|
msgid "Toggle bookmark 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker7
|
|
msgid "Toggle bookmark 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker8
|
|
msgid "Toggle bookmark 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker9
|
|
msgid "Toggle bookmark 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewassembler
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
|
msgid "View Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
|
#, fuzzy
|
|
#| msgid "Toggle view Breakpoints"
|
|
msgid "View Breakpoints"
|
|
msgstr "Togglel ihat Breakpoints"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
|
#, fuzzy
|
|
#| msgid "Toggle view Call Stack"
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Toggle lihat Call Stack"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
|
msgid "Toggle view Code Browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr "Toggle lihat Explorer Kode"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
|
#, fuzzy
|
|
#| msgid "Toggle view component palette"
|
|
msgid "Toggle View Component Palette"
|
|
msgstr "Toggle lihat palet komponen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
|
msgid "View Debuger Event Log"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
|
#, fuzzy
|
|
#| msgid "Toggle view Debugger Output"
|
|
msgid "View Debugger Output"
|
|
msgstr "Toggle lihat Output Debugger"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr "Toggle lihat Editor Dokumentasi"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewhistory
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
|
msgid "View History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr "Toggle lihat tombol cepat IDE"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
|
#, fuzzy
|
|
#| msgid "Toggle view Local Variables"
|
|
msgid "View Local Variables"
|
|
msgstr "Toggle lihat Variabel Lokal"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr "Toggle lihat Pesan"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr "Toggle lihat Inspektor Obyek"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
|
msgid "View Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewregisters
|
|
msgid "View Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr "Toggle lihat Hasil Pencarian"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr "Toggle lihat Editor Sumber"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewthreads
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
|
msgid "View Threads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewwatches
|
|
#, fuzzy
|
|
#| msgid "Toggle view Watches"
|
|
msgid "View Watches"
|
|
msgstr "Toggle lihat Pengawasan"
|
|
|
|
#: lazarusidestrconsts.liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr "Lihat histori lompat"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr "Lihat opsi proyek"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectsource
|
|
#, fuzzy
|
|
#| msgid "View project source"
|
|
msgid "View Project Source"
|
|
msgstr "Lihat sumber proyek"
|
|
|
|
#: lazarusidestrconsts.liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr "Lihat Info Unit"
|
|
|
|
#: lazarusidestrconsts.lislastopened
|
|
msgid "Last opened"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr "Menjalankan aplikasi tidak benar"
|
|
|
|
#: lazarusidestrconsts.lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Menjalankan baris perintah target"
|
|
|
|
#: lazarusidestrconsts.lislazarus
|
|
msgctxt "lazarusidestrconsts.lislazarus"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: lazarusidestrconsts.lislazarusdefault
|
|
msgid "Lazarus Default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Direktori Lazarus"
|
|
|
|
#: lazarusidestrconsts.lislazarusdiroverride
|
|
msgid "directory, to be used as a basedirectory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruseditorv
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr "Lazarus IDE"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr "ID bahasa Lazarus (contoh. en, de, id, fi)"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr "Nama bahasa Lazarus (contoh english, dutsch)"
|
|
|
|
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [opsi] <namafile-proyek>"
|
|
|
|
#: lazarusidestrconsts.lislazbuildaboaction
|
|
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
|
msgid "Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
|
msgid "Are you sure you want to delete this build profile?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildmany
|
|
msgid "Build Many"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildcommonsettings
|
|
msgid "Common Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
|
msgid "Confirm before build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
|
msgid "Confirm deletion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilddebugide
|
|
msgid "Debug IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefines
|
|
msgid "Defines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
|
msgid "Defines without -d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditdefines
|
|
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
|
msgid "Edit Defines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
|
msgid "Edit list of defines which can be used by any profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Kesalahan penulisan file"
|
|
|
|
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
|
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
|
msgid "Manage Build Profiles"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
|
msgid "Manage profiles"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
|
msgid "Name of the active profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprof
|
|
msgid "Add New Profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
|
msgid "Current build options will be associated with:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildnormalide
|
|
msgid "Normal IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptimizedide
|
|
msgid "Optimized IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Opsi:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
|
msgid "Options passed to compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildprofile
|
|
msgid "Profile to build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprof
|
|
msgid "Rename Profile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
|
msgid "New name for profile:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
|
msgid "Restart after building IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
|
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
|
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
|
msgid "Select profiles to build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
|
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
|
msgid "Show confirmation dialog when building directly from Tools menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
|
msgid "Show options and defines for command line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Target CPU:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Target OS:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
|
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
|
msgid "Update revision.inc"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
|
msgid "Update revision info in \"About Lazarus\" dialog"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazcleanupbuildall
|
|
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
|
msgid "Clean Up + Build all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazver
|
|
msgid "Lazarus Version (e.g. 1.2.4)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislclwidgettype
|
|
#, fuzzy
|
|
#| msgid "LCL Widget Type"
|
|
msgid "LCL widget type"
|
|
msgstr "Tipe Widget LCL"
|
|
|
|
#: lazarusidestrconsts.lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr "Copy dari inherited"
|
|
|
|
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
|
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr "Pindahkan entri ke inherited"
|
|
|
|
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
|
msgid "No valid FPDoc path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisleft
|
|
msgctxt "lazarusidestrconsts.lisleft"
|
|
msgid "Left"
|
|
msgstr "Left"
|
|
|
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr "Batas spasi Kiri. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dikiri kontrol."
|
|
|
|
#: lazarusidestrconsts.lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Anchor Kiri"
|
|
|
|
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
|
#, fuzzy
|
|
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Ini adalah kontrol terdekat dimana sisi kiri dianchor. Biarkan kosong untuk parent."
|
|
|
|
#: lazarusidestrconsts.lisleftsides
|
|
msgid "Left sides"
|
|
msgstr "Sisi Kiri"
|
|
|
|
#: lazarusidestrconsts.lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr "Kiri spasi secara sama"
|
|
|
|
#: lazarusidestrconsts.lisless
|
|
msgctxt "lazarusidestrconsts.lisless"
|
|
msgid "Less"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislevels
|
|
msgid "Levels"
|
|
msgstr "Tingkat"
|
|
|
|
#: lazarusidestrconsts.lislfmfile
|
|
msgid "LFM file"
|
|
msgstr "File LFM"
|
|
|
|
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
|
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr "File LFM rusak"
|
|
|
|
#: lazarusidestrconsts.lislfmisok
|
|
msgid "LFM is ok"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislgplnotice
|
|
#, fuzzy,badformat
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
#| "\n"
|
|
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lislibrarypath
|
|
msgid "library path"
|
|
msgstr "path pustaka"
|
|
|
|
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
|
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisline
|
|
msgid "Line:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislinelength
|
|
msgid "Line/Length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislink
|
|
msgid "Link:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr "opsi penggabung"
|
|
|
|
#: lazarusidestrconsts.lislinktarget
|
|
msgid "Link target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislistofallcasevalues
|
|
msgid "list of all case values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisloadingfailed
|
|
msgid "Loading %s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisloadmacrofrom
|
|
msgid "Load macro from"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocal
|
|
msgid "&Local"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocals
|
|
msgid "Locals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyname
|
|
msgid "&Copy Name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
|
|
msgid "Copy &RAW Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyvalue
|
|
msgid "C&opy Value"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislocalsnotevaluated
|
|
msgid "Locals not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogcallstack
|
|
msgid "Log Call Stack"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogcallstacklimit
|
|
msgid "(frames limit. 0 - no limits)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogevalexpression
|
|
msgctxt "lazarusidestrconsts.lislogevalexpression"
|
|
msgid "Eval expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislogmessage
|
|
msgid "Log Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislowercasestring
|
|
msgid "lowercase string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
|
msgid "Lowercase string given as parameter."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
|
msgid "lpk has vanished on disk. Using as alternative%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkismissing
|
|
msgid "lpk is missing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislrsincludefiles
|
|
msgid "Lazarus resources (.lrs) include files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacro
|
|
msgid "Macro %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Masukkan data"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "Masukkan parameter menjalankan"
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
|
#, fuzzy
|
|
#| msgid "Main Unit has Application.CreateForm statements"
|
|
msgid "Main unit has Application.CreateForm statements"
|
|
msgstr "Unit Utama mempunyai pernyataan Application.CreateForm"
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
|
|
msgid "Main unit has Application.Scaled statement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
|
|
msgid "Main unit has Application.Title statement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
|
#, fuzzy
|
|
#| msgid "Main Unit has Uses Section containing all Units of project"
|
|
msgid "Main unit has Uses section containing all units of project"
|
|
msgstr "Unit Utama mempunyai Seksi Uses yang berisi semua Unit dari proyek"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsource
|
|
msgid "Main unit is Pascal source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
|
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Buat Eksekutabel"
|
|
|
|
#: lazarusidestrconsts.lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr "Make tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Buat ResourceString"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "Tambahkan ke bagian"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
|
#, fuzzy,badformat
|
|
#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "Resourcestring %s%s%s sudah ada.%sSilahkan pilih nama lain.%sGunakan Abaikan untuk tetap menambahkan juga."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Opsi Konversi"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr "Pengenal Kustom:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
|
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Pengenal"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Panjang Pengenal:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr "Prefiks Pengenal:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Sisipkan secara alfabetik"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Sisipkan sensitif konteks"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Bagian ResourceString tidak benar"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "Resourcestring sudah ada"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Bagian Resourcestring:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Peninjauan Sumber"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "Konstan String dalam sumber"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "String dengan nilai sama:"
|
|
|
|
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
|
msgid "Make sure all ppu files of a package are in its output directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismanagesourceeditors
|
|
msgid "Manage Source Editors ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
|
msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
|
msgid "Maximum parallel processes, 0 means default (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaxs
|
|
msgid "Max %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
|
msgid "%s Maybe you have to recompile the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismb
|
|
msgid "%s MB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismeaction
|
|
msgctxt "lazarusidestrconsts.lismeaction"
|
|
msgid "Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismemorydump
|
|
msgid "Memory Dump"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Batalkan Pembangunan"
|
|
|
|
#: lazarusidestrconsts.lismenuaboutfpc
|
|
msgid "About FPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddbreakpoint
|
|
#, fuzzy
|
|
#| msgid "Add breakpoint"
|
|
msgid "Add &Breakpoint"
|
|
msgstr "Tambah breakpoint"
|
|
|
|
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
|
msgid "Add Active File to Package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
|
#, fuzzy
|
|
#| msgid "Add jump point to history"
|
|
msgid "Add Jump Point to History"
|
|
msgstr "Tambah titik lompatan ke histori"
|
|
|
|
#: lazarusidestrconsts.lismenuaddtoproject
|
|
#, fuzzy
|
|
#| msgid "Add editor file to Project"
|
|
msgid "Add Editor File to Project"
|
|
msgstr "Tambah file editor ke Proyek"
|
|
|
|
#: lazarusidestrconsts.lismenuaddwatch
|
|
#, fuzzy
|
|
#| msgid "Add watch ..."
|
|
msgid "Add &Watch ..."
|
|
msgstr "Tambah pengawasan ..."
|
|
|
|
#: lazarusidestrconsts.lismenubeaklinesinselection
|
|
msgid "Break Lines in Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenubreak
|
|
msgid "&Break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Bangun File"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarus
|
|
#, fuzzy
|
|
#| msgid "Build Lazarus with current profile"
|
|
msgid "Build Lazarus with Current Profile"
|
|
msgstr "Bangun Lazarus"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarusprof
|
|
msgid "Build Lazarus with Profile: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuchecklfm
|
|
#, fuzzy
|
|
#| msgid "Check LFM file in editor"
|
|
msgid "Check LFM File in Editor"
|
|
msgstr "Periksa file LFM dalam editor"
|
|
|
|
#: lazarusidestrconsts.lismenucleandirectory
|
|
#, fuzzy
|
|
#| msgid "Clean directory ..."
|
|
msgid "Clean Directory ..."
|
|
msgstr "Bersihkan direktori ..."
|
|
|
|
#: lazarusidestrconsts.lismenucleanupandbuild
|
|
msgid "Clean up and Build ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucloseall
|
|
#, fuzzy
|
|
#| msgid "Close A&ll Editor Files"
|
|
msgid "Close A&ll"
|
|
msgstr "Tutup semua file editor"
|
|
|
|
#: lazarusidestrconsts.lismenucloseeditorfile
|
|
msgid "&Close Editor File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Tutuip Proyek"
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
|
#, fuzzy
|
|
#| msgid "CodeTools defines editor ..."
|
|
msgid "CodeTools Defines Editor ..."
|
|
msgstr "Editor definisi CodeTools ..."
|
|
|
|
#: lazarusidestrconsts.lismenucommentselection
|
|
#, fuzzy
|
|
#| msgid "Comment selection"
|
|
msgid "Comment Selection"
|
|
msgstr "Komentari pilihan"
|
|
|
|
#: lazarusidestrconsts.lismenucomparefiles
|
|
msgid "Compare files ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucompilemanymodes
|
|
msgid "Compile many Modes ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenucompletecode
|
|
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Kode Lengkap"
|
|
|
|
#: lazarusidestrconsts.lismenucompletecodeinteractive
|
|
msgid "Complete Code (with dialog)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Konfigurasi Pembangunan+Jalankan File ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
|
#, fuzzy
|
|
#| msgid "Configure custom components ..."
|
|
msgid "Configure Custom Components ..."
|
|
msgstr "Konfigurasi komponen kustom ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigexternaltools
|
|
msgid "Configure External Tools ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "Konfigurasi \"Bangun Lazarus\" ..."
|
|
|
|
#: lazarusidestrconsts.lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr "Panduan sensitif isi"
|
|
|
|
#: lazarusidestrconsts.lismenucontinue
|
|
msgid "&Continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi package to Lazarus package ..."
|
|
msgid "Convert Delphi Package to Lazarus Package ..."
|
|
msgstr "Konversi paket Delphi ke paket Lazarus ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi project to Lazarus project ..."
|
|
msgid "Convert Delphi Project to Lazarus Project ..."
|
|
msgstr "Konversi proyek Delphi ke proyek Lazarus ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
|
#, fuzzy
|
|
#| msgid "Convert Delphi unit to Lazarus unit ..."
|
|
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
|
msgstr "Konversi unit Delphi ke unit Lazarus ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
|
#, fuzzy
|
|
#| msgid "Convert binary DFM to text LFM + check syntax ..."
|
|
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
|
msgstr "Konversi file DFM ke LFM ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertencoding
|
|
msgid "Convert Encoding of Projects/Packages ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenudebugwindows
|
|
#, fuzzy
|
|
#| msgid "Debug windows"
|
|
msgid "Debug Windows"
|
|
msgstr "Jendela Debug"
|
|
|
|
#: lazarusidestrconsts.lismenudelphiconversion
|
|
msgid "Delphi Conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Edit"
|
|
|
|
#: lazarusidestrconsts.lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Template kode ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr "Edit Bantuan sensitif konteks"
|
|
|
|
#: lazarusidestrconsts.lismenueditinstallpkgs
|
|
#, fuzzy
|
|
#| msgid "Install/Uninstall packages ..."
|
|
msgid "Install/Uninstall Packages ..."
|
|
msgstr "Konfigurasi paket terinstalasi ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
|
|
msgid "Accelerator(&&) key \"%s\" needs changing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
|
|
msgid "Add a new item above selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
|
|
msgid "Add a new item after selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
|
|
msgid "Add a new item before selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
|
|
msgid "Add a new item below selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
|
|
msgid "Add a submenu at the right of selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
|
|
msgid "Add a submenu below selected item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddfromtemplate
|
|
msgid "&Add from template ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddiconfroms
|
|
msgid "Add icon from %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddimagelisticon
|
|
msgid "Add imagelist &icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddmenuitem
|
|
msgid "Add menu item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemabove
|
|
msgid "&Add new item above"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemafter
|
|
msgid "Add ne&w item after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembefore
|
|
msgid "&Add new item before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembelow
|
|
msgid "Add ne&w item below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddonclickhandler
|
|
msgid "Add &OnClick handler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorafter
|
|
msgid "Add separator &after"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
|
|
msgid "Add separator &before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenu
|
|
msgid "Add submenu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
|
|
msgid "Add &submenu below"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenuright
|
|
msgid "Add &submenu right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
|
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
|
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
|
|
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
|
|
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
|
|
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaption
|
|
msgid "Caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptioneditemss
|
|
msgid "Captioned items: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
|
|
msgid "Caption should not be blank"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
|
|
msgid "Change conflicting accelerator \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
|
|
msgid "Change imagelist &icon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
|
|
msgid "Change %s for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
|
|
msgid "Change shortcut conflict \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
|
|
msgid "Change the shortCut for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
|
|
msgid "Change the shortCutKey2 for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
|
|
msgid "Choose template to delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
|
|
msgid "Choose template to insert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
|
|
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
|
|
msgid "Component is unexpected kind"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
|
|
msgid "Component is unnamed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
|
|
msgid "<conflict resolution complete>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
|
|
msgid "Conflicts found initially: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
|
|
msgid "Deepest nested menu level: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteitem
|
|
#, fuzzy
|
|
#| msgid "Delete Item"
|
|
msgid "&Delete item"
|
|
msgstr "Hapus Item"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletemenutemplate
|
|
msgid "&Delete menu template ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
|
|
msgid "Delete saved menu template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
|
|
msgid "Delete selected menu template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
|
|
msgid "Delete this item and its subitems?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
|
|
msgid "Display preview as &Popup menu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditcaption
|
|
msgid "Edit &Caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
|
|
msgid "Editing Caption of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsdots
|
|
msgid "To resolve conflict edit %s.%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsfors
|
|
msgid "Editing %s for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
|
|
msgid "Editing %s.%s - no menuitem selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteramenudescription
|
|
msgid "Enter a menu &Description:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
|
|
msgid "Enter a new ShortCut for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
|
|
msgid "Enter a new ShortCutKey2 for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
|
|
msgid "Existing saved templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
|
|
msgid "Further shortcut conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
|
|
msgid "Get help to use this editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgrabkey
|
|
msgid "&Grab key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexd
|
|
msgid "GroupIndex: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
|
|
msgid "Values in use: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinadequatedescription
|
|
msgid "Inadequate Description"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
|
|
msgid "Insert menu template into root of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
|
|
msgid "Insert selected menu template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorisnotassigned
|
|
msgid "is not assigned"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoritemswithicons
|
|
msgid "Items with icon: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
|
|
msgid "List shortcuts and &accelerators for %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
|
|
msgid "List shortcuts for %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Editor Menu"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemactions
|
|
msgid "Menu Item actions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
|
|
msgid "Menuitem shortcut conflicts in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormovedown
|
|
msgid "Move Down (or right)"
|
|
msgstr "Turun (atau kanan)"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemdown
|
|
msgid "Mo&ve item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemleft
|
|
msgid "&Move item left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemright
|
|
msgid "Mo&ve item right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemup
|
|
msgid "&Move item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
|
|
msgid "Move selected item to the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
|
|
msgid "Move selected item to the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveup
|
|
msgid "Move Up (or left)"
|
|
msgstr "Naik (atau kiri)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorna
|
|
msgid "n/a"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornomenuselected
|
|
msgid "(no menu selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornone
|
|
msgid "<none>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornonenone
|
|
msgid "<none>,<none>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
|
|
msgid "<no shortcut conflicts>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornousersavedtemplates
|
|
msgid "No user-saved templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorpickaniconfroms
|
|
msgid "Pick an icon from %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorpopupassignmentss
|
|
msgid "Popup assignments: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorradioitem
|
|
msgid "RadioItem"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorremainingconflictss
|
|
msgid "Remaining conflicts: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorremoveallseparators
|
|
msgid "&Remove all separators"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolvedconflictss
|
|
msgid "Resolved conflicts: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
|
|
msgid "Resolve selected conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
|
|
msgid "&Resolve shortcut conflicts ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavedtemplates
|
|
msgid "Saved templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
|
|
msgid "&Save menu as a template ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
|
|
msgid "Save menu as template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
|
|
msgid "Save menu as template for future use"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
|
|
msgid "Save menu shown as a new template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
|
msgid "%s conflicts with %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorseparators
|
|
msgid "Se¶tors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutitemss
|
|
msgid "Shortcut items: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
|
|
msgid "Shortcut not yet changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts
|
|
msgid "Shortcuts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts2
|
|
msgid "Shortc&uts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
|
|
msgid "Shortcuts and Accelerator keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsd
|
|
msgid "Shortcuts (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
|
|
msgid "Shortcuts (%d) and Accelerator keys (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
|
|
msgid "Shortcut,Source Property"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedins
|
|
msgid "Shortcuts used in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
|
|
msgid "Shortcuts used in %s (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
|
|
msgid "ShowMenuEditor: TMenu parameter is nil"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsins
|
|
msgid "\"%s\" in %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
|
|
msgid ""
|
|
"\"%s\" is already in use in %s as a shortcut.\n"
|
|
"Try a different shortcut.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
|
|
msgid "Please expand: \"%s\" is not a sufficient Description"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
|
|
msgid "Some widgetsets do not allow separators in the main menubar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcuts
|
|
msgid "%s: Shortcuts"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
|
|
msgid "%s: Shortcuts and accelerator keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsssonclicks
|
|
msgid "%s.%s.%s - OnClick: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorssubmenu
|
|
msgid "%s submenu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorstandardtemplates
|
|
msgid "Standard templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatedescription
|
|
msgid "Template description:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplates
|
|
msgid "&Templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatesaved
|
|
msgid "Template saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
|
|
msgid ""
|
|
"There are no user-saved menu templates.\n"
|
|
"\n"
|
|
"Only standard default templates are available.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
|
|
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
|
|
msgid ""
|
|
"You have to change the shortcut from %s\n"
|
|
"to avoid a conflict\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
|
|
msgid "You must enter text for the Caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuencloseinifdef
|
|
msgid "Enclose in $IFDEF ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuencloseselection
|
|
#, fuzzy
|
|
#| msgid "Enclose selection ..."
|
|
msgid "Enclose Selection ..."
|
|
msgstr "Tutupi pilihan ..."
|
|
|
|
#: lazarusidestrconsts.lismenuevaluate
|
|
#, fuzzy
|
|
#| msgid "Evaluate/Modify ..."
|
|
msgid "E&valuate/Modify ..."
|
|
msgstr "Evaluasi/Ubah ..."
|
|
|
|
#: lazarusidestrconsts.lismenuexampleprojects
|
|
msgid "Example Projects ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuextractproc
|
|
#, fuzzy
|
|
#| msgid "Extract procedure ..."
|
|
msgid "Extract Procedure ..."
|
|
msgstr "Ekstraks prosedur ..."
|
|
|
|
#: lazarusidestrconsts.lismenufile
|
|
msgid "&File"
|
|
msgstr "&File"
|
|
|
|
#: lazarusidestrconsts.lismenufind
|
|
msgctxt "lazarusidestrconsts.lismenufind"
|
|
msgid "Find"
|
|
msgstr "Cari"
|
|
|
|
#: lazarusidestrconsts.lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
|
#, fuzzy
|
|
#| msgid "Find other end of code block"
|
|
msgid "Find Other End of Code Block"
|
|
msgstr "Cari akhir blok kode lainnya"
|
|
|
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
|
#, fuzzy
|
|
#| msgid "Find code block start"
|
|
msgid "Find Start of Code Block"
|
|
msgstr "Cari awal blok kode"
|
|
|
|
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
|
#, fuzzy
|
|
#| msgid "Find Declaration at cursor"
|
|
msgid "Find Declaration at Cursor"
|
|
msgstr "Cari Deklarasi di kursor"
|
|
|
|
#: lazarusidestrconsts.lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Cari Referensi Pengenal ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindinfiles
|
|
#, fuzzy
|
|
#| msgid "Find &in files ..."
|
|
msgid "Find &in Files ..."
|
|
msgstr "Cari &dalam file ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "Cari Berikut&nya"
|
|
|
|
#: lazarusidestrconsts.lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "Cari &Sebelumnya"
|
|
|
|
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
|
msgid "Find References Of Used Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenugeneraloptions
|
|
msgid "Options ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenugotoincludedirective
|
|
#, fuzzy
|
|
#| msgid "Goto include directive"
|
|
msgid "Goto Include Directive"
|
|
msgstr "Pergi ke direktif include"
|
|
|
|
#: lazarusidestrconsts.lismenugotoline
|
|
#, fuzzy
|
|
#| msgid "Goto line ..."
|
|
msgid "Goto Line ..."
|
|
msgstr "Pergi ke baris ..."
|
|
|
|
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
|
#, fuzzy
|
|
#| msgid "Guess misplaced IFDEF/ENDIF"
|
|
msgid "Guess Misplaced IFDEF/ENDIF"
|
|
msgstr "Tebak IFDEF/ENDIF salah tempat"
|
|
|
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
|
#, fuzzy
|
|
#| msgid "Guess unclosed block"
|
|
msgid "Guess Unclosed Block"
|
|
msgstr "Tebak blok tidak tertutup"
|
|
|
|
#: lazarusidestrconsts.lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "&Panduan"
|
|
|
|
#: lazarusidestrconsts.lismenuideinternals
|
|
msgid "IDE Internals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Pencarian inkremental"
|
|
|
|
#: lazarusidestrconsts.lismenuindentselection
|
|
#, fuzzy
|
|
#| msgid "Indent selection"
|
|
msgid "Indent Selection"
|
|
msgstr "Lekukan pilihan"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
|
#, fuzzy
|
|
#| msgid "ChangeLog entry"
|
|
msgid "ChangeLog Entry"
|
|
msgstr "Entri ChangeLog"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcharacter
|
|
#, fuzzy
|
|
#| msgid "Insert from Character Map"
|
|
msgid "Insert from Character Map ..."
|
|
msgstr "Sisipkan dari Peta Karakter"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
|
#, fuzzy
|
|
#| msgid "Insert CVS keyword"
|
|
msgid "Insert CVS Keyword"
|
|
msgstr "kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertdatetime
|
|
#, fuzzy
|
|
#| msgid "Current date and time"
|
|
msgid "Current Date and Time"
|
|
msgstr "Tanggal dan waktu saat ini"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertfilename
|
|
msgid "Insert Full Filename ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgeneral
|
|
#, fuzzy
|
|
#| msgid "General"
|
|
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
|
msgid "Insert General"
|
|
msgstr "Umum"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnotice
|
|
#, fuzzy
|
|
#| msgid "GPL notice"
|
|
msgid "GPL Notice"
|
|
msgstr "catatan GPL"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
|
msgid "GPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
|
#, fuzzy
|
|
#| msgid "LGPL notice"
|
|
msgid "LGPL Notice"
|
|
msgstr "catatan LGPL"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
|
msgid "LGPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnotice
|
|
msgid "MIT Notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
|
msgid "MIT Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL Notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
|
msgid "Modified LGPL Notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuinsertusername
|
|
#, fuzzy
|
|
#| msgid "Current username"
|
|
msgid "Current Username"
|
|
msgstr "Nama pemakai saat ini"
|
|
|
|
#: lazarusidestrconsts.lismenuinspect
|
|
#, fuzzy
|
|
#| msgid "Inspect ..."
|
|
msgctxt "lazarusidestrconsts.lismenuinspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Inspeksi ..."
|
|
|
|
#: lazarusidestrconsts.lismenujumpback
|
|
#, fuzzy
|
|
#| msgid "Jump back"
|
|
msgid "Jump Back"
|
|
msgstr "Lompat kembali"
|
|
|
|
#: lazarusidestrconsts.lismenujumpforward
|
|
#, fuzzy
|
|
#| msgid "Jump forward"
|
|
msgid "Jump Forward"
|
|
msgstr "Lompat maju"
|
|
|
|
#: lazarusidestrconsts.lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Lompat ke"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementation
|
|
msgid "Jump to Implementation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
|
msgid "Jump to Implementation uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoinitialization
|
|
msgid "Jump to Initialization"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerface
|
|
msgid "Jump to Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
|
msgid "Jump to Interface uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptonextbookmark
|
|
#, fuzzy
|
|
#| msgid "Jump to next bookmark"
|
|
msgid "Jump to Next Bookmark"
|
|
msgstr "Lompat ke penunjuk berikutnya"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonexterror
|
|
#, fuzzy
|
|
#| msgid "Jump to next error"
|
|
msgid "Jump to Next Error"
|
|
msgstr "Lompat ke kesalahan berikutnya"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
|
#, fuzzy
|
|
#| msgid "Jump to previous bookmark"
|
|
msgid "Jump to Previous Bookmark"
|
|
msgstr "Lompat ke penunjuk sebelumnya"
|
|
|
|
#: lazarusidestrconsts.lismenujumptopreverror
|
|
#, fuzzy
|
|
#| msgid "Jump to previous error"
|
|
msgid "Jump to Previous Error"
|
|
msgstr "Lompat ke kesalahan sebelumnya"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
|
msgid "Jump to Procedure begin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
|
msgid "Jump to Procedure header"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenulowercaseselection
|
|
#, fuzzy
|
|
#| msgid "Lowercase selection"
|
|
msgid "Lowercase Selection"
|
|
msgstr "Kecilkan huruf pilihan"
|
|
|
|
#: lazarusidestrconsts.lismenumacrolistview
|
|
msgid "Editor Macros ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Buat String Resource ..."
|
|
|
|
#: lazarusidestrconsts.lismenumultipaste
|
|
msgctxt "lazarusidestrconsts.lismenumultipaste"
|
|
msgid "MultiPaste ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewcomponent
|
|
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Komponen Baru"
|
|
|
|
#: lazarusidestrconsts.lismenunewcustom
|
|
msgid "New %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Form Baru"
|
|
|
|
#: lazarusidestrconsts.lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Baru ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewpackage
|
|
msgid "New Package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Proyek Baru ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewprojectfromfile
|
|
#, fuzzy
|
|
#| msgid "New Project from file ..."
|
|
msgid "New Project from File ..."
|
|
msgstr "Proyek Baru dari file ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewunit
|
|
msgctxt "lazarusidestrconsts.lismenunewunit"
|
|
msgid "New Unit"
|
|
msgstr "Unit Baru"
|
|
|
|
#: lazarusidestrconsts.lismenuok
|
|
#, fuzzy
|
|
#| msgid "&Ok"
|
|
msgctxt "lazarusidestrconsts.lismenuok"
|
|
msgid "&OK"
|
|
msgstr "&Ok"
|
|
|
|
#: lazarusidestrconsts.lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Panduan Online"
|
|
|
|
#: lazarusidestrconsts.lismenuopen
|
|
#, fuzzy
|
|
#| msgid "Open ..."
|
|
msgid "&Open ..."
|
|
msgstr "Buka ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
|
#, fuzzy
|
|
#| msgid "Open filename at cursor"
|
|
msgid "Open Filename at Cursor"
|
|
msgstr "Buka nama file di kursor"
|
|
|
|
#: lazarusidestrconsts.lismenuopenfolder
|
|
msgid "Open Folder ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackage
|
|
#, fuzzy
|
|
#| msgid "Open loaded package ..."
|
|
msgid "Open Loaded Package ..."
|
|
msgstr "Buka paket yang diambil ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
|
#, fuzzy
|
|
#| msgid "Open package file (.lpk) ..."
|
|
msgid "Open Package File (.lpk) ..."
|
|
msgstr "Buka file paket (.lpk) ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
|
#, fuzzy
|
|
#| msgid "Open package of current unit"
|
|
msgid "Open Package of Current Unit"
|
|
msgstr "Open paket dari unit saat ini"
|
|
|
|
#: lazarusidestrconsts.lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Buka Proyek ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecent
|
|
#, fuzzy
|
|
#| msgid "Open &Recent ..."
|
|
msgid "Open &Recent"
|
|
msgstr "Buka yang Terakhir ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentpkg
|
|
#, fuzzy
|
|
#| msgid "Open recent package"
|
|
msgid "Open Recent Package"
|
|
msgstr "Buka paket terbaru ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentproject
|
|
#, fuzzy
|
|
#| msgid "Open Recent Project ..."
|
|
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
|
msgid "Open Recent Project"
|
|
msgstr "Buka Proyek Terakhir ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenunit
|
|
msgid "Open Unit ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupackage
|
|
msgid "Pa&ckage"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupackagegraph
|
|
#, fuzzy
|
|
#| msgid "Package Graph ..."
|
|
msgid "Package Graph"
|
|
msgstr "Paket Grafik ..."
|
|
|
|
#: lazarusidestrconsts.lismenupackagelinks
|
|
msgid "Package Links ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
|
msgid "Paste from clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
|
msgid "New package component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuprocedurelist
|
|
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
|
msgid "Procedure List ..."
|
|
msgstr " ..."
|
|
|
|
#: lazarusidestrconsts.lismenuproject
|
|
msgid "&Project"
|
|
msgstr "&Proyek"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Inspektor Proyek"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Opsi Proyek ..."
|
|
|
|
#: lazarusidestrconsts.lismenuprojectrun
|
|
#, fuzzy
|
|
#| msgid "Run"
|
|
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
|
msgid "&Run"
|
|
msgstr "Jalankan"
|
|
|
|
#: lazarusidestrconsts.lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Publikasikan Proyek ..."
|
|
|
|
#: lazarusidestrconsts.lismenuquickcompile
|
|
#, fuzzy
|
|
#| msgid "Quick compile"
|
|
msgid "Quick Compile"
|
|
msgstr "Kompilasi Cepat"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
|
#, fuzzy
|
|
#| msgid "Quick syntax check"
|
|
msgid "Quick Syntax Check"
|
|
msgstr "Pemeriksaan sintaks cepat"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
|
msgid "Quick syntax check OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Hapus dari Proyek ..."
|
|
|
|
#: lazarusidestrconsts.lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Ganti nama Pengenal ..."
|
|
|
|
#: lazarusidestrconsts.lismenureportingbug
|
|
#, fuzzy
|
|
#| msgid "Reporting a bug"
|
|
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
|
msgid "Reporting a Bug"
|
|
msgstr "Melaporkan bug..."
|
|
|
|
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
|
msgid "Resave forms with enabled i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
|
#, fuzzy
|
|
#| msgid "Rescan FPC source directory"
|
|
msgid "Rescan FPC Source Directory"
|
|
msgstr "Cari lagi direktori sumber FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuresetdebugger
|
|
#, fuzzy
|
|
#| msgid "Reset debugger"
|
|
msgid "Reset Debugger"
|
|
msgstr "Reset debugger"
|
|
|
|
#: lazarusidestrconsts.lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Kembalikan"
|
|
|
|
#: lazarusidestrconsts.lismenurun
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lismenurun"
|
|
msgid "&Run"
|
|
msgstr "&Jalankan"
|
|
|
|
#: lazarusidestrconsts.lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Jalankan File"
|
|
|
|
#: lazarusidestrconsts.lismenurunparameters
|
|
#, fuzzy
|
|
#| msgid "Run Parameters ..."
|
|
msgid "Run &Parameters ..."
|
|
msgstr "Parameter Menjalankan ..."
|
|
|
|
#: lazarusidestrconsts.lismenuruntocursor
|
|
#, fuzzy
|
|
#| msgid "Run to &Cursor"
|
|
msgid "Step over to &Cursor"
|
|
msgstr "Jalanjan sampai kursor"
|
|
|
|
#: lazarusidestrconsts.lismenurunwithoutdebugging
|
|
msgid "Run without Debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusave
|
|
#, fuzzy
|
|
#| msgid "Save"
|
|
msgctxt "lazarusidestrconsts.lismenusave"
|
|
msgid "&Save"
|
|
msgstr "Simpan"
|
|
|
|
#: lazarusidestrconsts.lismenusaveas
|
|
#, fuzzy
|
|
#| msgid "Save As ..."
|
|
msgid "Save &As ..."
|
|
msgstr "Simpan Sebagai ..."
|
|
|
|
#: lazarusidestrconsts.lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Simpan Proyek"
|
|
|
|
#: lazarusidestrconsts.lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Simpan Proyek Sebagai ..."
|
|
|
|
#: lazarusidestrconsts.lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Cari"
|
|
|
|
#: lazarusidestrconsts.lismenuselect
|
|
msgid "Select"
|
|
msgstr "Pilih"
|
|
|
|
#: lazarusidestrconsts.lismenuselectall
|
|
#, fuzzy
|
|
#| msgid "Select all"
|
|
msgctxt "lazarusidestrconsts.lismenuselectall"
|
|
msgid "Select All"
|
|
msgstr "Pilih semua"
|
|
|
|
#: lazarusidestrconsts.lismenuselectcodeblock
|
|
#, fuzzy
|
|
#| msgid "Select code block"
|
|
msgid "Select Code Block"
|
|
msgstr "Pilih blok kode"
|
|
|
|
#: lazarusidestrconsts.lismenuselectline
|
|
#, fuzzy
|
|
#| msgid "Select line"
|
|
msgid "Select Line"
|
|
msgstr "Pilih baris"
|
|
|
|
#: lazarusidestrconsts.lismenuselectparagraph
|
|
#, fuzzy
|
|
#| msgid "Select paragraph"
|
|
msgid "Select Paragraph"
|
|
msgstr "Pilih paragraf"
|
|
|
|
#: lazarusidestrconsts.lismenuselecttobrace
|
|
#, fuzzy
|
|
#| msgid "Select to brace"
|
|
msgid "Select to Brace"
|
|
msgstr "Pilih untuk dikurung"
|
|
|
|
#: lazarusidestrconsts.lismenuselectword
|
|
#, fuzzy
|
|
#| msgid "Select word"
|
|
msgid "Select Word"
|
|
msgstr "Pilih kata"
|
|
|
|
#: lazarusidestrconsts.lismenusetfreebookmark
|
|
#, fuzzy
|
|
#| msgid "Set a free bookmark"
|
|
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Set penunjuk bebas"
|
|
|
|
#: lazarusidestrconsts.lismenushowexecutionpoint
|
|
msgid "S&how Execution Point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenushowsmarthint
|
|
msgid "Context sensitive smart hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusortselection
|
|
#, fuzzy
|
|
#| msgid "Sort selection ..."
|
|
msgid "Sort Selection ..."
|
|
msgstr "Urut pilihan ..."
|
|
|
|
#: lazarusidestrconsts.lismenusource
|
|
msgid "S&ource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepinto
|
|
#, fuzzy
|
|
#| msgid "Step in&to"
|
|
msgid "Step In&to"
|
|
msgstr "Melangkah ke dalam"
|
|
|
|
#: lazarusidestrconsts.lismenustepintocontext
|
|
msgid "Step Into (Context)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepintoinstr
|
|
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
|
|
msgid "Step Into Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepintoinstrhint
|
|
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
|
|
msgid "Step Into Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepout
|
|
msgid "Step O&ut"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepover
|
|
#, fuzzy
|
|
#| msgid "&Step over"
|
|
msgid "&Step Over"
|
|
msgstr "Melewati"
|
|
|
|
#: lazarusidestrconsts.lismenustepovercontext
|
|
msgid "Step Over (Context)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepoverinstr
|
|
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
|
|
msgid "Step Over Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenustepoverinstrhint
|
|
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
|
|
msgid "Step Over Instruction"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuswapcaseselection
|
|
msgid "Swap Case in Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutabstospacesselection
|
|
#, fuzzy
|
|
#| msgid "Tabs to spaces in selection"
|
|
msgid "Tabs to Spaces in Selection"
|
|
msgstr "Tab ke spasi dalam pilihan"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateabout
|
|
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
|
msgid "About"
|
|
msgstr "Tentang"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatecontents
|
|
msgid "Contents"
|
|
msgstr "Isi"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
|
msgid "Standard Edit Menu"
|
|
msgstr "Menu Edit Standar"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
|
msgid "Standard File Menu"
|
|
msgstr "Menu File Standar"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
|
msgid "Standard Help Menu"
|
|
msgstr "Menu Panduan Standar"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefind
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
|
msgid "Find"
|
|
msgstr "Cari"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefindnext
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
|
|
msgid "Find Next"
|
|
msgstr "Cari Berikutnya"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateopenrecent
|
|
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
|
msgid "Open Recent"
|
|
msgstr "Buka yang Terakhir"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatetutorial
|
|
msgid "Tutorial"
|
|
msgstr "Tutorial"
|
|
|
|
#: lazarusidestrconsts.lismenutogglecomment
|
|
msgid "Toggle Comment in Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Piranti"
|
|
|
|
#: lazarusidestrconsts.lismenuuncommentselection
|
|
#, fuzzy
|
|
#| msgid "Uncomment selection"
|
|
msgid "Uncomment Selection"
|
|
msgstr "Jangan komentari pilihan"
|
|
|
|
#: lazarusidestrconsts.lismenuunindentselection
|
|
#, fuzzy
|
|
#| msgid "Unindent selection"
|
|
msgid "Unindent Selection"
|
|
msgstr "Jangan lekukan pilihan"
|
|
|
|
#: lazarusidestrconsts.lismenuuppercaseselection
|
|
#, fuzzy
|
|
#| msgid "Uppercase selection"
|
|
msgid "Uppercase Selection"
|
|
msgstr "Besarkan huruf pilihan"
|
|
|
|
#: lazarusidestrconsts.lismenuuseunit
|
|
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
|
msgid "Add Unit to Uses Section ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuview
|
|
msgid "&View"
|
|
msgstr "&Lihat"
|
|
|
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
|
#, fuzzy
|
|
#| msgid "View Anchor Editor"
|
|
msgid "Anchor Editor"
|
|
msgstr "Lihat Editor Jangkar"
|
|
|
|
#: lazarusidestrconsts.lismenuviewassembler
|
|
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewbreakpoints
|
|
msgid "BreakPoints"
|
|
msgstr "BreakPoints"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcallstack
|
|
msgid "Call Stack"
|
|
msgstr "Tumpukan Panggilan"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Browser Kode"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Eksplorer Kode"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
|
#, fuzzy
|
|
#| msgid "View Component Palette"
|
|
msgid "Component Palette"
|
|
msgstr "Lihat Palet Komponen"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Komponen"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugevents
|
|
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
|
msgid "Event Log"
|
|
msgstr "Log Event"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugoutput
|
|
#, fuzzy
|
|
#| msgid "Debug output"
|
|
msgid "Debug Output"
|
|
msgstr "Output Debug"
|
|
|
|
#: lazarusidestrconsts.lismenuviewforms
|
|
#, fuzzy
|
|
#| msgid "Forms..."
|
|
msgid "Forms ..."
|
|
msgstr "Forms..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewhistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
|
msgid "History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewjumphistory
|
|
#, fuzzy
|
|
#| msgid "Jump History ..."
|
|
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Lihat Histori-Lompatan ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewlocalvariables
|
|
msgid "Local Variables"
|
|
msgstr "Variabel Lokal"
|
|
|
|
#: lazarusidestrconsts.lismenuviewmessages
|
|
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
|
msgid "Messages"
|
|
msgstr "Pesan"
|
|
|
|
#: lazarusidestrconsts.lismenuviewobjectinspector
|
|
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
|
msgid "Object Inspector"
|
|
msgstr "Inspektor Obyek"
|
|
|
|
#: lazarusidestrconsts.lismenuviewprojectsource
|
|
msgid "&View Project Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
|
msgid "Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewregisters
|
|
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
|
msgid "Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Cari Hasil"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsourceeditor
|
|
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Editor Sumber"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtaborder
|
|
msgid "Tab Order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewthreads
|
|
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
|
msgid "Threads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
|
#, fuzzy
|
|
#| msgid "Toggle form/unit view"
|
|
msgid "Toggle Form/Unit View"
|
|
msgstr "Toggle tampilan form/unit"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
|
#, fuzzy
|
|
#| msgid "Unit Dependencies ..."
|
|
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Lihat Ketergantungan Unit"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
|
#, fuzzy
|
|
#| msgid "Unit Information"
|
|
msgid "Unit Information ..."
|
|
msgstr "Lihat Informasi Unit"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunits
|
|
#, fuzzy
|
|
#| msgid "Units..."
|
|
msgid "Units ..."
|
|
msgstr "Units..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewwatches
|
|
msgid "Watches"
|
|
msgstr "Pengawasan"
|
|
|
|
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
|
msgid "What Needs Building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuwindow
|
|
msgid "&Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismeother
|
|
#, fuzzy
|
|
#| msgid "Other"
|
|
msgctxt "lazarusidestrconsts.lismeother"
|
|
msgid "Other tabs"
|
|
msgstr "Lainnya"
|
|
|
|
#: lazarusidestrconsts.lismeprojects
|
|
msgid "Projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismessageseditor
|
|
msgid "Messages Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismessageswindow
|
|
msgid "Messages Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingdirectory
|
|
msgid "missing directory \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr "Event Hilang"
|
|
|
|
#: lazarusidestrconsts.lismissingexecutable
|
|
msgid "missing executable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Paket Tidak Ada"
|
|
|
|
#: lazarusidestrconsts.lismissingunitschoices
|
|
msgid "Your choices are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitscomment
|
|
msgid "Comment Out"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsfordelphi
|
|
msgid "For Delphi only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1
|
|
msgid "1) Comment out the selected units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1b
|
|
msgid "1) Use the units only for Delphi."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo2
|
|
msgid "2) Search for units. Found paths are added to project settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo3
|
|
msgid "3) Abort now, install packages or fix paths and try again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitssearch
|
|
msgid "Search Unit Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismissingunitsskip
|
|
msgid "Skip this Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismitnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (c) <year> <copyright holders>\n"
|
|
"\n"
|
|
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
|
"\n"
|
|
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
|
"\n"
|
|
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmadditionsandoverrides
|
|
msgid "Additions and Overrides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmaddscustomoptions
|
|
msgid "Adds custom options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
|
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackages
|
|
msgid "Apply to all packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
|
msgid "Apply to all packages and projects."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
|
msgid "Apply to all packages matching name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoproject
|
|
msgid "Apply to project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
|
msgid "Create a new group of options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmcustomoption
|
|
msgid "Custom Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
|
msgid "Delete the selected target or option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
|
msgid "Does not add custom options:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
|
msgid "Does not have IDE Macro %s:=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
|
msgid "Does not override OutDir (-FU)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
|
msgid "Exclude all packages matching name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
|
msgid "expected \":=\" after macro name, but found \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
|
msgid "expected macro name, but found \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmfromto
|
|
msgid "From %s to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmidemacro
|
|
msgid "IDE Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmidemacro2
|
|
msgid "IDE Macro %s:=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterat
|
|
msgid "invalid character \"%s\" at %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
|
msgid "invalid character in macro value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmmissingmacroname
|
|
msgid "missing macro name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmnewtarget
|
|
msgid "New Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
|
msgid "Override OutDir (-FU): %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
|
msgid "Override output directory (-FU)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
|
msgid "Override output directory -FU of target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
|
msgid "Redo last undo to this grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
|
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmsets
|
|
msgid "Set \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
|
msgid "Stored in IDE (environmentoptions.xml)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
|
msgid "Stored in project (.lpi)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
|
msgid "Stored in session of project (.lps)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmtargets
|
|
msgid "Targets: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
|
msgid "Undo last change to this grid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencoding
|
|
msgid "Use system encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencodinghint
|
|
msgid "Disable support for UTF-8 default string encoding."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmvalues
|
|
msgid "Value \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmwas
|
|
msgid "(was \"%s\")"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
|
|
msgid "WidgetSet change is available only for LCL projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismode
|
|
msgid ", Mode: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismodifiedlgplnotice
|
|
#, fuzzy,badformat
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
#| "\n"
|
|
#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
#| "\n"
|
|
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
"\n"
|
|
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr "<description>%sHak Cipta (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts.lismodify
|
|
msgid "&Modify"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismore
|
|
msgctxt "lazarusidestrconsts.lismore"
|
|
msgid "More"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoresub
|
|
msgctxt "lazarusidestrconsts.lismoresub"
|
|
msgid "More"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismove
|
|
msgid "Move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefiles
|
|
msgid "Move Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefiles2
|
|
msgid "Move files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
|
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveonepositiondown
|
|
msgid "Move \"%s\" one position down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveonepositionup
|
|
msgid "Move \"%s\" one position up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfiles
|
|
msgid "Move or Copy files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
|
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovepage
|
|
msgid "Move Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveselecteddown
|
|
msgid "Move selected item down (Ctrl+Down)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveselectedup
|
|
msgid "Move selected item up (Ctrl+Up)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismoveto
|
|
msgid "Move to: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
|
msgid "Moving these units will break their uses sections. See Messages window for details."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpcstyle
|
|
msgid "C style: \" => \\\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpescapequotes
|
|
msgid "Escape "es"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpmultipaste
|
|
msgctxt "lazarusidestrconsts.lismpmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismppascalstyle
|
|
msgid "Pascal style: ' => ''"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismppasteoptions
|
|
msgid "Paste &options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismppreview
|
|
msgid "&Preview"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismptextaftereachline
|
|
msgid "Text &after each line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismptextbeforeeachline
|
|
msgid "Text &before each line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismptrimclipboardcontents
|
|
msgid "&Trim clipboard contents"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisms
|
|
msgid "(ms)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismsgcolors
|
|
msgid "Message colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
|
msgid "Multiple directories are separated with semicolons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismultiplepack
|
|
msgid ", multiple packages: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Simpan pesan ke file (*.txt)"
|
|
|
|
#: lazarusidestrconsts.lisname
|
|
msgctxt "lazarusidestrconsts.lisname"
|
|
msgid "Name"
|
|
msgstr "Nama"
|
|
|
|
#: lazarusidestrconsts.lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnameofactivebuildmode
|
|
msgid "Name of active build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Nama dari procedure baru"
|
|
|
|
#: lazarusidestrconsts.lisnever
|
|
msgctxt "lazarusidestrconsts.lisnever"
|
|
msgid "Never"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnew
|
|
msgctxt "lazarusidestrconsts.lisnew"
|
|
msgid "New"
|
|
msgstr "Baru"
|
|
|
|
#: lazarusidestrconsts.lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Kelas Baru"
|
|
|
|
#: lazarusidestrconsts.lisnewconsoleapplication
|
|
msgid "New console application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Buat file editor baru.%sPilih jenis."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Buat file teks kosong baru."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
|
#, fuzzy,badformat
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Buat proyek baru.%Pilih jenis."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
#, fuzzy,badformat
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Buat paket standar baru.%Paket adalah koleksi dari unit dan komponen."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Buat unit baru dengan modul data."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
|
msgid "Create a new unit with a frame."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Buat unit baru dengan form LCL."
|
|
|
|
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
|
msgid "Inherit from a project form or component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Tidak ada item dipilih"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Silahkan pilih item terlebih dulu."
|
|
|
|
#: lazarusidestrconsts.lisnewencoding
|
|
msgid "New encoding:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname
|
|
msgid "Macro %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname2
|
|
msgid "New Macroname"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
|
|
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
|
|
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewpage
|
|
msgid "New page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewproject
|
|
#, fuzzy,badformat
|
|
#| msgid "%s - (new project)"
|
|
msgid "(new project)"
|
|
msgstr "%s - (proyek baru)"
|
|
|
|
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
|
msgid "New recorded macros. Not to be saved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
|
msgid "New units are added to uses sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisno
|
|
msgid "No"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Tidak ada file backup"
|
|
|
|
#: lazarusidestrconsts.lisnobuildprofilesselected
|
|
msgid "No profiles are selected to be built."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnochange
|
|
msgid "No change"
|
|
msgstr "Tidak ada perubahan"
|
|
|
|
#: lazarusidestrconsts.lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr "Tidak ada kode dipilih"
|
|
|
|
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr "Tidak ada opsi kompilator diturunkan."
|
|
|
|
#: lazarusidestrconsts.lisnohints
|
|
msgid "no hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoidewindowselected
|
|
msgid "No IDE window selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnolfmfile
|
|
msgid "No LFM file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnomacroselected
|
|
msgid "No macro selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnomessageselected
|
|
msgid "(no message selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoname
|
|
msgid "noname"
|
|
msgstr "tanpa nama"
|
|
|
|
#: lazarusidestrconsts.lisnone
|
|
msgid "%snone"
|
|
msgstr "%snone"
|
|
|
|
#: lazarusidestrconsts.lisnoneclicktochooseone
|
|
msgid "none, click to choose one"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoneselected
|
|
msgid "(None selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnonodeselected
|
|
msgid "no node selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnopascalfile
|
|
msgid "No Pascal file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoprogramfilesfound
|
|
msgid "No program file \"%s\" found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "ResourceString Section tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
|
#, fuzzy
|
|
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr "Biasanya filter adalah ekspresi reguler. Dalam Sintaks Sederhana sebuah . adalah karakter normal, sebuah * bisa berarti apapun, sebuah ? berarti setiap karakter, dan koma serta titk koma memisahkan alternatif. Sebagai contoh: Sintaks Sederhana *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
|
|
#: lazarusidestrconsts.lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Tidak ada Konstan String Ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisnotadesigntimepackage
|
|
msgid "Not a designtime package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotaninstallpackage
|
|
msgid "Not an install package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotavalidpascalidentifier
|
|
msgid "Not a valid Pascal identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnote
|
|
msgctxt "lazarusidestrconsts.lisnote"
|
|
msgid "Note"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposbottom
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
|
msgid "Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposleft
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
|
msgid "Left"
|
|
msgstr "Left"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposright
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
|
msgid "Right"
|
|
msgstr "Right"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabpostop
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
|
msgid "Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "CATATAN: Tidak bisa membuat Define Template untuk Sumber Free Pascal"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "CATATAN: Tidak bisa membuat Define Template untuk Sumber Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisnotemplateselected
|
|
msgid "no template selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
|
|
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
|
|
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplemented
|
|
msgid "Not implemented"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotimplementedyet
|
|
msgid "Not implemented yet:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotinstalled
|
|
msgid "not installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotinstalledpackages
|
|
msgid "Not installed packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Tdak sekarang"
|
|
|
|
#: lazarusidestrconsts.lisnowloadedscheme
|
|
msgid "Now loaded: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnpcreate
|
|
msgid "Create"
|
|
msgstr "Buat"
|
|
|
|
#: lazarusidestrconsts.lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr "Buat proyek baru"
|
|
|
|
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
|
msgid "Number of files to convert: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
|
msgid "Object Inspector becomes visible when components are selected in designer."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisobjectpath
|
|
msgid "object path"
|
|
msgstr "path objek"
|
|
|
|
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
|
msgid "Switch to Object Inspector Favorites tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoff
|
|
msgid "? (Off)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisofpackage
|
|
msgid " of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoftheprojectinspector
|
|
msgid " of the Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
|
msgid "Add to favorite properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
|
msgid "Choose a base class for the favorite property \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoifclassnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "Class %s%s%s not found."
|
|
msgid "Class \"%s\" not found."
|
|
msgstr "Class %s%s%s tidak ditemukan."
|
|
|
|
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
|
msgid "Remove from favorite properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "otomatis menginstalasi dinamis"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "otomatis menginstalasi statis"
|
|
|
|
#: lazarusidestrconsts.lisoipdescription
|
|
msgid "Description: "
|
|
msgstr "Deskripsi: "
|
|
|
|
#: lazarusidestrconsts.lisoipdescriptiondescription
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sDeskripsi: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipfilename
|
|
msgid "Filename: %s"
|
|
msgstr "Nama file: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "diinstalasi dinamis"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "diinstalasi statis"
|
|
|
|
#: lazarusidestrconsts.lisoiplicenselicense
|
|
msgid "%sLicense: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoipmissing
|
|
msgid "missing"
|
|
msgstr "tidak ada"
|
|
|
|
#: lazarusidestrconsts.lisoipmodified
|
|
msgid "modified"
|
|
msgstr "diubah"
|
|
|
|
#: lazarusidestrconsts.lisoipopenloadedpackage
|
|
#, fuzzy
|
|
#| msgid "Open loaded package"
|
|
msgid "Open Loaded Package"
|
|
msgstr "Buka paket yang diambil"
|
|
|
|
#: lazarusidestrconsts.lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Nama Paket"
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "Silahkan pilih paket"
|
|
|
|
#: lazarusidestrconsts.lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "hanya baca"
|
|
|
|
#: lazarusidestrconsts.lisoipstate
|
|
msgctxt "lazarusidestrconsts.lisoipstate"
|
|
msgid "State"
|
|
msgstr "Kondisi"
|
|
|
|
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "%sThis package is installed, but the lpk file was not found"
|
|
msgstr "%sPaket ini diinstalasi, tetapi file lpk tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisok
|
|
msgctxt "lazarusidestrconsts.lisok"
|
|
msgid "OK"
|
|
msgstr "OK"
|
|
|
|
#: lazarusidestrconsts.lisoldclass
|
|
msgid "Old Class"
|
|
msgstr "Kelas Lama"
|
|
|
|
#: lazarusidestrconsts.lison
|
|
msgid "? (On)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
|
msgid "On break line (i.e. return or enter key)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlinepackage
|
|
msgid "available in the main repository"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonly32bit
|
|
msgid "only 32bit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
|
|
msgid "Only available on Windows. Run the tool hidden."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
|
|
msgid "Only available on Windows. Run tool in a new console."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
|
msgid "Only messages fitting this regular expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
|
msgid "Only messages with these FPC IDs (comma separated):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
|
|
msgid "Only register the Lazarus package files (.lpk). Do not build."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr "Hanya mencari seluruh kata"
|
|
|
|
#: lazarusidestrconsts.lisonpastefromclipboard
|
|
msgid "On paste from clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopen
|
|
msgctxt "lazarusidestrconsts.lisopen"
|
|
msgid "Open"
|
|
msgstr "Buka"
|
|
|
|
#: lazarusidestrconsts.lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr "Buka sebagai file XML"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunit
|
|
msgid "Open designer on open unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
|
msgid "Form is loaded in designer always when source unit is opened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr "Buka file yang ada"
|
|
|
|
#: lazarusidestrconsts.lisopenfile
|
|
#, fuzzy
|
|
#| msgid "Open file"
|
|
msgctxt "lazarusidestrconsts.lisopenfile"
|
|
msgid "Open File"
|
|
msgstr "Buka file"
|
|
|
|
#: lazarusidestrconsts.lisopenfile2
|
|
#, fuzzy
|
|
#| msgid "Open file"
|
|
msgctxt "lazarusidestrconsts.lisopenfile2"
|
|
msgid "Open file"
|
|
msgstr "Buka file"
|
|
|
|
#: lazarusidestrconsts.lisopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenlfm
|
|
msgid "Open %s"
|
|
msgstr "Buka %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Buka Paket?"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage2
|
|
msgid "Open package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr "Buka File Paket"
|
|
|
|
#: lazarusidestrconsts.lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Buka Proyek?"
|
|
|
|
#: lazarusidestrconsts.lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Buka proyek"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr "Buka lagi proyek"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Buka File Proyek"
|
|
|
|
#: lazarusidestrconsts.lisopensymlink
|
|
msgid "Open symlink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopentarget
|
|
msgid "Open target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr "Buka file sebagai sumber normal"
|
|
|
|
#: lazarusidestrconsts.lisopenthepackage
|
|
msgid "Open the package %s?"
|
|
msgstr "Buka paket %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentheproject
|
|
msgid "Open the project %s?"
|
|
msgstr "Buka proyek %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentooloptions
|
|
msgid "Open Tool Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenunit
|
|
msgid "Open Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenurl
|
|
msgid "Open URL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenxml
|
|
msgid "Open XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoptions
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisoptions"
|
|
msgid "Options"
|
|
msgstr "Opsi"
|
|
|
|
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
|
|
msgid "Options changed, recompiling clean with -B"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoptionvalueignored
|
|
msgid "ignored"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisor
|
|
msgid "or"
|
|
msgstr "atau"
|
|
|
|
#: lazarusidestrconsts.lisos
|
|
msgid ", OS: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
|
msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
|
|
msgid "output directory of %s contains Pascal unit source \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridelanguage
|
|
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgstr "Timpa bahasa. Sebagai contoh --language=de. untuk nilai yang mungkin lihat file dalam direktori languages."
|
|
|
|
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
|
|
msgid "Override function result string types with the first parameter expression type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
|
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
|
msgid "%soverride the project or IDE build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
|
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
|
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
|
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverwritefile
|
|
msgid "Overwrite file?"
|
|
msgstr "Timpa file?"
|
|
|
|
#: lazarusidestrconsts.lisoverwritefileondisk
|
|
msgid "Overwrite file on disk"
|
|
msgstr "Timpa file pada disk"
|
|
|
|
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
|
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackage
|
|
msgid "Package"
|
|
msgstr "Paket"
|
|
|
|
#: lazarusidestrconsts.lispackage2
|
|
msgid "package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackage3
|
|
msgid ", package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageinfo
|
|
#, fuzzy
|
|
#| msgid "Package Info"
|
|
msgid "Package info"
|
|
msgstr "Info Paket"
|
|
|
|
#: lazarusidestrconsts.lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Nama paket dimulai dengan ..."
|
|
|
|
#: lazarusidestrconsts.lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Nama paket berisi ..."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
|
msgid "Package needs an output directory."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Paket perlu diinstalasi"
|
|
|
|
#: lazarusidestrconsts.lispackageoption
|
|
msgid "Package \"%s\" Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageoutputdirectories
|
|
msgid "Package output directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagesourcedirectories
|
|
msgid "Package source directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
|
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackageunit
|
|
msgid "package unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispage
|
|
msgid "Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispagename
|
|
msgid "Page name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispagenamealreadyexists
|
|
msgid "Page name \"%s\" already exists. Not added."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispanic
|
|
msgctxt "lazarusidestrconsts.lispanic"
|
|
msgid "Panic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparsed
|
|
msgid ", parsed "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparser
|
|
msgid "parser \"%s\": %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisparsers
|
|
msgid "Parsers:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispasscount
|
|
msgid "Pass Count"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
|
|
msgid "passing compiler define \"%s\" twice with different values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
|
|
msgid "passing compiler option -%s twice with different values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispaste
|
|
msgctxt "lazarusidestrconsts.lispaste"
|
|
msgid "Paste"
|
|
msgstr "Paste"
|
|
|
|
#: lazarusidestrconsts.lispasteclipboard
|
|
msgid "paste clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lispastefromclipboard"
|
|
msgid "Paste from clipboard."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispastelcolors
|
|
msgid "Pastel Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispath
|
|
msgid "Path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditbrowse
|
|
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
|
msgid "Browse"
|
|
msgstr "Browse"
|
|
|
|
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
|
msgid "Delete Invalid Paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathdown
|
|
#, fuzzy
|
|
#| msgid "Move path down"
|
|
msgid "Move path down (Ctrl+Down)"
|
|
msgstr "Turunkan path"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathup
|
|
#, fuzzy
|
|
#| msgid "Move path up"
|
|
msgid "Move path up (Ctrl+Up)"
|
|
msgstr "Naikkan path"
|
|
|
|
#: lazarusidestrconsts.lispatheditoraddhint
|
|
msgid "Add new path to the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditordeletehint
|
|
msgid "Delete the selected path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
|
msgid "Remove non-existent (gray) paths from the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditorreplacehint
|
|
msgid "Replace the selected path with a new path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditortempladdhint
|
|
msgid "Add template to the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Template Path"
|
|
|
|
#: lazarusidestrconsts.lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Path Pencarian:"
|
|
|
|
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
|
msgid "path of the instantfpc cache"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathofthemakeutility
|
|
msgid "Path of the make utility"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathtoinstance
|
|
msgid "Path to failed Instance:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispause
|
|
msgctxt "lazarusidestrconsts.lispause"
|
|
msgid "Pause"
|
|
msgstr "Istirahat"
|
|
|
|
#: lazarusidestrconsts.lispckcleartousethepackagename
|
|
msgid "Clear to use the package name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckdisablei18noflfm
|
|
msgid "Disable I18N of lfm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
|
msgid "Add Files from File System"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddotheritems
|
|
msgid "Add other items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditaddtoproject
|
|
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Terapkan perubahan"
|
|
|
|
#: lazarusidestrconsts.lispckeditavailableonline
|
|
msgid "(available online)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "Panggil %sRegister%s procedure dari unit yang dipilih"
|
|
|
|
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
|
msgid "Clean up dependencies ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
|
msgid "Clear default/preferred filename of dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Kompilasi semuanya?"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Kompilasi paket"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
|
msgid "Compiler Options for Package %s"
|
|
msgstr "Opsi Kompilator untuk Paket %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
|
msgid "Create fpmake.pp"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatemakefile
|
|
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Buat Makefile"
|
|
|
|
#: lazarusidestrconsts.lispckeditdefault
|
|
msgid "%s, default: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
|
#, fuzzy
|
|
#| msgid "Edit General Options"
|
|
msgid "Edit general options"
|
|
msgstr "Edit Opsi Umum"
|
|
|
|
#: lazarusidestrconsts.lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Properti File"
|
|
|
|
#: lazarusidestrconsts.lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Instalasi"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Versi maksimum tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Versi minimum tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Versi Maksimum:"
|
|
|
|
#: lazarusidestrconsts.lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Versi Minimum:"
|
|
|
|
#: lazarusidestrconsts.lispckeditmodified
|
|
msgid "Modified: %s"
|
|
msgstr "Diubah: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Turunkan dependensi"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Naikkan dependensi"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackage
|
|
msgid "Package %s"
|
|
msgstr "Paket %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Package %s%s%s has changed.%sSave package?"
|
|
msgid "Package \"%s\" has changed.%sSave package?"
|
|
msgstr "Paket %s%s%s sudah diubah.%sSimpan paket?"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
|
msgid "package %s not saved"
|
|
msgstr "paket %s tidak dismpan"
|
|
|
|
#: lazarusidestrconsts.lispckeditpage
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s, Halaman: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Tambah-Ulang dependensi"
|
|
|
|
#: lazarusidestrconsts.lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Tambah-Ulang file"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadonly
|
|
msgid "Read Only: %s"
|
|
msgstr "Hanya Baca: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
|
#, fuzzy
|
|
#| msgid "Recompile all required"
|
|
msgid "Recompile All Required"
|
|
msgstr "Kompilasi ulang semua yang dibutuhkan"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileclean
|
|
#, fuzzy
|
|
#| msgid "Recompile clean"
|
|
msgid "Recompile Clean"
|
|
msgstr "Kompilasi ulang bersih"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Rekompilasi ini dan semua paket yang dibutuhkan?"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Plugins terdaftar"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Register unit"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Hapus dependensi"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency2
|
|
msgid "Remove Dependency?"
|
|
msgstr "Hapus Dependensi?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
|
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Hapus dependensi %s%s%s%sdari paket %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedfiles
|
|
msgid "Removed Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Hapus paket yang diperlukan"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Hapus file"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Hapus file?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
|
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Hapus file %s%s%s%sdari paket %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Hapus item yang dipilih"
|
|
|
|
#: lazarusidestrconsts.lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Paket yang Dibutuhkan"
|
|
|
|
#: lazarusidestrconsts.lispckeditsavepackage
|
|
#, fuzzy
|
|
#| msgid "Save package"
|
|
msgid "Save Package"
|
|
msgstr "Simpan paket"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
|
msgid "Store file name as default for this dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
|
msgid "Store file name as preferred for this dependency"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
|
#, fuzzy,badformat
|
|
#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Versi maksimum %s%s%s bukan versi paket yang benar.%s(contoh benar 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
|
#, fuzzy,badformat
|
|
#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Versi minimum %s%s%s bukan versi paket yang benar.%s(contoh benar 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "Uninstalasi"
|
|
|
|
#: lazarusidestrconsts.lispckeditviewpackagesource
|
|
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
|
msgid "View Package Source"
|
|
msgstr "Lihat Sumber Paket"
|
|
|
|
#: lazarusidestrconsts.lispckexplbase
|
|
msgid "Base, cannot be uninstalled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckexplinstalled
|
|
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
|
msgid "Installed"
|
|
msgstr "Diinstalasi"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Instalasi saat mulai nanti"
|
|
|
|
#: lazarusidestrconsts.lispckexplstate
|
|
msgid "%sState: "
|
|
msgstr "%sKondisi: "
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
|
#, fuzzy
|
|
#| msgid "Uninstall on next start"
|
|
msgid "Uninstall on next start (unless needed by an installed package)"
|
|
msgstr "Jangan instalasi saat mulai nanti"
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallpackage
|
|
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
|
msgid "Uninstall package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "Tambah opsi untuk paket dependen dan proyek"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Tambah path ke paket dependen/proyek"
|
|
|
|
#: lazarusidestrconsts.lispckoptsauthor
|
|
#, fuzzy
|
|
#| msgid "Author:"
|
|
msgid "Author"
|
|
msgstr "Pembuat:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Otomatis membangun ulang jika diperlukan"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Otomatis membangun ulang ketika pembangunan ulang semua"
|
|
|
|
#: lazarusidestrconsts.lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Kustom"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
|
#, fuzzy
|
|
#| msgid "Description/Abstract"
|
|
msgid "Description / Abstract"
|
|
msgstr "Deskripsi/Abstrak"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntime
|
|
msgid "Designtime"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
|
#, fuzzy
|
|
#| msgid "Designtime and Runtime"
|
|
msgid "Designtime and runtime"
|
|
msgstr "Waktu desain dan Runtime"
|
|
|
|
#: lazarusidestrconsts.lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "Integrasi IDE"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr "Include"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Tipe paket tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Librari"
|
|
|
|
#: lazarusidestrconsts.lispckoptslicense
|
|
#, fuzzy
|
|
#| msgid "License:"
|
|
msgid "License"
|
|
msgstr "Lisensi:"
|
|
|
|
#: lazarusidestrconsts.lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Linker"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr "Mayor"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Kompilasi manual (tidak secara otomatis)"
|
|
|
|
#: lazarusidestrconsts.lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr "Minor"
|
|
|
|
#: lazarusidestrconsts.lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Objek"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackageoptions
|
|
msgid "Package Options"
|
|
msgstr "Opsi Paket"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackagetype
|
|
#, fuzzy
|
|
#| msgid "PackageType"
|
|
msgid "Package type"
|
|
msgstr "TipePaket"
|
|
|
|
#: lazarusidestrconsts.lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr "Menyediakan"
|
|
|
|
#: lazarusidestrconsts.lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Rilis"
|
|
|
|
#: lazarusidestrconsts.lispckoptsruntime
|
|
msgid "Runtime"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
|
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
|
msgstr "Paket %s%s%s mempunyai tanda otomatis instalasi.%sIni berarti akan diinstalasi dalam IDE. Paket instalasi%sharus Paket waktu desain."
|
|
|
|
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr "Paket ini menyediakan hal yang sama seperti paket berikut:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
|
#, fuzzy
|
|
#| msgid "Update/Rebuild"
|
|
msgid "Update / Rebuild"
|
|
msgstr "Pemutakhiran/Bangun ulang"
|
|
|
|
#: lazarusidestrconsts.lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Penggunaan"
|
|
|
|
#: lazarusidestrconsts.lispckpackage
|
|
msgid "Package:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
|
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckshowunneededdependencies
|
|
msgid "Show unneeded dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
|
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispdabort
|
|
msgctxt "lazarusidestrconsts.lispdabort"
|
|
msgid "Abort"
|
|
msgstr "Batalkan"
|
|
|
|
#: lazarusidestrconsts.lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Progres"
|
|
|
|
#: lazarusidestrconsts.lispecollapsedirectory
|
|
msgid "Collapse directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr "Konflik ditemukan"
|
|
|
|
#: lazarusidestrconsts.lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeexpanddirectory
|
|
msgid "Expand directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispefilename
|
|
msgid "Filename:"
|
|
msgstr "Nama file:"
|
|
|
|
#: lazarusidestrconsts.lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr "Nama file unit tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr "Nama unit tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispemissingfilesofpackage
|
|
msgid "Missing files of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
|
msgid "New file not in include path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
|
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
|
msgid "No files missing. All files exist."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisperemovefiles
|
|
msgid "Remove files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisperevertpackage
|
|
msgid "Revert Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesavepackageas
|
|
msgid "Save Package As ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
|
msgid "Show directory hierarchy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeshowmissingfiles
|
|
msgid "Show Missing Files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesortfiles
|
|
msgid "Sort Files Permanently"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesortfilesalphabetically
|
|
msgid "Sort files alphabetically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
|
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr "Nama unit:"
|
|
|
|
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
|
msgid "Use all units in directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispeusenounitsindirectory
|
|
msgid "Use no units in directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
|
msgid "Clean up package dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgclearselection
|
|
msgid "Clear Selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
|
msgid "CompiledSrcPath addition"
|
|
msgstr "Tambahan CompiledSrcPath"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsnamespaces
|
|
msgid "Namespaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
|
msgid "Output directory"
|
|
msgstr "Direktori output"
|
|
|
|
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
|
msgid "Package Source Directory Mark"
|
|
msgstr "Tanda Direktori Sumber Proyek"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsunitpath
|
|
msgid "Unit Path"
|
|
msgstr "Path Unit"
|
|
|
|
#: lazarusidestrconsts.lispkgdeletedependencies
|
|
msgid "Delete dependencies"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Anda benar-benar ingin melupakan semua perubahan terhadap paket %s dan mengambil ulang dari file?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "Unit baru tidak dalam unitpath"
|
|
|
|
#: lazarusidestrconsts.lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Publikasikan Paket"
|
|
|
|
#: lazarusidestrconsts.lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Kembalikan paket?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
|
|
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
|
msgstr "File %s%s%s%ssaat ini tidak dalam unitpath dari paket.%s%sTambah %s%s%s ke UnitPath?"
|
|
|
|
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
|
msgid "More functions for the package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypebinary
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
|
msgid "Binary"
|
|
msgstr "Biner"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeinclude
|
|
msgid "Include file"
|
|
msgstr "File Include"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeissues
|
|
msgid "Issues xml file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelfm
|
|
msgid "LFM - Lazarus form text"
|
|
msgstr "LFM - Teks form Lazarus"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelrs
|
|
msgid "LRS - Lazarus resource"
|
|
msgstr "LRS - Lazarus resource"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypemainunit
|
|
msgid "Main Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypetext
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
|
msgid "Text"
|
|
msgstr "Teks"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
|
msgid "Virtual Unit"
|
|
msgstr "Unit Virtual"
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
|
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
|
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
|
|
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
|
|
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
|
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
|
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "%sAdding new Dependency for package %s: package %s%s"
|
|
msgid "%sAdding new Dependency for package %s: package %s"
|
|
msgstr "%sPenambahan Dependensi baru untuk paket %s: paket %s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "%sAdding new Dependency for project %s: package %s%s"
|
|
msgid "%sAdding new Dependency for project %s: package %s"
|
|
msgstr "%sPenambahan Dependensi baru untuk proyek %s: paket %s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
|
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
|
msgstr "Tambah unit ke klausul uses dari paket. Matikan ini hanya untuk unit yang seharusnya tidak dikompilasi dalam semua kasus."
|
|
|
|
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Unit dwimakna ditemukan"
|
|
|
|
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Otomatis menginstalasi paket"
|
|
|
|
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sKedua paket tersambung. Ini berarti, This means, either one package uses the other, or they are both used by a third package."
|
|
|
|
#: lazarusidestrconsts.lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Dependensi Rusak"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
|
msgid "Circular dependencies found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangcompilepackage
|
|
msgid "Compile package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeletefailed
|
|
msgid "Delete failed"
|
|
msgstr "Penghapusan gagal"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Hapus File Paket Lama?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Delete old package file %s%s%s?"
|
|
msgid "Delete old package file \"%s\"?"
|
|
msgstr "Hapus file paket %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Dependensi tapa Pemilik: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
|
msgid "Error reading file"
|
|
msgstr "Kesalahan pembacaan file"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Kesalahan Pembacaan Paket"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
|
|
msgid "Error: updating po files failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Kesalahan penulisan file"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Kesalahan Penulisan Paket"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "File sudah ada dalam paket"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "File dalam Proyek"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Nama file berbeda dari Namapaket"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Nama file sedang digunakan oleh paket lain"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Nama file sedang digunakan oleh proyek"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "File %s%s%s not found."
|
|
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "File %s%s%s tidak ditemukan."
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "File tidak disimpan"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr "Menginstalasi paket %s akan menginstalasi paket secara otomatis:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr "Menginstalasi paket %s akan menginstalasi paket secara otomatis:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
|
msgid "invalid Compiler filename"
|
|
msgstr "Nama file Kompilator tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Ekstensi file tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Ekstensi file paket tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Nama file paket tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Nama paket tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Nama Paket Tidak Benar"
|
|
|
|
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
|
msgstr "Pengambilan paket %s akan menimpa paket %s%sdari file %s.%sPaket lama diubah.%s%sSimpan paket lama %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangnewpackage
|
|
msgid "NewPackage"
|
|
msgstr "PaketBaru"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackage
|
|
msgid "Package: %s"
|
|
msgstr "Paket: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Paket konflik"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
|
#, fuzzy
|
|
#| msgid "Package is no designtime package"
|
|
msgid "Package is not a designtime package"
|
|
msgstr "Paket bukan paket waktu desain"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Paket dibutuhkan"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
|
msgid "package main source file"
|
|
msgstr "file sumber utama paket"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Nama paket sudah ada"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Paket harus mempunyai ekstensi .lpk"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
|
msgid "Please compile the package first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Silahkan simpan file sebelum menambahkannya ke paket."
|
|
|
|
#: lazarusidestrconsts.lispkgmangproject
|
|
msgid "Project: %s"
|
|
msgstr "Proyek: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Bangun ulang Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Replace existing file %s%s%s?"
|
|
msgid "Replace existing file \"%s\"?"
|
|
msgstr "Timpa file yang sudah ada %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Timpa File"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
|
msgid "One or more required packages were not found. See package graph for details."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
|
msgid ""
|
|
"The package %s is already open in the IDE.\n"
|
|
"You cannot save a package with the same name.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage
|
|
#, fuzzy
|
|
#| msgid "Save Package?"
|
|
msgid "Save package?"
|
|
msgstr "Simpan Paket?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Simpan Paket %s (*.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
|
#, fuzzy,badformat
|
|
#| msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
|
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
|
msgstr "Haruskah file diganti nama huruf kecil ke %s%s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr "Lewati paket ini"
|
|
|
|
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
|
msgid "static packages config file"
|
|
msgstr "file konfigurasi paket statik"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
|
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
|
msgstr "File kompilator untuk paket %s bukan eksekutabel yang benar: %s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%sis already in the package %s."
|
|
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
|
msgid "The file \"%s\"%sis already in the package %s."
|
|
msgstr "File %s%s%s%ssudah berada dalam paket %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s is not a Lazarus package."
|
|
msgid "The file \"%s\" is not a Lazarus package."
|
|
msgstr "File %s%s%s ibukan paket Lazarus."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
|
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
|
msgstr "Nama file %s%s%s tidak terkait ke nama paket %s%s%s dalam file.%sUbah nama paket ke %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
|
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "Nama file %s%s%s adalah bagian dari proyek saat ini.%sProyek dan Paket seharusnya bukan file berbagi."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
|
#, fuzzy,badformat
|
|
#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
|
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
|
msgstr "Nama file %s%s%s digunakan oleh%spaket %s%s%s%sdalam file %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
|
|
msgid "The file \"%s\" of package %s was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr "Paket berikut gagal diambil:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr "Paket berikut gagal diambil:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
#, fuzzy,badformat
|
|
#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
|
msgstr "%sUnit berikut akan ditambahkan ke bagian uses dari%s%s:%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
|
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
|
|
msgstr "Paket %s%s%s gagal dikompilasi.%sHapus dari daftar instalasi?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
#, fuzzy,badformat
|
|
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
|
|
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
|
msgstr "Nama file paket %s%s%s in%s%s%s%s bukan nama paket Lazarus yang benar."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
#, fuzzy
|
|
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
|
msgstr "Paket %s adalah hanya paket runtime.%sPaket hanya runtime tidak bisa diinstalasi dalam IDE."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
|
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Paket %s%s%s ditandai untuk instalasi, tetapi tidak ditemukan.%sHapus dependensi dari daftar instalasi paket?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
|
msgstr "Paket %s diperlukan oleh %s, yang ditandai untuk instalasi.%sLihat grafik paket."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
#, fuzzy,badformat
|
|
#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "Nama paket %s%s%s bukan nama paket yang benar%sSilahkan pilih nama lain (contoh. paket1.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
|
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
|
msgstr "Nama paket %s%s%s dari%sfile %s%s%s tidak benar."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Paket %s%s%s sudah ditandai.%sSaat ini Lazarus hanya mendukung paket static linked. Pembatalan instalasi sebenarnya perlu membangun ulang dan memulai lagi Lazarus.%s%sAnda ingin membangun ulang Lazarus sekarang?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Paket %s%s%s ditandai untuk instalasi.%sSaat ini Lazarus hanya mendukung paket static linked. Instalasi sebenarnya memerlukan pembangunan ulang dan memulai lagi Lazarus.%s%sAnda ingin membangun ulang Lazarus sekarang?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
|
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Proyek memerlukan paket %s%s%s.%sTetapi tidak ditemukan. Lihat Proyek -> Inspektor Proyek."
|
|
|
|
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
|
#, fuzzy,badformat
|
|
#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
|
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
|
msgstr "Ada dua unit dengan nama sama:%s%s1. %s%s%s dari %s%s2. %s%s%s dari %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
|
msgid "There is a circular dependency in the packages. See package graph."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
|
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
|
msgstr "Ada unit FPC dengan nama yang sama dengan paket::%s%s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
|
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
|
msgstr "Ada unit FPC dengan nama yang sama dengan: %s%s%s%s%s dari %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
|
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
|
msgstr "Sudah ada nama paket lain dengan nama %s%s%s.%sPaket konflik: %s%s%s%sFile: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgstr "Sudah ada paket %s%s%s diambil%sdari file %s%s%s.%sLihat Komponen -> Grafik Paket.%sPenimpaan tidak mungkin."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Ada paket tidak disimpan dalam paket yang diperlukan. Lihat grafik paket."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
|
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
|
msgstr "Ada unit dengan nama yang sama dengan paket:%s%s1. %s%s%s dari %s%s2. %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr "Ini adalah paket virtual. belum mempunyai sumber. Silahkan simpan paket terlebih dulu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
|
msgid "Unable to create directory"
|
|
msgstr "Tidak bisa membuat direktori"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create output directory %s%s%s%sfor package %s."
|
|
msgid "Unable to create output directory \"%s\"%sfor package %s."
|
|
msgstr "Tidak bisa membuat direktori output %s%s%s%suntuk paket %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
|
msgid "Unable to create package source directory \"%s\"%sfor package %s."
|
|
msgstr "Tidak bisa membuat direktori sumber paket %s%s%s%suntuk paket %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgstr "Tidak bisa membuat direktori target untuk lazarus:%s%s%s%s.%sDirektori ini dibutuhkan untuk Lazarus IDE baru yang diubah dengan paket kustom anda."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete file %s%s%s."
|
|
msgid "Unable to delete file \"%s\"."
|
|
msgstr "Tidak bisa menghapus file %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
|
msgid "Unable to delete file"
|
|
msgstr "Tidak bisa menghapus file"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
|
msgid "Unable to delete old state file \"%s\"%sfor package %s."
|
|
msgstr "Tidak bisa menghapus file kondisi yang lama %s%s%s%suntuk paket %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
|
msgid "Unable to load package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
|
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
|
|
msgstr "Tidak bisa membuka paket %s%s%s.%sPaket ini ditandai untuk instalasi."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
|
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Tidak bisa membaca file kondisi %s%s%s%sdari paket %s.%sKesalahan: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
|
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
|
msgstr "Tidak bisa menulis paket %s%s%s%ske file %s%s%s.%sKesalahan: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
|
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Tidak bisa menulis file kondisi %s%s%s%sdari paket %s.%sKesalahan: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Batalkan instalasi paket?"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Batalkan instalasi paket %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Paket tidak disimpan"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Gunakan unit"
|
|
|
|
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
|
#, fuzzy,badformat
|
|
#| msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
|
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
|
msgstr "Perhatian: File %s%s%s%smilik proyek saat ini."
|
|
|
|
#: lazarusidestrconsts.lispkgmgrkeep
|
|
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
|
msgid "keep"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmgrnew
|
|
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
|
msgid "new"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmgrremove
|
|
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
|
msgid "remove"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgselectapackage
|
|
msgid "Select a package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsinstalled
|
|
msgctxt "lazarusidestrconsts.lispkgsinstalled"
|
|
msgid "Installed"
|
|
msgstr "Diinstalasi"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
|
#, fuzzy
|
|
#| msgid "Can not register components without unit"
|
|
msgid "Cannot register components without unit"
|
|
msgstr "Tidak bisa mendaftarkan komponen tanpa unit"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
|
#, fuzzy,badformat
|
|
#| msgid "Component Class %s%s%s already defined"
|
|
msgid "Component Class \"%s\" already defined"
|
|
msgstr "Kelas Komponen %s%s%s sudah didefinisikan"
|
|
|
|
#: lazarusidestrconsts.lispkgsysfilename
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%sFile Name: %s%s%s"
|
|
msgid "%s%sFile Name: \"%s\""
|
|
msgstr "%s%sNama File: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
|
msgid "Invalid component class"
|
|
msgstr "Kelas komponen tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
|
msgid "Invalid Unitname: %s"
|
|
msgstr "Nama unit tidak benar: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgsyslpkfilename
|
|
msgid "%s%slpk file: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
|
msgid "Package file not found"
|
|
msgstr "File paket tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
|
msgid "Package registration error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
|
msgid "Register procedure is nil"
|
|
msgstr "Register procedure kosong"
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
|
msgid "RegisterUnit was called, but no package is registering."
|
|
msgstr "RegisterUnit dipanggil, tetapi tidak ada paket yang terdaftar."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
|
|
msgid "%s%sThe lpk file was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
|
#, fuzzy,badformat
|
|
#| msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgstr "Paket ini %s%s%s diinstalasi, tetapi tanpa file paket (.lpk) yang ditemukan.%spaket sementara yang rusak dibuat."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
|
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
|
msgstr "Ini adalah paket default. Digunakan hanya untuk komponen tanpa paket. Komponen ini kadaluarsa."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
|
msgstr "Paket diinstalasi, tetapi file lpk tidak ditemukan. Semua komponennya di-non aktifkan. Silahkan betulkan ini."
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitname
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%sUnit Name: %s%s%s"
|
|
msgid "%s%sUnit Name: \"%s\""
|
|
msgstr "%s%sNama Unit: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
|
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
|
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
|
|
msgid "Unit \"%s\" was removed from package (lpk)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
|
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
|
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr "File tidak dalam paket yang diaktifkan."
|
|
|
|
#: lazarusidestrconsts.lispkgtransitivity
|
|
msgid "Transitivity"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read package file %s%s%s.%sError: %s"
|
|
msgid "Unable to read package file \"%s\".%sError: %s"
|
|
msgstr "Tidak bisa membaca file paket %s%s%s.%sKesalahan: %s"
|
|
|
|
#: lazarusidestrconsts.lisplay
|
|
msgid "Play"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldglobal
|
|
msgctxt "lazarusidestrconsts.lispldglobal"
|
|
msgid "Global"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldonline
|
|
msgid "Online"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowgloballinksin
|
|
msgid "Show global links in "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowonlinelinks
|
|
msgid "Show online links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowuserlinksin
|
|
msgid "Show user links in "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplduser
|
|
msgid "User"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
|
msgid "Please fix the error shown in the message window, which is normally below the source editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "Silahkan buka unit sebelum menjalankan"
|
|
|
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr "Silahkan pilih beberapa kode untuk mengekstrak procedure/method baru."
|
|
|
|
#: lazarusidestrconsts.lisplistall
|
|
msgctxt "lazarusidestrconsts.lisplistall"
|
|
msgid "<All>"
|
|
msgstr "<Semua>"
|
|
|
|
#: lazarusidestrconsts.lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr "Ubah Font"
|
|
|
|
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr "Copy nama method ke clipboard"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr "Filter menyamai setiap bagian dari method"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr "Filter menyamai setiap awal dari method"
|
|
|
|
#: lazarusidestrconsts.lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Lompat Ke Pilihan"
|
|
|
|
#: lazarusidestrconsts.lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<Tidak ada>"
|
|
|
|
#: lazarusidestrconsts.lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Objects"
|
|
|
|
#: lazarusidestrconsts.lisplistprocedurelist
|
|
msgid "Procedure List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisplisttype
|
|
msgctxt "lazarusidestrconsts.lisplisttype"
|
|
msgid "Type"
|
|
msgstr "Tipe"
|
|
|
|
#: lazarusidestrconsts.lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Jangan simpan info sesi apapun"
|
|
|
|
#: lazarusidestrconsts.lispointer
|
|
msgid "Pointer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
|
#, fuzzy
|
|
#| msgid "Save in IDE config directory"
|
|
msgid "Save in .lps file in IDE config directory"
|
|
msgstr "Simpan dalam direktori konfigurasi IDE"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "Simpan dalam file .lpi"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr "Simpan dalam file .lps dalam direktori proyek"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Simpan informasi sesi dalam"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
|
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisposition
|
|
msgid "Position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispositionoutsideofsource
|
|
msgid "%s (position outside of source)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisppuinwrongdirectory
|
|
msgid "ppu in wrong directory=%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
|
msgid "%s.ppu not found. Check your fpc.cfg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprecedingword
|
|
msgid "Preceding word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
|
msgstr "direktori konfigurasi utama, dimana Lazarus menyimpan file konfigurasinya. Default adalah"
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigpath
|
|
msgid "Primary config path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprior
|
|
msgid "prior %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispriority
|
|
msgctxt "lazarusidestrconsts.lispriority"
|
|
msgid "Priority"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprivate
|
|
msgid "Private"
|
|
msgstr "Private"
|
|
|
|
#: lazarusidestrconsts.lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Metode Private"
|
|
|
|
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
#, fuzzy,badformat
|
|
#| msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
|
|
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
|
msgstr "Mungkin anda perlu menginstalasi beberapa paket sebelum melanjutkan. %s%sPerhatian:%sProyek tergantung pada beberapa paket, yang berisi unit dengan prosedur Register. Prosedur Register biasanya digunakan untuk menginstalasi komponen dalam IDE. Tetapi unit berikut milik paket yang belum diinstalasi dalam IDE. Jika anda ingin mencoba membuka form dalam IDE, yang menggunakan komponen tersebut, anda akan mendapatkan kesalahan mengenai komponen yang tidak ada dan pengambilan form akan membuat hasil yang tidak menyenangkan.%s%sIni tidak berpengaruh pada pembukaan proyek atau sumbernya.%s%sIni hanya berarti: Adalah ide yang buruk untuk membuka form untuk desain, sebelum menginstalasi paket yang tidak ada.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisprocedure
|
|
msgctxt "lazarusidestrconsts.lisprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedure"
|
|
|
|
#: lazarusidestrconsts.lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr "Proseduir dengan interface"
|
|
|
|
#: lazarusidestrconsts.lisprogram
|
|
msgctxt "lazarusidestrconsts.lisprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Program dideteksi"
|
|
|
|
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
|
msgid "A Free Pascal command line program with some useful settings added."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
#, fuzzy
|
|
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
|
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Sumber program harus ekstensi pascal seperti .pas, .pp or .lpr"
|
|
|
|
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
|
msgid "Add Files to Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Dependensi sudah ada"
|
|
|
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
|
#, fuzzy
|
|
#| msgid "Add editor files"
|
|
msgid "Add Editor Files"
|
|
msgstr "Tambah file editor"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Versi Min-Max tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
|
#, fuzzy
|
|
#| msgid "Invalid pascal unit name"
|
|
msgid "Invalid Pascal unit name"
|
|
msgstr "Nama unit pascal tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Versi tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisprojaddlocalpkg
|
|
msgid "Local (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Versi Maksimum (opsional):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Versi Minimum (opsional):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Kebutuhan Baru"
|
|
|
|
#: lazarusidestrconsts.lisprojaddonlinepkg
|
|
msgid "Online (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Nama Paket:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Paket tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagetype
|
|
msgid "Package Type:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
|
#, fuzzy,badformat
|
|
#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
|
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
|
msgstr "Dependensi %s%s%s tidak ditemukan.%sSilahkan pilih paket yang ada."
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Versi Maksimum %s%s%s tidak benar.%sSilahkan gunakan format mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Versi Maksimum lebih rendah daripada Versi Minimum."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Versi Minimum %s%s%s tidak benar.%sSilahkan gunakan format mayor mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
|
#, fuzzy,badformat
|
|
#| msgid "The project has already a dependency for the package %s%s%s."
|
|
msgid "The project has already a dependency for the package \"%s\"."
|
|
msgstr "Proyek sudah mempunyai dependensi untuk paket %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
|
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
|
msgstr "Nama unit %s%s%s sudah ada dalam proyek%sdengan file: %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
|
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
|
msgstr "Nama unit %s%s%s sudah ada dalam pilihan%sdengan file: %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit name %s%s%s is not a valid Pascal identifier."
|
|
msgid "The unit name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Nama unit %s%s%s bukan pengenal pascal yang benar."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtoproject
|
|
#, fuzzy
|
|
#| msgid "Add to project"
|
|
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Tambah ke proyek"
|
|
|
|
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Nama unit sudah ada"
|
|
|
|
#: lazarusidestrconsts.lisproject
|
|
msgid "Project %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisproject2
|
|
msgid "Project: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisproject3
|
|
msgid "project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Prouek diubah"
|
|
|
|
#: lazarusidestrconsts.lisprojectchangedondisk
|
|
msgid "Project changed on disk"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectcount
|
|
msgid "%d projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectory
|
|
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Direktori proyek"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
|
msgid "Title in taskbar shows also directory path of the project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Nama file proyek"
|
|
|
|
#: lazarusidestrconsts.lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Path Include Proyek"
|
|
|
|
#: lazarusidestrconsts.lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "File info proyek dideteksi"
|
|
|
|
#: lazarusidestrconsts.lisprojectinformation
|
|
#, fuzzy
|
|
#| msgid "Project Information"
|
|
msgid "Project information"
|
|
msgstr "Informasi Proyek"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Proyek bisa dijalankan"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnablehint
|
|
msgid "Generates a binary executable which can be run."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacro
|
|
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
|
msgid "Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr "Properti makro proyek"
|
|
|
|
#: lazarusidestrconsts.lisprojectnamespaces
|
|
msgid "Project Namespaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectoption
|
|
msgid "Project Option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectoutdir
|
|
msgid "Project Output directory (e.g. the ppu directory)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectoutputdirectory
|
|
msgid "Project output directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectpathhint
|
|
msgid "Directory where project's main file must be"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsession
|
|
msgid "Project Session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsessionchanged
|
|
msgid "Project session changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsourcedirectories
|
|
msgid "Project source directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
|
msgid "%0:s%0:s At address %1:x"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
|
msgid "Project %s raised exception class '%s'."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
|
msgid "Project %s raised exception class '%s' with message:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
|
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Path Src Proyek"
|
|
|
|
#: lazarusidestrconsts.lisprojectunit
|
|
msgid "project unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Path Unir Proyek"
|
|
|
|
#: lazarusidestrconsts.lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojfiles
|
|
msgid "Files:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Konfirmasi penghapusan dependensi"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Hapus dependensi untuk %s?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspprojectinspector
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Inspektor Proyek - %s"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Hapus paket yang diperlukan"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Hapus file %s dari proyek?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
|
msgid "Remove %s items from project?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
|
msgid "Unable to read state file %s of project %s%sError: %s"
|
|
msgstr "Tidak bisa membaca file kondisi %s dari proyek %s%sKesalahan: %s"
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
|
msgid "Unable to write state file for project %s%sError: %s"
|
|
msgstr "Tidak bisa menuliskan file kondisi untuk proyek %s%sKesalahanr: %s"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Selalu membangun (meskipun jika tidak ada yang berubah)"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
|
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojoptserror
|
|
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
|
msgid "Error"
|
|
msgstr "Salah"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Tidak bisas mengubah form otomatis dibuat dalam sumber program.%Silahkan betulkan kesalahan terlebih dahulu."
|
|
|
|
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
|
msgid "Project Source Directory Mark"
|
|
msgstr "Tanda Direktori Sumber Proyek"
|
|
|
|
#: lazarusidestrconsts.lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Nilai untuk prompt"
|
|
|
|
#: lazarusidestrconsts.lisproperties
|
|
msgid "Properties (replace or remove)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprotected
|
|
msgid "Protected"
|
|
msgstr "Protected"
|
|
|
|
#: lazarusidestrconsts.lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr "Metode Protected"
|
|
|
|
#: lazarusidestrconsts.lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr "Metode Public"
|
|
|
|
#: lazarusidestrconsts.lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr "Metode Published"
|
|
|
|
#: lazarusidestrconsts.lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Direktori publikasi proyek"
|
|
|
|
#: lazarusidestrconsts.lispublishproject
|
|
msgid "Publish Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
|
#, fuzzy
|
|
#| msgid "Invalid Exclude filter"
|
|
msgid "Invalid exclude filter"
|
|
msgstr "Filter Exclude tidak benar"
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
|
#, fuzzy
|
|
#| msgid "Invalid Include filter"
|
|
msgid "Invalid include filter"
|
|
msgstr "Filter Include tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
|
msgid "Save .lrs files in the output directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
|
msgid "The resource will be available for FPC."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
|
#, fuzzy
|
|
#| msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Unit pascal harus mempunyai ekstensi .pp atau .pas"
|
|
|
|
#: lazarusidestrconsts.lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr "Edit unit virtual"
|
|
|
|
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
|
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr "Sudah ada unit dengan nama ini.%sFile: %s"
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
|
#, fuzzy
|
|
#| msgid "The unitname is not a valid pascal identifier."
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
|
msgid "The unitname is not a valid Pascal identifier."
|
|
msgstr "Nama unit bukan pengenal pascal yang benar."
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
|
#, fuzzy
|
|
#| msgid "The unitname is used when the IDE extends uses clauses."
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
|
msgid "The unitname is used when the IDE extends uses clauses"
|
|
msgstr "Nama unit digunakan ketika IDE melebarkan klausul uses."
|
|
|
|
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr "Namam unit dan nama file tidak sama.%sContoh: unit1.pas dan Unit1"
|
|
|
|
#: lazarusidestrconsts.lispwconvertproject
|
|
msgid "Convert &Delphi Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwnewproject
|
|
msgid "&New Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwopenproject
|
|
msgid "&Open Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispwopenrecentproject
|
|
#, fuzzy
|
|
#| msgid "Open Recent Project"
|
|
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
|
msgid "Open &Recent Project"
|
|
msgstr "Buka yang Terakhir"
|
|
|
|
#: lazarusidestrconsts.lispwviewexampleprojects
|
|
msgid "View &Example Projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixerror
|
|
msgid "QuickFix error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixes
|
|
msgid "Quick fixes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixremoveunit
|
|
msgid "Quick fix: Remove unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
|
msgid "Search identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquit
|
|
msgctxt "lazarusidestrconsts.lisquit"
|
|
msgid "Quit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquitlazarus
|
|
#, fuzzy
|
|
#| msgid "Quit Lazarus"
|
|
msgid "&Quit Lazarus"
|
|
msgstr "Keluar Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisrange
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisrange"
|
|
msgid "Range"
|
|
msgstr "Jangkauan"
|
|
|
|
#: lazarusidestrconsts.lisreaderror
|
|
msgid "Read Error"
|
|
msgstr "Pembacaan Salah"
|
|
|
|
#: lazarusidestrconsts.lisreallydelete
|
|
msgid "Really delete?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecenttabs
|
|
msgid "Recent tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecord
|
|
msgctxt "lazarusidestrconsts.lisrecord"
|
|
msgid "Record"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecordedmacros
|
|
msgid "Recorded"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrecordstruct
|
|
msgid "Record/Structure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisredo
|
|
msgctxt "lazarusidestrconsts.lisredo"
|
|
msgid "Redo"
|
|
msgstr "Redo"
|
|
|
|
#: lazarusidestrconsts.lisregisters
|
|
msgctxt "lazarusidestrconsts.lisregisters"
|
|
msgid "Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisregularexpression
|
|
msgid "Regular expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrelative
|
|
msgid "Relative"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrelativepaths
|
|
msgid "Relative paths"
|
|
msgstr "Path relatif"
|
|
|
|
#: lazarusidestrconsts.lisremove
|
|
msgctxt "lazarusidestrconsts.lisremove"
|
|
msgid "Remove"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremove2
|
|
msgid "Remove?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Hapus semua properti yang tidak benar"
|
|
|
|
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
|
msgid "Remove all message type filters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveallunits
|
|
msgid "Remove all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
|
msgid "Remove Compiler Option Hide Message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
|
msgid "Remove %s dependencies from package \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovedpropertys
|
|
msgid "Removed property \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefilesfrompackage
|
|
msgid "Remove %s files from package \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefrominstalllist
|
|
msgid "Remove from install list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovefromproject
|
|
#, fuzzy
|
|
#| msgid "Remove from project"
|
|
msgid "Remove from Project"
|
|
msgstr "Hapus dari proyek"
|
|
|
|
#: lazarusidestrconsts.lisremovefromsearchpath
|
|
msgid "Remove from search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveincludepath
|
|
msgid "Remove include path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable
|
|
msgid "Remove local variable %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable3
|
|
msgid "Remove local variable \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovemessagetypefilter
|
|
msgid "Remove Message Type Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovenonexistingfiles
|
|
msgid "Remove nonexistent files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveselectedunits
|
|
msgid "Remove selected units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremovethem
|
|
msgid "Remove them"
|
|
msgstr "Hapus mereka"
|
|
|
|
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
|
msgid "Remove the paths from \"Other sources\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveunitpath
|
|
msgid "Remove unit path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisremoveuses
|
|
msgid "Remove uses \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrename
|
|
msgctxt "lazarusidestrconsts.lisrename"
|
|
msgid "Rename"
|
|
msgstr "Ganti nama"
|
|
|
|
#: lazarusidestrconsts.lisrename2
|
|
msgid "Rename ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Ganti nama file?"
|
|
|
|
#: lazarusidestrconsts.lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Penggantian nama file gagal"
|
|
|
|
#: lazarusidestrconsts.lisrenameshowresult
|
|
msgid "Show list of renamed Identifiers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenameto
|
|
msgid "Rename to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr "Ganti nama ke huruf kecil"
|
|
|
|
#: lazarusidestrconsts.lisreopenproject
|
|
msgid "Reopen project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrepeat
|
|
msgctxt "lazarusidestrconsts.lisrepeat"
|
|
msgid "Repeat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrepeatcount
|
|
msgid "Repeat Count:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplace
|
|
msgctxt "lazarusidestrconsts.lisreplace"
|
|
msgid "Replace"
|
|
msgstr "Ganti"
|
|
|
|
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
|
msgid "Replaced property \"%s\" with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacedtypeswiths
|
|
msgid "Replaced type \"%s\" with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacement
|
|
msgid "Replacement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacementfuncs
|
|
msgid "Replacement functions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacements
|
|
msgid "Replacements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplaceremoveunknown
|
|
msgid "Fix unknown properties and types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacewholeidentifier
|
|
msgid "Replace whole identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr "Penggantian yang dipilih gagal."
|
|
|
|
#: lazarusidestrconsts.lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
|
|
#: lazarusidestrconsts.lisrescan
|
|
msgid "Rescan"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreset
|
|
msgid "Reset"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
|
msgid "Reset all file filters to defaults?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
|
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
|
msgid "Resource name must be unique."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Penyimpanan resource salah"
|
|
|
|
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
|
msgid "Resource type of project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrestart
|
|
msgctxt "lazarusidestrconsts.lisrestart"
|
|
msgid "Restart"
|
|
msgstr "Mulai lagi"
|
|
|
|
#: lazarusidestrconsts.lisresult2
|
|
msgid "Result:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnparameterindexedword
|
|
msgid ""
|
|
"Return parameter-indexed word from the current line preceding cursor position.\n"
|
|
"\n"
|
|
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
|
|
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
|
|
"is always the current macro.\n"
|
|
"\n"
|
|
"Example line:\n"
|
|
"i 0 count-1 forb|\n"
|
|
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
|
"\n"
|
|
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
|
msgid ""
|
|
"Return the list of all values of case variable in front of variable.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithoutExtraIndent // the case list will be generated without extra indentation\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Pengembalian gagal"
|
|
|
|
#: lazarusidestrconsts.lisright
|
|
msgctxt "lazarusidestrconsts.lisright"
|
|
msgid "Right"
|
|
msgstr "Right"
|
|
|
|
#: lazarusidestrconsts.lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Anchor Kanan"
|
|
|
|
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr "Batas spasi Kanan. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dikanan kontrol."
|
|
|
|
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
|
#, fuzzy
|
|
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Ini adalah kontrol terdekat dimana sisi kanan dianchor. Biarkan kosong untuk parent."
|
|
|
|
#: lazarusidestrconsts.lisrightsides
|
|
msgid "Right sides"
|
|
msgstr "Sisi Kanan"
|
|
|
|
#: lazarusidestrconsts.lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr "Kanan spasi secara sama"
|
|
|
|
#: lazarusidestrconsts.lisroot
|
|
msgid "Root"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrootdirectory
|
|
msgid "Root Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrun
|
|
msgctxt "lazarusidestrconsts.lisrun"
|
|
msgid "Run"
|
|
msgstr "Jalankan"
|
|
|
|
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
|
msgid "\"Run and Design time\" packages have no limitations."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunbuttonhint
|
|
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
|
|
msgid "Run"
|
|
msgstr "Jalankan"
|
|
|
|
#: lazarusidestrconsts.lisrunning
|
|
msgid "%s (running ...)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "File bukan eksekutabel"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
|
#, fuzzy,badformat
|
|
#| msgid "The host application %s%s%s is not executable."
|
|
msgid "The host application \"%s\" is not executable."
|
|
msgstr "Aplikasi induk %s%s%s bukan eksekutabel."
|
|
|
|
#: lazarusidestrconsts.lisrunstage
|
|
msgctxt "lazarusidestrconsts.lisrunstage"
|
|
msgid "Run"
|
|
msgstr "Jalankan"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
|
msgid "Runtime only, cannot be installed in IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
|
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
|
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Jalankan-sampai gagal"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract Methods - not yet overridden"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsof
|
|
msgid "Abstract methods of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamselectnone
|
|
msgid "Select none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissave
|
|
#, fuzzy
|
|
#| msgid "Save ..."
|
|
msgctxt "lazarusidestrconsts.lissave"
|
|
msgid "Save"
|
|
msgstr "Simpan ..."
|
|
|
|
#: lazarusidestrconsts.lissaveall
|
|
msgctxt "lazarusidestrconsts.lissaveall"
|
|
msgid "Save All"
|
|
msgstr "Simpan Semua"
|
|
|
|
#: lazarusidestrconsts.lissaveallchecked
|
|
msgid "Save All Checked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveallmodified
|
|
#, fuzzy
|
|
#| msgid "save all modified files"
|
|
msgid "Save all modified files"
|
|
msgstr "simpan semua file yang diubah"
|
|
|
|
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
|
msgid "Save All/Original Messages to File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveandexitdialog
|
|
msgid "Save and exit dialog"
|
|
msgstr "Dialog Simpan dan keluar"
|
|
|
|
#: lazarusidestrconsts.lissaveandrebuildide
|
|
msgid "Save and rebuild IDE"
|
|
msgstr "Simpan dan bangun ulang IDE"
|
|
|
|
#: lazarusidestrconsts.lissaveas
|
|
msgctxt "lazarusidestrconsts.lissaveas"
|
|
msgid "Save As"
|
|
msgstr "Simpan Sebagai"
|
|
|
|
#: lazarusidestrconsts.lissavechangedfiles
|
|
msgid "Save changed files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Simpan perubahan?"
|
|
|
|
#: lazarusidestrconsts.lissavechangestoproject
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Simpan perubahan ke proyek %s?"
|
|
|
|
#: lazarusidestrconsts.lissavecurrenteditorfile
|
|
#, fuzzy
|
|
#| msgid "save current editor file"
|
|
msgid "Save current editor file"
|
|
msgstr "simpan file editor saat ini"
|
|
|
|
#: lazarusidestrconsts.lissavedwithidesettings
|
|
msgid "Saved with IDE settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavedwithprojectsession
|
|
msgid "Saved with project session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
|
msgid "Save editor info of non project files"
|
|
msgstr "Simpan info editor dari file non proyek"
|
|
|
|
#: lazarusidestrconsts.lissavefileas
|
|
msgid "Save file as"
|
|
msgstr "Simpan file sebagai"
|
|
|
|
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
|
#, fuzzy,badformat
|
|
#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
|
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
|
msgstr "Simpan file %s%s%s%ssebelum menutup form %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
|
msgid "Save info of closed editor files"
|
|
msgstr "Simpan info dari file editor yang ditutup"
|
|
|
|
#: lazarusidestrconsts.lissavemacroas
|
|
msgid "Save macro as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavemessages
|
|
msgid "Save messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissaveproject
|
|
msgid "Save project %s (*%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionchangestoproject
|
|
msgid "Save session changes to project %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstate
|
|
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
|
|
msgid "Save fold info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
|
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistory
|
|
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
|
|
msgid "Save jump history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
|
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Simpan Seting"
|
|
|
|
#: lazarusidestrconsts.lissaveshownmessagestofile
|
|
msgid "Save Shown Messages to File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissavespace
|
|
msgid "Save "
|
|
msgstr "Simpan"
|
|
|
|
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
|
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr "Faktor Skala:"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdir
|
|
msgid "Scan files in parent directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
|
msgid "Search for source files in sibling directories (parent directory and its children)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanning
|
|
msgid "Scanning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanning2
|
|
msgid "%s. Scanning ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisscanparentdir
|
|
msgid "Scanning parent directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissearchpaths2
|
|
msgid "Search paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissearchunit
|
|
msgid "Search Unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
|
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
|
msgstr "direktori konfig kedua, dimana Lazarus mencari file template konfig. Default adalah"
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigpath
|
|
msgid "Secondary config path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissecondtest
|
|
msgid "&Second test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Lihat pesan."
|
|
|
|
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr "%sLihat Proyek -> Inspektor Proyek"
|
|
|
|
#: lazarusidestrconsts.lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr "Pilih item panduan:"
|
|
|
|
#: lazarusidestrconsts.lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Pilih node"
|
|
|
|
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
|
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectdfmfiles
|
|
msgid "Select Delphi form files (*.dfm)"
|
|
msgstr "Pilih form Delphi dari file (*.dfm)"
|
|
|
|
#: lazarusidestrconsts.lisselected
|
|
msgctxt "lazarusidestrconsts.lisselected"
|
|
msgid "Selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedaddition
|
|
msgid "Selected addition:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedandchildcontrols
|
|
msgid "Selected and child controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedbottomneighbour
|
|
msgid "(selected bottom neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedcommandsmapping
|
|
msgid "Selected Command's Mapping"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedforinstallation
|
|
msgid "selected for installation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedforuninstallation
|
|
msgid "selected for uninstallation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedleftneighbour
|
|
msgid "(selected left neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
|
msgid "Selected message in messages window:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedmodeswerebuilt
|
|
msgid "Selected %d modes were successfully built."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedrightneighbour
|
|
msgid "(selected right neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectedtopneighbour
|
|
msgid "(selected top neighbour)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectfile
|
|
msgid "Select the file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
|
msgid "Select FPC source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectframe
|
|
msgid "Select Frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Pilihan melebih konstan string"
|
|
|
|
#: lazarusidestrconsts.lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Piranti pemilihan"
|
|
|
|
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
|
msgid "Select Lazarus source directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectpathto
|
|
msgid "Select path to %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselecttargetdirectory
|
|
msgid "Select target directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetallcolors
|
|
msgid "Set all colors:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetdefault
|
|
msgid "Set default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
|
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissetupdefaultindentation
|
|
msgid "(Set up default indentation)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshort
|
|
msgid "Short:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshortnopath
|
|
msgid "Short, no path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
|
msgid "Should the component \"%s\" be auto created when the application starts?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshow
|
|
msgid "Show"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowabstractmethodsof
|
|
msgid "Show abstract methods of \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
|
msgid "Show component tree"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowconsole
|
|
msgid "Show console"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowdeclarationhints
|
|
msgid "Show declaration hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
|
msgid "Show differences between modes ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowemptyunitspackages
|
|
msgid "Show empty units/packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
|
msgid "Show FPC message \"lines compiled\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowglyphsfor
|
|
msgid "Show Glyphs for"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
|
msgid "Show gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowhelp
|
|
msgid "Show help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
|
msgid "Show hints"
|
|
msgstr "Tampilkan petunjuk dalam Inspektor Objek"
|
|
|
|
#: lazarusidestrconsts.lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr "Tampilkan pengenal"
|
|
|
|
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
|
msgid "Show information box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowmessagetypeid
|
|
msgid "Show Message Type ID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowonlymodified
|
|
msgid "Show only modified"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
|
msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoutput
|
|
msgid "Show output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoverviewgutter
|
|
msgid "Show overview Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Tampilkan paket"
|
|
|
|
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
|
msgid "Show position of source editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
|
msgid "Show recently used identifiers at top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrelativepaths
|
|
msgid "Show relative paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
|
msgid "Shows all controls in tree hierarchy."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
|
msgid "A box at the bottom shows description for the selected property."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
|
msgid "Show setup dialog for most important settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
|
msgid "Show statusbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunits
|
|
msgid "Show units"
|
|
msgstr "Tampilkan unit"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitialization
|
|
msgid "Show units with initialization/finalization sections"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
|
msgid "These units may initialize global data used by the program/application. Remove with care."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowunusedunits
|
|
msgid "Show unused units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
|
msgid "Show value hints while debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowversionandexit
|
|
msgid "show version and exit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissibling
|
|
msgid "Sibling"
|
|
msgstr "Terdekat"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogram
|
|
msgid "Simple Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
|
msgid "A most simple Free Pascal command line program."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissimplesyntax
|
|
#, fuzzy
|
|
#| msgid "Simple Syntax"
|
|
msgid "Simple syntax"
|
|
msgstr "Sintaks Sederhana"
|
|
|
|
#: lazarusidestrconsts.lisskiperrors
|
|
msgid "Skip errors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskipfile
|
|
msgid "Skip file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr "Lewati file dan lanjutkan pengambilan"
|
|
|
|
#: lazarusidestrconsts.lisskiploadinglastproject
|
|
msgid "Skip loading last project"
|
|
msgstr "Lewati pengambilan proyek terakhir"
|
|
|
|
#: lazarusidestrconsts.lisskipthesewarnings
|
|
msgid "Skip these warnings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
|
msgid "Slower but more accurate."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissmallerratherthanfaster
|
|
msgid "Smaller rather than faster"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissmatches
|
|
msgid "Matches"
|
|
msgstr "Sama"
|
|
|
|
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Maaf, tipe ini belum diimplementasikan"
|
|
|
|
#: lazarusidestrconsts.lissortforscope
|
|
msgid "Sort for scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissorting
|
|
msgid "Sorting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Membesar"
|
|
|
|
#: lazarusidestrconsts.lissortselcasesensitive
|
|
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Mengecil"
|
|
|
|
#: lazarusidestrconsts.lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Domain"
|
|
|
|
#: lazarusidestrconsts.lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Abaikan Spasi"
|
|
|
|
#: lazarusidestrconsts.lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Baris"
|
|
|
|
#: lazarusidestrconsts.lissortseloptions
|
|
msgctxt "lazarusidestrconsts.lissortseloptions"
|
|
msgid "Options"
|
|
msgstr "Opsi"
|
|
|
|
#: lazarusidestrconsts.lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Paragraf"
|
|
|
|
#: lazarusidestrconsts.lissortselpreview
|
|
msgctxt "lazarusidestrconsts.lissortselpreview"
|
|
msgid "Preview"
|
|
msgstr "Peninjauan"
|
|
|
|
#: lazarusidestrconsts.lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Terima"
|
|
|
|
#: lazarusidestrconsts.lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Urut pilihan"
|
|
|
|
#: lazarusidestrconsts.lissortselwords
|
|
msgctxt "lazarusidestrconsts.lissortselwords"
|
|
msgid "Words"
|
|
msgstr "Kata"
|
|
|
|
#: lazarusidestrconsts.lissortunicoderangelistalphabetically
|
|
msgid "Sort Unicode range list alphabetically"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
|
msgid "Source and Destination are the same:%s%s"
|
|
msgstr "Sumber dan Tujuan adalah sama:%s%s"
|
|
|
|
#: lazarusidestrconsts.lissourcebreakpoint
|
|
msgid "&Source Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
|
msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
|
#, fuzzy,badformat
|
|
#| msgid "Source directory %s%s%s does not exist."
|
|
msgid "Source directory \"%s\" does not exist."
|
|
msgstr "Direktori sumber %s%s%s tidak ada."
|
|
|
|
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
|
msgid "Source Editor Window Manager"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Sumber dimodifikasi"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
|
#, fuzzy,badformat
|
|
#| msgid "Source of page %s%s%s has changed. Save?"
|
|
msgid "Source of page \"%s\" has changed. Save?"
|
|
msgstr "Sumber dari halaman %s%s%s sudah diubah. Simpan?"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
|
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Path sumber"
|
|
|
|
#: lazarusidestrconsts.lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Spasi secara sama"
|
|
|
|
#: lazarusidestrconsts.lissrcos
|
|
msgid "Src OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisssearching
|
|
msgid "Searching"
|
|
msgstr "Pencarian"
|
|
|
|
#: lazarusidestrconsts.lisssearchtext
|
|
msgid "Search text"
|
|
msgstr "Cari teks"
|
|
|
|
#: lazarusidestrconsts.lisstartconversion
|
|
msgid "Start Conversion"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstartide
|
|
msgid "Start IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr "Mulai dengan proyek baru"
|
|
|
|
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
|
msgid "Statusbar shows the property's name and the class where it is published."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstop
|
|
msgctxt "lazarusidestrconsts.lisstop"
|
|
msgid "Stop"
|
|
msgstr "Hentikan"
|
|
|
|
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Hentikan debugging saat ini dan bangun ulang proyek?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Hentikan Debugging?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Hentikan debugging?"
|
|
|
|
#: lazarusidestrconsts.lisstoponexception
|
|
msgid "Stop on exception"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Hentikan debugging?"
|
|
|
|
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
|
msgid "Store path delimiters \\ and / as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstrangelpifile
|
|
msgid "Strange lpi file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Pengaliran salah"
|
|
|
|
#: lazarusidestrconsts.lisstring
|
|
msgid "String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisstyle
|
|
msgctxt "lazarusidestrconsts.lisstyle"
|
|
msgid "Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr "Sub Prosedur"
|
|
|
|
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr "Sub Prosedur pada tingkat yang sama"
|
|
|
|
#: lazarusidestrconsts.lissuccess
|
|
msgid "Success"
|
|
msgstr "Sukses"
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexported
|
|
msgid "Successfully exported to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
|
msgid "Successfully exported %d BuildModes to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
|
msgid "Successfully exported compiler options to \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimported
|
|
msgid "Successfully imported from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
|
msgid "Successfully imported %d BuildModes from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
|
msgid "Successfully imported compiler options from \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
|
msgid "Suggest default name of new file in lowercase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuspiciousincludepath
|
|
msgid "Suspicious include path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuspiciousunitpath
|
|
msgid "Suspicious unit path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissvnrevision
|
|
msgid "SVN Revision: "
|
|
msgstr "Revisi SVN:"
|
|
|
|
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Nama variabel tidak benar"
|
|
|
|
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
|
#, fuzzy,badformat
|
|
#| msgid "%s%s%s is not a valid identifier."
|
|
msgid "\"%s\" is not a valid identifier."
|
|
msgstr "%s%s%s bukan pengenal yang benar."
|
|
|
|
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Timpa variabel sistem"
|
|
|
|
#: lazarusidestrconsts.lisswitchfiltersettings
|
|
msgid "Switch Filter Settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
|
msgid "Switch to Favorites tab after asking for component name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
|
msgid "system.ppu not found. Check your fpc.cfg."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listab
|
|
msgid "Tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts.listaborderconfirmsort
|
|
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderdownhint
|
|
msgid "Move the selected control down in tab order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderof
|
|
#, fuzzy,badformat
|
|
#| msgid "Tab Order of"
|
|
msgid "Tab Order of %s"
|
|
msgstr "Urutan Tab dari"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursionhint
|
|
msgid "Calculate tab order recursively for child controls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderrecursively
|
|
msgid "recursively"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listabordersorthint
|
|
msgid "Calculate tab order for controls by their X- and Y- positions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderuphint
|
|
msgid "Move the selected control up in tab order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listabsfor
|
|
msgid "Tabs for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listakesnapshot
|
|
msgid "Take a Snapshot"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listarget
|
|
msgid "Target:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listarget2
|
|
msgid ", Target: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Target CPU"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
|
msgid "Target file name: (-o, empty = use unit output directory)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetfilenameo
|
|
msgid "Target file name (-o):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Nama file target dari proyek"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetisreadonly
|
|
msgid "Target is read only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listargetos
|
|
msgctxt "lazarusidestrconsts.listargetos"
|
|
msgid "Target OS"
|
|
msgstr "Target OS"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcell
|
|
msgid "Editable Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
|
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplatefile
|
|
msgid "Template file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Direktori Tes"
|
|
|
|
#: lazarusidestrconsts.listesturl
|
|
msgid "Test URL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
|
msgid "The Application Bundle was created for \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
#, fuzzy,badformat
|
|
#| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgstr "Class %s%s%s adalah TControl dan tidak bisa di-paste ke dalam non kontrol.%sTidak mem-paste."
|
|
|
|
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
|
msgid "The Codetools found an error:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
|
#, fuzzy,badformat
|
|
#| msgid "The command after %s%s%s is not executable."
|
|
msgid "The command after \"%s\" is not executable."
|
|
msgstr "Perintah seteleh %s%s%s bukan eksekutabel."
|
|
|
|
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
|
#, fuzzy,badformat
|
|
#| msgid "The command after publishing is invalid:%s%s%s%s"
|
|
msgid "The command after publishing is invalid:%s\"%s\""
|
|
msgstr "Perintah setelah publikasi tidak benar:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
|
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
msgid "The component %s can not be deleted, because it is not owned by %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
|
#, fuzzy,badformat
|
|
#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
|
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
|
msgstr "Editor komponen dari class%s%s%s%sditemukan dengan verb #%s %s%s%s%stelah menghasilkan kesalahan:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
|
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
|
msgid "The configuration will be downgraded/converted."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
|
msgid "The %s contains a nonexistent directory:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
|
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
|
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
#, fuzzy,badformat
|
|
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
|
|
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
|
msgstr "Debugger %s%s%s%stidak ada atau bukan yang bisa dijalankan.%s%sLihat Lingkungan -> Opsi Debugger"
|
|
|
|
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
|
|
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
|
msgid "The default mode must be stored in project, not in session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
|
#, fuzzy,badformat
|
|
#| msgid "The destination directory%s%s%s%s does not exist."
|
|
msgid "The destination directory%s\"%s\" does not exist."
|
|
msgstr "Direktori tujuan %s%s%s%s tidak ada."
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
|
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
|
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
|
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
|
#, fuzzy,badformat
|
|
#| msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
|
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
|
msgstr "Direktori %s%s%s tidak dibutuhkan lagi dalam path unit.%sHapus?"
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
|
msgid "The directory \"%s\" is not writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
|
#, fuzzy,badformat
|
|
#| msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
|
msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?"
|
|
msgstr "Direktori %s%s%s belum ada dalam path unit.%sTambahkan?"
|
|
|
|
#: lazarusidestrconsts.listhedirectorywasnotfound
|
|
msgid "The directory %s was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefile
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s"
|
|
msgid "The file \"%s\""
|
|
msgstr "File %s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
|
msgid "The file %s does not look like a lpi file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
|
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
|
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
|
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisinvalid
|
|
msgid "The file mask \"%s\" is invalid."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
|
msgid "The file mask \"%s\" is not a valid regular expression."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr "File %s%s%s%ssepertinya sebuah program. Tutup proyek sekarang dan buat proyek Lazarus baru untuk program ini?%s\"Tidak\" akan mengambil file sebagai sumber normal."
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
#, fuzzy
|
|
#| msgid "The file %s seems to be the program file of an existing lazarus Project."
|
|
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
|
msgstr "File %s nampaknya file program dari Proyek Lazarus yang sudah ada."
|
|
|
|
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
|
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
|
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
|
msgstr "File %s%s%s%stidak ditemukan.%sAnda ingin mencarinya sendiri?%s"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
#, fuzzy,badformat
|
|
#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "File %s%s%s%stidak ditemukan. %sMengabaikan akan tetap mengambil proyek, %sMembatalkan akan menghentikan pengambilan."
|
|
|
|
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
#, fuzzy,badformat
|
|
#| msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
|
msgstr "Method berikut digunakan oleh %s tidak dalam sumber%s%s%s%s%s%sHapus referensi dangling?"
|
|
|
|
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
|
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
|
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheideisstillbuilding
|
|
msgid "The IDE is still building."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
|
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
#, fuzzy,badformat
|
|
#| msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
|
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
|
msgstr "Menjalankan aplikasi %s%s%s%stidak ada atau bukan yang bisa dijalankan.%s%sLihat Jalankan -> Parameter menjalankan -> Lokal"
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
|
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
|
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
#, fuzzy
|
|
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
|
msgstr "File LFM (form Lazarus) berisi properti tidak benar. Ini berarti sebagai contoh berisi beberapa properti/kelas, yang tidak ada dalam LCL saat ini. Pembetulan normal adalah menghapus properti ini dari lfm dan membetulkan kode pascal secara manual."
|
|
|
|
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
|
msgid "The macro \"%s\" does not begin with \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
|
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
|
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
|
msgid "The old configuration will be upgraded."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
|
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
|
msgid "The output directory \"%s\" is missing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheownerclasshasthisname
|
|
msgid "The owner class has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheownerhasthisname
|
|
msgid "The owner has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
|
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
|
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
|
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
|
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
|
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
|
msgid "The package %s is already in the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
|
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
|
msgid "The path of \"make\" is not correct: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
#, fuzzy,badformat
|
|
#| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
|
|
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
|
msgstr "Program %smake%stidak ditemukan.%sPiranti ini diperlukan untuk membangun lazarus.%s"
|
|
|
|
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
|
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
|
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
|
msgid "The project has no main source file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
|
#, fuzzy,badformat
|
|
#| msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
|
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
|
msgstr "File info proyek %s%s%s%ssama dengan file sumber utama proyek!"
|
|
|
|
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
|
msgid "The project information file \"%s\"%shas changed on disk."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
#, fuzzy
|
|
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Proyek harus disimpan sebelum pembangunan%sJika anda menset Direktori Test dalam opsi lingkungan,%sanda bisa membuat proyek baru dan membangunnya sekaligus.%sSimpan proyek?"
|
|
|
|
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
|
|
msgid "The project uses FPC resources, which require at least FPC 2.4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
|
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
|
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
|
msgid "%sThere are additional notes for this message on%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listherearenoconflictingkeys
|
|
msgid "There are no conflicting keys."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "Ada file lain dalam direktori dengan nama yang sama, %syang beda hanya jenis hurufnya:%s%s%sHapus dulu?"
|
|
|
|
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
|
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
|
msgstr "Ada file dengan nama sama dan ekstensi mirip pada disk%File: %s%s%sHapus file dwimakna?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
|
msgid "There is already a build mode with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
|
msgid "There is already a component class with the name %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
|
msgid "There is already a component with this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafilein
|
|
msgid "There is already a file%s%s%sin %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
|
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already a form with the name %s%s%s"
|
|
msgid "There is already a form with the name \"%s\""
|
|
msgstr "Sudah ada form dengan nama %s%s%s"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
|
msgid "There is already a macro with the name \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
|
msgid "There is already an IDE macro with the name \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
|
msgid "There is already a package %s in the list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
|
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
#, fuzzy,badformat
|
|
#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
|
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Sudah ada unit dengan nama%s%s%s. Pengenal Pascal harus unik."
|
|
|
|
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
|
#, fuzzy,badformat
|
|
#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
|
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
|
msgstr "Ada unit dengan nama %s%s%s dalam proyek.%sSilahkan pilih nama yang berbeda"
|
|
|
|
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
|
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
|
msgid "There must be at least one build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
|
#, fuzzy,badformat
|
|
#| msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
|
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
|
msgstr "Resource class %s%s%s turunan dari %s%s%s. Mungkin ini salah ketik untuk TForm."
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr "Ada kesalahan selama penulisan komponen yang dipilih %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr "Ada kesalahan ketika pengubahan stream biner dari komponen yang dipilih %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr "Ada kesalahan ketikda meng-copy stream komponen ke clipboard:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
|
#, fuzzy
|
|
#| msgid "The root component can not be deleted."
|
|
msgid "The root component cannot be deleted."
|
|
msgstr "Komponen teratas tidak bisa dihapus."
|
|
|
|
#: lazarusidestrconsts.listhesefileswillbedeleted
|
|
msgid "These files will be deleted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
|
msgid "These settings are stored with the project."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheseunitswerenotfound
|
|
msgid "These units were not found:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
|
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetargetisnotwritable
|
|
msgid "The target %s is not writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
|
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitalreadyexists
|
|
msgid "The unit \"%s\" already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitbelongstopackage
|
|
msgid "The unit belongs to package %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunithasthisname
|
|
msgid "The unit has this name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
|
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
|
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
|
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
|
#, fuzzy,badformat
|
|
#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
|
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Unit sendiri sudah mempunyai nama %s%s%s. Pengenal Pascal harus unik."
|
|
|
|
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
|
msgid "This component already contains a class with the name %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
|
msgid "This function needs an open .lfm file in the source editor."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhishelpmessage
|
|
msgid "this help message"
|
|
msgstr "pesan panduan ini"
|
|
|
|
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
|
msgid "This is a test project for a design time package, testing it outside the IDE."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
#, fuzzy
|
|
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr "Ini sepertinya file pascal. %s direkomendasikan untuk menggunakan nama file dengan huruf kecil, untuk menghindari berbagai masalah pada beberapa filesystems dan kompilator berbeda. %sGanti nama ke huruf kecil?"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
|
msgid "This project has no main source file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
|
msgid "This project has only the default build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
|
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr "Pernyataan ini tidak bisa diekstrak.%sSilahkan pilih beberapa kode untuk mengekstrak procedure/method baru."
|
|
|
|
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
|
msgid "This will allow changing all build modes at once. Not implemented yet."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
|
msgid "This will create a circular dependency."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
|
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreads
|
|
msgctxt "lazarusidestrconsts.listhreads"
|
|
msgid "Threads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadscurrent
|
|
msgctxt "lazarusidestrconsts.listhreadscurrent"
|
|
msgid "Current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadsfunc
|
|
msgctxt "lazarusidestrconsts.listhreadsfunc"
|
|
msgid "Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadsgoto
|
|
msgid "Goto"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadsline
|
|
msgctxt "lazarusidestrconsts.listhreadsline"
|
|
msgid "Line"
|
|
msgstr "Baris"
|
|
|
|
#: lazarusidestrconsts.listhreadsnotevaluated
|
|
msgid "Threads not evaluated"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadssrc
|
|
msgctxt "lazarusidestrconsts.listhreadssrc"
|
|
msgid "Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhreadsstate
|
|
msgctxt "lazarusidestrconsts.listhreadsstate"
|
|
msgid "State"
|
|
msgstr "Kondisi"
|
|
|
|
#: lazarusidestrconsts.listitle
|
|
msgid "&Title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
|
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listitleopencomponenticon24x24
|
|
msgid "Choose a component icon 24x24"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
|
msgid "Function: append path delimiter"
|
|
msgstr "Fungsi: tambah delimiter path"
|
|
|
|
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
|
#, fuzzy
|
|
#| msgid "Function: chomp path delimiter"
|
|
msgid "Function: remove trailing path delimiter"
|
|
msgstr "Fungsi: chomp delimiter path"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfileextension
|
|
msgid "Function: extract file extension"
|
|
msgstr "Fungsi: ekstrak ekstensi file"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
|
msgid "Function: extract file name+extension"
|
|
msgstr "Fungsi: ekstrak nama+ekstensi file"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
|
msgid "Function: extract file name only"
|
|
msgstr "Fungsi: ekstrak hanya nama file"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilepath
|
|
msgid "Function: extract file path"
|
|
msgstr "Fungsi: ekstrak path file"
|
|
|
|
#: lazarusidestrconsts.listmunknownmacro
|
|
msgid "(unknown macro: %s)"
|
|
msgstr "(makro tidak dikenal: %s)"
|
|
|
|
#: lazarusidestrconsts.listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Path:"
|
|
|
|
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
|
msgid "Toggle showing filenames with full path or with relative path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbarconfiguration
|
|
msgid "Toolbar Configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptions
|
|
msgid "Toolbar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptionshighlight
|
|
msgid "Highlight toolbars buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolbaroptionsraise
|
|
msgid "Raise toolbars"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolhasnoexecutable
|
|
msgid "tool \"%s\" has no executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderfailed
|
|
msgid "Tool Header: Failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderrunning
|
|
msgid "Tool Header: Running"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheaderscrolledup
|
|
msgid "Tool Header: Scrolled up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolheadersuccess
|
|
msgid "Tool Header: Success"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
|
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listop
|
|
msgctxt "lazarusidestrconsts.listop"
|
|
msgid "Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Anchor Atas"
|
|
|
|
#: lazarusidestrconsts.listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr "Batas spasi Atas. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi diatas kontrol."
|
|
|
|
#: lazarusidestrconsts.listopinfoview
|
|
msgid "Show Class/Proc Hint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listops
|
|
msgid "Tops"
|
|
msgstr "Atas"
|
|
|
|
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
|
#, fuzzy
|
|
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Ini adalah kontrol terdekat dimana sisi atas dianchor. Biarkan kosong untuk parent."
|
|
|
|
#: lazarusidestrconsts.listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr "Spasi Atas secara sama"
|
|
|
|
#: lazarusidestrconsts.listotalpages
|
|
msgid "Total Pages: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listranslatetheenglishmessages
|
|
msgid "Translate the English Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listreeneedsrefresh
|
|
msgid "Tree needs refresh"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
|
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listypes
|
|
msgid "Types (not removed if no replacement)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudadditionaldirectories
|
|
msgid "Additional directories:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallpackageunits
|
|
msgid "All package units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallsourceeditorunits
|
|
msgid "All source editor units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudallunits
|
|
msgid "All units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
|
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudcollapseallnodes
|
|
msgid "Collapse all nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudexpandallnodes
|
|
msgid "Expand all nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudfile
|
|
msgid "File: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudfilter
|
|
msgid "(Filter)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses
|
|
msgid "Implementation Uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses2
|
|
msgid "implementation uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses
|
|
msgid "Interface Uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses2
|
|
msgid "interface uses: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudprojectsandpackages
|
|
msgid "Projects and packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudscanning
|
|
msgid "Scanning ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudscanningunits
|
|
msgid "Scanning: %s units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearch
|
|
msgid "(Search)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
|
msgid "Find next occurrence of this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
|
msgid "Find next unit with this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
|
msgid "Find previous occurrence of this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
|
msgid "Find previous unit with this phrase"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudselectedunits
|
|
msgid "Selected units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudshownodesfordirectories
|
|
msgid "Show nodes for directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
|
msgid "Show nodes for project and packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudunits
|
|
msgid "Units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudunits2
|
|
msgid "Units: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations
|
|
msgid "Used by Implementations: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations2
|
|
msgid "used by implementations: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces
|
|
msgid "Used by Interfaces: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
|
msgid "used by interfaces: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Jangan tampilkan pesan ini lagi."
|
|
|
|
#: lazarusidestrconsts.lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Kesalahan dalam ekspresi reguler"
|
|
|
|
#: lazarusidestrconsts.lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Font tanpa UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisuegotoline
|
|
#, fuzzy
|
|
#| msgid "Goto line :"
|
|
msgid "Goto line:"
|
|
msgstr "Pergi ke baris :"
|
|
|
|
#: lazarusidestrconsts.lisuemodeseparator
|
|
msgid "/"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Tidak ditemukan"
|
|
|
|
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
|
#, fuzzy,badformat
|
|
#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
|
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
|
msgstr "Ganti %s%s%s%s yang ditemukan ini dengan %s%s%s?"
|
|
|
|
#: lazarusidestrconsts.lisuesearching
|
|
msgid "Searching: %s"
|
|
msgstr "Pencarian: %s"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
|
msgid "Continue search from the beginning?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
|
msgid "Continue search from the end?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringnotfound
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Pencarian string '%s' tidak ditemukan!"
|
|
|
|
#: lazarusidestrconsts.lisuethecurre
|
|
#, fuzzy
|
|
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
|
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
|
msgstr "Font editor saat ini tidak mendukung UTF-8, tetapi sistem anda nampak menggunakannya. %sItu berarti karakter non ASCII mungkin akan ditampilk tidak benar. %sAnda bisa memilih font lain dalam opsi editor."
|
|
|
|
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr "Bersihkan cache include"
|
|
|
|
#: lazarusidestrconsts.lisuidbytes
|
|
msgid "%s bytes"
|
|
msgstr "%s byte"
|
|
|
|
#: lazarusidestrconsts.lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Disertakan oleh:"
|
|
|
|
#: lazarusidestrconsts.lisuidinproject
|
|
#, fuzzy
|
|
#| msgid "in Project:"
|
|
msgid "In project:"
|
|
msgstr "dalam Proyek:"
|
|
|
|
#: lazarusidestrconsts.lisuidlines
|
|
msgctxt "lazarusidestrconsts.lisuidlines"
|
|
msgid "Lines:"
|
|
msgstr "Baris:"
|
|
|
|
#: lazarusidestrconsts.lisuidname
|
|
msgctxt "lazarusidestrconsts.lisuidname"
|
|
msgid "Name:"
|
|
msgstr "Nama:"
|
|
|
|
#: lazarusidestrconsts.lisuidno
|
|
msgid "no"
|
|
msgstr "tidak"
|
|
|
|
#: lazarusidestrconsts.lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Ukuran:"
|
|
|
|
#: lazarusidestrconsts.lisuidtype
|
|
msgid "Type:"
|
|
msgstr "TipeL"
|
|
|
|
#: lazarusidestrconsts.lisuidyes
|
|
msgid "yes"
|
|
msgstr "ya"
|
|
|
|
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Tampilkan Nilai CodeTools"
|
|
|
|
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr "Tidak bisas mengubah stream biner ke teks"
|
|
|
|
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr "Tidak bisa meng-copy komponen ke clipboard"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Tidak bisa menambah komentar header resource ke file resource %s%s%s%s.%sKemungkinan salah sintaks"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Tidak bisa menambah resource T%s:FORMDATA ke file resource %s%s%s%s.%sKemungkinan salah sintaks."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
|
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
|
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
|
msgstr "Tidak bisa menambah %s ke proyek, karena sudah ada unit dengan nama yang sama dalam Proyek."
|
|
|
|
#: lazarusidestrconsts.lisunabletobackupfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to backup file %s%s%s to %s%s%s!"
|
|
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
|
msgstr "Tidak bisa mem-backup file %s%s%s to %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeclassofto
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr "%s%sTidak bisa mengubah kelas dari %s ke %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
|
|
msgid "Unable to change project scaled in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
|
msgid "Unable to change project title in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Tidak bisa membersihkan direktori tujuan"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
|
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
|
msgstr "Tidak bisa membersihkan %s%s%s.%sSilahkan periksa perijinan."
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr "Tidak bisa mengkonversi teks komponen ke dalam format biner:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to convert file %s%s%s%sError: %s"
|
|
msgid "Unable to convert file \"%s\"%sError: %s"
|
|
msgstr "Tidak bisa mengubah file %s%s%s%sKesalahan: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
|
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
|
msgstr "Tidak bisa mengubah data form teks dari file %s%s%s%s%skedalam aliran biner. (%s)"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
|
msgid "Unable to convert to encoding \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfile
|
|
msgid "Unable to copy file"
|
|
msgstr "Tidak bisa meng-copy file"
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
|
msgid "Unable to copy file \"%s\"%sto \"%s\""
|
|
msgstr "Tidak bisa meng- copy file %s%s%s%sto %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create backup directory %s%s%s."
|
|
msgid "Unable to create backup directory \"%s\"."
|
|
msgstr "Tidak bisa membuat direktori backup %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatedirectory
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create directory %s%s%s."
|
|
msgid "Unable to create directory \"%s\"."
|
|
msgstr "Tidak bisa membuat direktori %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile
|
|
msgid "Unable to create file"
|
|
msgstr "Tidak bisa membuat file"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to create file %s%s%s"
|
|
msgid "Unable to create file \"%s\""
|
|
msgstr "Tidak bisa membuat file %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile3
|
|
msgid "Unable to create file%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
|
msgid "Unable to create link \"%s\" with target \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
|
msgid "Unable to create new file, because there is already a directory with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
|
msgid "Unable to create new method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr "Tidak bisa membuat bufer lfm sementara."
|
|
|
|
#: lazarusidestrconsts.lisunabletodelete
|
|
msgid "Unable to delete"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to delete ambiguous file %s%s%s"
|
|
msgid "Unable to delete ambiguous file \"%s\""
|
|
msgstr "Tidak bisa menghapus file dwimakna %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoexecute
|
|
msgid "unable to execute: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to find a valid classname in %s%s%s"
|
|
msgid "Unable to find a valid classname in \"%s\""
|
|
msgstr "Tidak menemukan nama class yang benar dalam %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to find file %s%s%s."
|
|
msgid "Unable to find file \"%s\"."
|
|
msgstr "Tidak bisa menemukan file %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr "Tidak bisa menemukan %s dalam LFM Stream."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindmethod
|
|
msgid "Unable to find method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
|
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
|
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr "Tidak bisa mengumpulkan perubahan editor."
|
|
|
|
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr "Tidak bisa mendapatkan sumber untuk desainer."
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadfile2
|
|
msgid "unable to load file %s: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadpackage
|
|
msgid "Unable to load package \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
|
msgid "Unable to load the component class \"%s\", because it depends on itself."
|
|
msgstr "Tidak bisa mengambil kelas komponen %s%s%s, karena ia tergantung pada dirinya sendiri."
|
|
|
|
#: lazarusidestrconsts.lisunabletoopen
|
|
msgid "Unable to open \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr "Tidak bisa membuka desainer.%sKelas %s bukan turunan dari kelas bisa didesain seperti TForm atau TDataModule."
|
|
|
|
#: lazarusidestrconsts.lisunabletoread
|
|
msgid "Unable to read %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile
|
|
msgid "Unable to read file"
|
|
msgstr "Tidak bisa membaca file"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read file %s%s%s!"
|
|
msgid "Unable to read file \"%s\"."
|
|
msgstr "Tidak bisa membaca file %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to read file %s%s%s%sError: %s"
|
|
msgid "Unable to read file \"%s\"%sError: %s"
|
|
msgstr "Tidak bisa membaca file %s%s%s%sKesalahan: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadlpi
|
|
msgid "Unable to read lpi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
|
msgid "unable to read process ExitStatus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
|
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
|
msgid "Unable to read the project info file%s\"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to remove old backup file %s%s%s!"
|
|
msgid "Unable to remove old backup file \"%s\"!"
|
|
msgstr "Tidak bisa menghapus file backup lama %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
|
|
msgid "Unable to remove project scaled from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
|
msgid "Unable to remove project title from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
|
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
|
msgstr "Tidak bisa mengganti nama file dwimakna %s%s%s%ske %s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefile
|
|
msgid "Unable to rename file"
|
|
msgstr "Tidak bisa mengganti nama file"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename file %s%s%s to %s%s%s!"
|
|
msgid "Unable to rename file \"%s\" to \"%s\"!"
|
|
msgstr "Tidak bisa mengganti nama file %s%s%s to %s%s%s!"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto2
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
|
msgid "Unable to rename file \"%s\"%sto \"%s\"."
|
|
msgstr "Tidak bisa mengganti nama file %s%s%s%sto %s%s%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Tidak bisa mengganti nama form dalam sumber."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Tidak bisa mengganti nama metode. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Tidak bisa mengganti nama variabel dalam sumber."
|
|
|
|
#: lazarusidestrconsts.lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletorun2
|
|
msgid "Unable to run \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr "Tidak bisa men-set Kontrol AnchorSide"
|
|
|
|
#: lazarusidestrconsts.lisunabletoshowmethod
|
|
msgid "Unable to show method."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr "Tidak bisas menyalurkan komponen yang dipilih"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr "Tidak bisa mengalirkan komponen yang dipilih."
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamt
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "Tidak bisa mengalirkan %s:T%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "Tidak bisa mentransformasi aliran komponen biner %s:T%s ke dalam teks"
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "Tidak bisa memutakhirkan pernyataan CreateForm dalam sumber proyek"
|
|
|
|
#: lazarusidestrconsts.lisunabletowrite2
|
|
msgid "Unable to write \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile
|
|
msgid "Unable to write file"
|
|
msgstr "Tidak bisa menuliskan file"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile2
|
|
msgid "Unable to write file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefileerror
|
|
#, fuzzy,badformat
|
|
#| msgid "Unable to write file %s%s%s%sError: %s"
|
|
msgid "Unable to write file \"%s\"%sError: %s"
|
|
msgstr "Tidak bisa menulis file %s%s%s%sKesalahan: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
|
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
|
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetofile2
|
|
msgid "Unable to write to file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
|
msgid "Unable to write xml stream to %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuncheckall
|
|
msgid "Uncheck All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisundo
|
|
msgctxt "lazarusidestrconsts.lisundo"
|
|
msgid "Undo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstall
|
|
msgid "Uninstall %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallimpossible
|
|
msgid "Uninstall impossible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "Deinstalasi pilihan"
|
|
|
|
#: lazarusidestrconsts.lisunit
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisunit"
|
|
msgid "Unit"
|
|
msgstr "Unit"
|
|
|
|
#: lazarusidestrconsts.lisunithaschangedsave
|
|
msgid "Unit \"%s\" has changed. Save?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Pengenal unit sudah ada"
|
|
|
|
#: lazarusidestrconsts.lisunitinpackage
|
|
msgid "%s unit %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Nama unit sudah ada dalam proyek"
|
|
|
|
#: lazarusidestrconsts.lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr "Nama unit dimulai dengan ..."
|
|
|
|
#: lazarusidestrconsts.lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr "Nama unit berisi ..."
|
|
|
|
#: lazarusidestrconsts.lisunitnotfound
|
|
msgid "unit %s not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
|
msgid "unit %s not found at new position \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundinproject
|
|
msgid "A unit not found in project %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr "Direktori Output Unit"
|
|
|
|
#: lazarusidestrconsts.lisunitpath
|
|
msgid "unit path"
|
|
msgstr "path unit"
|
|
|
|
#: lazarusidestrconsts.lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Path Unit"
|
|
|
|
#: lazarusidestrconsts.lisunitrequirespackage
|
|
msgid "unit %s requires package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitsnotfoundinproject
|
|
msgid "Units not found in project %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunsigned
|
|
msgid "Unsigned"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusedunitsof
|
|
msgid "Unused units of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
|
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
|
|
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisup
|
|
msgctxt "lazarusidestrconsts.lisup"
|
|
msgid "Up"
|
|
msgstr "Naik"
|
|
|
|
#: lazarusidestrconsts.lisupdateinfo
|
|
msgid "Update info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
|
msgid "Update other procedure signatures when only letter case has changed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatereferences
|
|
msgid "Update references?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
|
|
msgid "Updating PO files failed for package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgrade
|
|
msgid "Upgrade"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupgradeconfiguration
|
|
msgid "Upgrade configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuppercasestring
|
|
msgid "uppercase string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
|
msgid "Uppercase string given as parameter."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
|
msgid "URL on wiki (the base url is %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusagemessagehoption
|
|
msgid "Usage message (-h option)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuse
|
|
msgid "Use"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseansistrings
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Gunakan Ansi Strings"
|
|
|
|
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
|
msgid "Use CheckBox for Boolean values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
|
msgid "Use comments in custom options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedby
|
|
msgid " used by %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedesigntimepackages
|
|
msgid "Use design time packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusedforautocreatedforms
|
|
msgid "Used for auto-created forms."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseexcludefilter
|
|
#, fuzzy
|
|
#| msgid "Use Exclude Filter"
|
|
msgid "Use exclude filter"
|
|
msgstr "Gunakan Filter Kekecualian"
|
|
|
|
#: lazarusidestrconsts.lisuseidentifier
|
|
msgid "Use identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseidentifierinat
|
|
msgid "Use identifier %s in %s at %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseincludefilter
|
|
#, fuzzy
|
|
#| msgid "Use Include Filter"
|
|
msgid "Use include filter"
|
|
msgstr "Gunakan Filter Include"
|
|
|
|
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr "Meluncurkan aplikasi"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage
|
|
msgid "Use package %s in package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage2
|
|
msgid "Use package in package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject
|
|
msgid "Use package %s in project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject2
|
|
msgid "Use package in project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
|
msgid "Add to list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
|
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
|
msgid "User defined text markup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
|
msgid "Remove from list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
|
msgid "Toggle on list \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseunit
|
|
msgctxt "lazarusidestrconsts.lisuseunit"
|
|
msgid "Add Unit to Uses Section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseunitinunit
|
|
msgid "Use unit %s in unit %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisutf8withbom
|
|
msgid "UTF-8 with BOM"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalue
|
|
msgctxt "lazarusidestrconsts.lisvalue"
|
|
msgid "Value"
|
|
msgstr "Nilai"
|
|
|
|
#: lazarusidestrconsts.lisvalue2
|
|
msgid "Value%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalue3
|
|
msgid "Value: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvalues
|
|
msgid "Values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
|
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvariable
|
|
msgctxt "lazarusidestrconsts.lisvariable"
|
|
msgid "Variable"
|
|
msgstr "Variabel"
|
|
|
|
#: lazarusidestrconsts.lisverbose
|
|
msgctxt "lazarusidestrconsts.lisverbose"
|
|
msgid "Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisversion
|
|
msgid "Version"
|
|
msgstr "Versi"
|
|
|
|
#: lazarusidestrconsts.lisversionmismatch
|
|
msgid "Version mismatch"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisvertical
|
|
msgid "Vertical"
|
|
msgstr "Vertikal"
|
|
|
|
#: lazarusidestrconsts.lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisveryverbose
|
|
msgid "Very Verbose"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewbreakpointproperties
|
|
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
|
|
msgid "Breakpoint Properties ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsource
|
|
msgid "View Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsourcedisass
|
|
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
|
|
msgid "View Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Lihat Sumber (.lfm)"
|
|
|
|
#: lazarusidestrconsts.liswarning
|
|
msgid "Warning: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
|
#, fuzzy,badformat
|
|
#| msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
|
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
|
|
msgstr "Peringatan: file dwimakna ditemukan: %s%s%s. File Sumber adalah: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liswarnings
|
|
msgid ", Warnings: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
|
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatch
|
|
msgid "&Watch"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchdata
|
|
msgid "Watch:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchkind
|
|
msgid "Watch action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchkindread
|
|
msgid "Read"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchkindreadwrite
|
|
msgid "Read/Write"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchkindwrite
|
|
msgid "Write"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchpoint
|
|
msgid "&Data/Watch Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchpointbreakpoint
|
|
msgid "&Data/watch Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchpropert
|
|
msgid "Watch Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchscope
|
|
msgid "Watch scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchscopeglobal
|
|
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
|
|
msgid "Global"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchscopelocal
|
|
msgid "Declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswatchtowatchpoint
|
|
msgid "Create &Data/Watch Breakpoint ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswelcometolazaruside
|
|
msgid "Welcome to Lazarus IDE %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
|
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhatneedsbuilding
|
|
msgid "What needs building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
|
msgid "When a unit is renamed, update references"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
|
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
|
|
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
|
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
|
msgid "Window menu shows designed form's name instead of caption"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
|
msgid "Useful especially if the caption is left empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswindowstaysontop
|
|
msgid "Window stays on top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithincludes2
|
|
msgid ", with includes "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
|
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
|
msgid "Without a proper debugger, debugging will be disappointing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
|
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
|
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
|
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "Dengan paket yang diperlukan"
|
|
|
|
#: lazarusidestrconsts.liswldeleteall
|
|
msgid "De&lete All"
|
|
msgstr "&Hapus Semua"
|
|
|
|
#: lazarusidestrconsts.liswldisableall
|
|
msgid "D&isable All"
|
|
msgstr "Mat&ikan Semua"
|
|
|
|
#: lazarusidestrconsts.liswlenableall
|
|
msgid "E&nable All"
|
|
msgstr "Hidupka&n Semua"
|
|
|
|
#: lazarusidestrconsts.liswlexpression
|
|
msgid "Expression"
|
|
msgstr "Ekspresi"
|
|
|
|
#: lazarusidestrconsts.liswlinspectpane
|
|
msgid "Inspect pane"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswlproperties
|
|
msgid "&Properties"
|
|
msgstr "&Properti"
|
|
|
|
#: lazarusidestrconsts.liswlwatchlist
|
|
#, fuzzy
|
|
#| msgid "Watch list"
|
|
msgid "Watch List"
|
|
msgstr "Daftar Pengawasan"
|
|
|
|
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Kata di kursor dalam editor saat ini"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr "Direktori kerja untuk membangun"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr "Direktori kerja untuk menjalankan"
|
|
|
|
#: lazarusidestrconsts.liswriteerror
|
|
msgid "Write Error"
|
|
msgstr "Penulisan Salah"
|
|
|
|
#: lazarusidestrconsts.liswriteerrorfile
|
|
msgid "Write error: %s%sFile: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswrongversionin
|
|
msgid "wrong version in %s: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisxmlerror
|
|
msgid "XML Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
|
msgid "XML parser error in file %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyes
|
|
msgid "Yes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
|
msgid "You can disable this for individual forms via the package editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
|
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
|
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
#, fuzzy
|
|
#| msgid "You can not build lazarus while debugging or compiling."
|
|
msgid "You cannot build Lazarus while debugging or compiling."
|
|
msgstr "Anda tidak bisa membangun lazarus saat debugging atau kompilasi."
|
|
|
|
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
|
|
msgid "You cannot change the build mode while compiling."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
|
|
msgid "You can select items by simply pressing underscored letters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis_all_
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lis_all_"
|
|
msgid "<All>"
|
|
msgstr "<Semua>"
|
|
|
|
#: lazarusidestrconsts.locwndsrceditor
|
|
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
|
msgid "Source Editor"
|
|
msgstr "Editor Sumber"
|
|
|
|
#: lazarusidestrconsts.lrsplddeleteselected
|
|
msgid "Delete selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldinvalid
|
|
msgid "invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
|
msgid "lpk file invalid (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfilevalid
|
|
msgid "lpk file valid (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldunabletodeletefile
|
|
msgid "Unable to delete file \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrspldvalid
|
|
msgid "valid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lrsrescanlplfiles
|
|
msgid "Rescan lpl files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgbinary
|
|
msgctxt "lazarusidestrconsts.regdlgbinary"
|
|
msgid "Binary"
|
|
msgstr "Biner"
|
|
|
|
#: lazarusidestrconsts.regdlgdecimal
|
|
msgctxt "lazarusidestrconsts.regdlgdecimal"
|
|
msgid "Decimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
|
|
msgid "Display type for selected Registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgformat
|
|
msgid "Format"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlghex
|
|
msgid "Hex"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgoctal
|
|
msgid "Octal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.regdlgraw
|
|
msgid "Raw"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr "Tambah Inverse"
|
|
|
|
#: lazarusidestrconsts.rsattachto
|
|
msgid "Attach to"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsattributes
|
|
msgid "Attributes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
|
msgid "Increased every time the project is compiled."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsbuild
|
|
msgid "&Build:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscharacterset
|
|
msgid "Character set:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsclosecurrentpage
|
|
msgid "Close current page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr "Definisi kondisional"
|
|
|
|
#: lazarusidestrconsts.rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr "Buat definisi baru"
|
|
|
|
#: lazarusidestrconsts.rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsenterpid
|
|
msgid "Enter PID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfilterthelistwithstring
|
|
msgid "Filter the lines in list with a string"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
|
msgid "Found, but not listed here: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nexcluded
|
|
msgid "Excluded"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextcompile
|
|
msgid "Force update PO files on next compile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nidentifiers
|
|
msgid "Identifiers:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18noriginals
|
|
msgid "Originals:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfohint
|
|
msgid "Version info is stored if the executable format supports it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
|
msgid "Include version info in executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnnameshint
|
|
msgid "Column Names"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
|
|
msgid "Strategy for saving Columns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnwidthhint
|
|
msgid "Column Width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomgeometry
|
|
msgid "Custom geometry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomgeometryhint
|
|
msgid "User can define window's position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
|
|
msgid "Fixed default geometry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
|
|
msgid "Always the same fixed position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
|
|
msgid "Let windowmanager decide"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
|
|
msgid "System windowmanagers have different strategies for positioning windows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwppositionwindowlisthint
|
|
msgid "Windows that have been open. They may be closed now."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
|
msgid "Restore window geometry"
|
|
msgstr "Simpan kembali geometri jendela"
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
|
|
msgid "Use previous position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplittercustomposition
|
|
msgid "Custom Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterdefault
|
|
msgid "Default Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
|
|
msgid "Restore with window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
|
|
msgid "Restore Size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageafrikaans
|
|
msgid "Afrikaans"
|
|
msgstr "Afrikaans"
|
|
|
|
#: lazarusidestrconsts.rslanguagearabic
|
|
msgid "Arabic"
|
|
msgstr "Bahasa Arab"
|
|
|
|
#: lazarusidestrconsts.rslanguageautomatic
|
|
#, fuzzy
|
|
#| msgid "Automatic (or english)"
|
|
msgid "Automatic (or English)"
|
|
msgstr "Otomatis (atau Inggris)"
|
|
|
|
#: lazarusidestrconsts.rslanguagecatalan
|
|
msgid "Catalan"
|
|
msgstr "Catalian"
|
|
|
|
#: lazarusidestrconsts.rslanguagechinese
|
|
msgid "Chinese"
|
|
msgstr "Cina"
|
|
|
|
#: lazarusidestrconsts.rslanguageczech
|
|
msgid "Czech"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagedutch
|
|
msgid "Dutch"
|
|
msgstr "Belanda"
|
|
|
|
#: lazarusidestrconsts.rslanguageenglish
|
|
msgid "English"
|
|
msgstr "Inggris"
|
|
|
|
#: lazarusidestrconsts.rslanguagefinnish
|
|
msgid "Finnish"
|
|
msgstr "Finlandia"
|
|
|
|
#: lazarusidestrconsts.rslanguagefrench
|
|
msgid "French"
|
|
msgstr "Perancis"
|
|
|
|
#: lazarusidestrconsts.rslanguagegerman
|
|
msgid "German"
|
|
msgstr "Jerman"
|
|
|
|
#: lazarusidestrconsts.rslanguagehebrew
|
|
msgid "Hebrew"
|
|
msgstr "Hebrew"
|
|
|
|
#: lazarusidestrconsts.rslanguagehungarian
|
|
msgid "Hungarian"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageindonesian
|
|
msgid "Indonesian"
|
|
msgstr "Indonesian"
|
|
|
|
#: lazarusidestrconsts.rslanguageitalian
|
|
msgid "Italian"
|
|
msgstr "Italia"
|
|
|
|
#: lazarusidestrconsts.rslanguagejapanese
|
|
msgid "Japanese"
|
|
msgstr "Jepang"
|
|
|
|
#: lazarusidestrconsts.rslanguagelithuanian
|
|
msgid "Lithuanian"
|
|
msgstr "Lithuania"
|
|
|
|
#: lazarusidestrconsts.rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagepolish
|
|
msgid "Polish"
|
|
msgstr "Polandia"
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguese
|
|
msgid "Portuguese"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguesebr
|
|
msgid "Brazilian Portuguese"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagerussian
|
|
msgid "Russian"
|
|
msgstr "Rusia"
|
|
|
|
#: lazarusidestrconsts.rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageslovak
|
|
msgid "Slovak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguagespanish
|
|
msgid "Spanish"
|
|
msgstr "SPanyol"
|
|
|
|
#: lazarusidestrconsts.rslanguageturkish
|
|
msgid "Turkish"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rslanguageukrainian
|
|
msgid "Ukrainian"
|
|
msgstr "Ukraina"
|
|
|
|
#: lazarusidestrconsts.rsmajorversion
|
|
msgid "&Major version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsminorversion
|
|
msgid "Mi&nor version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsotherinfo
|
|
msgid "Other info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresource
|
|
msgid "Resource"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresourceclear
|
|
msgid "Delete all resources?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresourcefilename
|
|
msgid "File name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresourcetype
|
|
msgctxt "lazarusidestrconsts.rsresourcetype"
|
|
msgid "Type"
|
|
msgstr "Tipe"
|
|
|
|
#: lazarusidestrconsts.rsrevision
|
|
msgid "&Revision:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsselectaninheritedentry
|
|
msgid "Select an inherited entry"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsstartanewsearch
|
|
msgid "Start a new search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Perintah menu Panduan"
|
|
|
|
#: lazarusidestrconsts.srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Perintah Perintah"
|
|
|
|
#: lazarusidestrconsts.srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "Perintah CodeTools"
|
|
|
|
#: lazarusidestrconsts.srkmcatcolselection
|
|
msgid "Text column selection commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Perintah pemindahan kursor"
|
|
|
|
#: lazarusidestrconsts.srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Perintah pengeditan teks"
|
|
|
|
#: lazarusidestrconsts.srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Perintah menu File"
|
|
|
|
#: lazarusidestrconsts.srkmcatfold
|
|
msgid "Text folding commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatmacrorecording
|
|
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
|
msgid "Macros"
|
|
msgstr "Makro"
|
|
|
|
#: lazarusidestrconsts.srkmcatmarker
|
|
#, fuzzy
|
|
#| msgid "Text marker commands"
|
|
msgid "Text bookmark commands"
|
|
msgstr "Perintah penanda teks"
|
|
|
|
#: lazarusidestrconsts.srkmcatmulticaret
|
|
msgid "Multi caret commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Perintah menu Proyek"
|
|
|
|
#: lazarusidestrconsts.srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Perintah menu Jalankan"
|
|
|
|
#: lazarusidestrconsts.srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Perintah pencarian dan penggantian teks"
|
|
|
|
#: lazarusidestrconsts.srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Perintah pemindahan teks"
|
|
|
|
#: lazarusidestrconsts.srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Perintah Notebook Sumber"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroedit
|
|
msgid "Syncron Editing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
|
msgid "Syncron Editing (not in Cell)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
|
msgid "Syncron Editing (while selecting)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateedit
|
|
msgid "Template Editing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateeditoff
|
|
msgid "Template Editing (not in Cell)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Perintah menu Piranti"
|
|
|
|
#: lazarusidestrconsts.srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Perintah menu Lihat"
|
|
|
|
#: lazarusidestrconsts.srkmcommand
|
|
msgctxt "lazarusidestrconsts.srkmcommand"
|
|
msgid "Command:"
|
|
msgstr "Perintah:"
|
|
|
|
#: lazarusidestrconsts.srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Konflik"
|
|
|
|
#: lazarusidestrconsts.srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "batalkan pembangunan"
|
|
|
|
#: lazarusidestrconsts.srkmecabstractmethods
|
|
msgid "Abstract Methods ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpaddress
|
|
msgid "add address breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpsource
|
|
msgid "add source breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
|
msgid "add data/watchpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecaddjumppoint
|
|
#, fuzzy
|
|
#| msgid "Add jump point"
|
|
msgid "Add Jump Point"
|
|
msgstr "Tambahkan titik lompat"
|
|
|
|
#: lazarusidestrconsts.srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "tambah pengawasan"
|
|
|
|
#: lazarusidestrconsts.srkmecattach
|
|
msgid "Attach to program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Penyempurnaan template kode"
|
|
|
|
#: lazarusidestrconsts.srkmecblockcopy
|
|
msgid "Copy Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockdelete
|
|
msgid "Delete Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotobegin
|
|
msgid "Goto Block begin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotoend
|
|
msgid "Goto Block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockhide
|
|
msgid "Hide Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockindent
|
|
msgid "Indent block"
|
|
msgstr "Lekukan Blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockmove
|
|
msgid "Move Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetbegin
|
|
msgid "Set block begin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetend
|
|
msgid "Set block end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockshow
|
|
msgid "Show Block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblocktogglehide
|
|
msgid "Toggle block"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindent
|
|
msgid "Unindent block"
|
|
msgstr "Jangan lekukan blok"
|
|
|
|
#: lazarusidestrconsts.srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "bangun program/proyek"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "bangun file"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildlazarus
|
|
#, fuzzy
|
|
#| msgid "Build lazarus"
|
|
msgid "Build Lazarus"
|
|
msgstr "Bangun Lazarus"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildmanymodes
|
|
msgid "build many modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecchar
|
|
msgid "Char"
|
|
msgstr "Karakter"
|
|
|
|
#: lazarusidestrconsts.srkmeccleanupandbuild
|
|
msgid "clean up and build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Hapus seluruh teks"
|
|
|
|
#: lazarusidestrconsts.srkmecclearallbookmark
|
|
msgid "Clear all Bookmarks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
|
msgid "Clear Bookmarks for current file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseldown
|
|
msgid "Column Select Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
|
msgid "Column Select to absolute end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditortop
|
|
msgid "Column Select to absolute beginning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselleft
|
|
msgid "Column Select Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellineend
|
|
msgid "Column Select Line End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinestart
|
|
msgid "Column Select Line Start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
|
msgid "Column Select to text start in line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagebottom
|
|
msgid "Column Select Page Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagedown
|
|
msgid "Column Select Page Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagetop
|
|
msgid "Column Select Page Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpageup
|
|
msgid "Column Select Page Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselright
|
|
msgid "Column Select Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselup
|
|
msgid "Column Select Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordleft
|
|
msgid "Column Select Word Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordright
|
|
msgid "Column Select Word Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Mode pemilihan kolom"
|
|
|
|
#: lazarusidestrconsts.srkmeccompile
|
|
msgid "compile program/project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "file konfig pembangunan"
|
|
|
|
#: lazarusidestrconsts.srkmeccopy
|
|
#, fuzzy
|
|
#| msgid "Copy selection to clipboard"
|
|
msgctxt "lazarusidestrconsts.srkmeccopy"
|
|
msgid "Copy"
|
|
msgstr "Copy pilihan ke clipboard"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
|
msgid "Copy editor to new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
|
msgid "Copy editor to next free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
|
msgid "Copy editor to prior free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccut
|
|
#, fuzzy
|
|
#| msgid "Cut selection to clipboard"
|
|
msgctxt "lazarusidestrconsts.srkmeccut"
|
|
msgid "Cut"
|
|
msgstr "Potong pilihan ke clipboard"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Hapus sampai awal baris"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Hapus karakter di kursor"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Hapus sampai akhir baris"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Hapus Karakter Terakhir"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Hapus sampai awal kata"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Hapus baris saat ini"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Hapus sampai akhir kata"
|
|
|
|
#: lazarusidestrconsts.srkmecdetach
|
|
msgid "Detach from program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdiff
|
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
|
msgid "Diff"
|
|
msgstr "Diff"
|
|
|
|
#: lazarusidestrconsts.srkmecdown
|
|
msgid "Move cursor down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Pindahkan kursor ke absolut akhir"
|
|
|
|
#: lazarusidestrconsts.srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Pindahkan kursor ke absolut awal"
|
|
|
|
#: lazarusidestrconsts.srkmecemptymethods
|
|
msgid "Empty Methods ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecenvironmentoptions
|
|
msgid "IDE options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr "evaluasi/modifikasi"
|
|
|
|
#: lazarusidestrconsts.srkmecextractproc
|
|
#, fuzzy
|
|
#| msgid "Extract procedure"
|
|
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
|
msgid "Extract Procedure"
|
|
msgstr "Ekstraks prosedur"
|
|
|
|
#: lazarusidestrconsts.srkmecexttool
|
|
msgid "External tool %d"
|
|
msgstr "Piranti eksternal %d"
|
|
|
|
#: lazarusidestrconsts.srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Seting piranti eksternal"
|
|
|
|
#: lazarusidestrconsts.srkmecfind
|
|
#, fuzzy
|
|
#| msgid "Find text"
|
|
msgid "Find Text"
|
|
msgstr "Cari teks"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Cari akhir blok lain"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Cari awal blok"
|
|
|
|
#: lazarusidestrconsts.srkmecfinddeclaration
|
|
#, fuzzy
|
|
#| msgid "Find declaration"
|
|
msgid "Find Declaration"
|
|
msgstr "Cari deklarasi"
|
|
|
|
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
|
#, fuzzy
|
|
#| msgid "Find identifier references"
|
|
msgid "Find Identifier References"
|
|
msgstr "Cari referensi pengenal"
|
|
|
|
#: lazarusidestrconsts.srkmecfindinfiles
|
|
#, fuzzy
|
|
#| msgid "Find in files"
|
|
msgid "Find in Files"
|
|
msgstr "Cari dalam file"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnext
|
|
#, fuzzy
|
|
#| msgid "Find next"
|
|
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
|
msgid "Find Next"
|
|
msgstr "Cari berikutnya"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
|
#, fuzzy
|
|
#| msgid "Find next word occurrence"
|
|
msgid "Find Next Word Occurrence"
|
|
msgstr "Cari keberadaan kata berikutnya"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloads
|
|
msgid "Find Overloads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
|
msgid "Find Overloads ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevious
|
|
#, fuzzy
|
|
#| msgid "Find previous"
|
|
msgid "Find Previous"
|
|
msgstr "Cari sebelumnya"
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
|
#, fuzzy
|
|
#| msgid "Find previous word occurrence"
|
|
msgid "Find Previous Word Occurrence"
|
|
msgstr "Cari keberadaan kata sebelumnya"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
|
#, fuzzy
|
|
#| msgid "Find procedure definiton"
|
|
msgid "Find Procedure Definiton"
|
|
msgstr "Cari definisi procedure"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduremethod
|
|
#, fuzzy
|
|
#| msgid "Find procedure method"
|
|
msgid "Find Procedure Method"
|
|
msgstr "Cari metode procedure"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldcurrent
|
|
msgid "Fold at Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecfoldlevel
|
|
msgid "Fold to Level %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotoeditor
|
|
msgid "Go to editor %d"
|
|
msgstr "Pergi ke editor %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoincludedirective
|
|
#, fuzzy
|
|
#| msgid "Go to to include directive of current include file"
|
|
msgid "Go to include directive of current include file"
|
|
msgstr "Pergi ke direktif include dari file include saat ini"
|
|
|
|
#: lazarusidestrconsts.srkmecgotolinenumber
|
|
#, fuzzy
|
|
#| msgid "Go to line number"
|
|
msgid "Go to Line Number"
|
|
msgstr "Pergi ke nomor baris"
|
|
|
|
#: lazarusidestrconsts.srkmecgotomarker
|
|
#, fuzzy
|
|
#| msgid "Go to Marker %d"
|
|
msgid "Go to bookmark %d"
|
|
msgstr "Pergi ke Penanda %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Pergi ke XY"
|
|
|
|
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
|
#, fuzzy
|
|
#| msgid "Guess misplaced $IFDEF"
|
|
msgid "Guess Misplaced $IFDEF"
|
|
msgstr "Tebak $IFDEF salah tempat"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordleft
|
|
msgid "Move cursor part-word left (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordright
|
|
msgid "Move cursor part-word right (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr "Ime Str"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "Sisipkan entri ChangeLog"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Sisipkan dari Charactermap"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "Sisipkan Pembuat kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "Sisipkan Tanggal kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "Sisipkan Header kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "Sisipkan ID kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "Sisipkan Log kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "Sisipkan Nama kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "Sisipkan Revisi kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "Sisipkan Sumber kata kunci CVS"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Sisipkan tanggal dan waktu saat ini"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertfilename
|
|
msgid "Insert Full Filename"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "Sisipkan catatan GPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
|
msgid "Insert GPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "Sisipkan catatan LGPL"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
|
msgid "Insert LGPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Pisahkan baris, biarkan kursor"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnotice
|
|
msgid "Insert MIT notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
|
msgid "Insert MIT notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Mode Sisipan"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr "Sisipkan catatan LGPL yang diubah"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
|
msgid "Insert modified LGPL notice (translated)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Sisipkan nama pemakai saat ini"
|
|
|
|
#: lazarusidestrconsts.srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "inspeksi"
|
|
|
|
#: lazarusidestrconsts.srkmecinvertassignment
|
|
#, fuzzy
|
|
#| msgid "Invert assignment"
|
|
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Balikkan penempatan"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapleft
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
|
msgid "Left"
|
|
msgstr "Left"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapright
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
|
msgid "Right"
|
|
msgstr "Right"
|
|
|
|
#: lazarusidestrconsts.srkmecleft
|
|
msgid "Move cursor left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Pisahkan baris dan pindahkan kursor"
|
|
|
|
#: lazarusidestrconsts.srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Pindahkan kursor ke akhir baris"
|
|
|
|
#: lazarusidestrconsts.srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Mode pemilihan baris"
|
|
|
|
#: lazarusidestrconsts.srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Pindahkan kursorke awal baris"
|
|
|
|
#: lazarusidestrconsts.srkmeclinetextstart
|
|
msgid "Move cursor to text start in line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeclockeditor
|
|
msgid "Lock Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmakeresourcestring
|
|
#, fuzzy
|
|
#| msgid "Make resource string"
|
|
msgid "Make Resource String"
|
|
msgstr "Buat string resource"
|
|
|
|
#: lazarusidestrconsts.srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Pergi ke kurung yang sama"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Pindahkan editor ke kiri"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
|
msgid "Move editor to new window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
|
msgid "Move editor to next free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
|
msgid "Move editor to prior free window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Pindahkan editor ke kanan"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmultipaste
|
|
msgctxt "lazarusidestrconsts.srkmecmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Penanda berikutnya"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Pergi ke editor berikutnya"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
|
msgid "Go to next editor in history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextsharededitor
|
|
msgid "Go to next editor with same Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnextwindow
|
|
msgid "Go to next window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Mode pilihan normal"
|
|
|
|
#: lazarusidestrconsts.srkmecopenfileatcursor
|
|
#, fuzzy
|
|
#| msgid "Open file at cursor"
|
|
msgid "Open File at Cursor"
|
|
msgstr "Buka file di kursor"
|
|
|
|
#: lazarusidestrconsts.srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Mode Menimpa"
|
|
|
|
#: lazarusidestrconsts.srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Pindahkan kursor ke bawah halaman"
|
|
|
|
#: lazarusidestrconsts.srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Pindahkan kursor turun satu halaman"
|
|
|
|
#: lazarusidestrconsts.srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Pindahkan kursor ke kiri satu halaman"
|
|
|
|
#: lazarusidestrconsts.srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Pindahkan kursor ke kanan satu halaman"
|
|
|
|
#: lazarusidestrconsts.srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Pindahkan kursor ke atas halaman"
|
|
|
|
#: lazarusidestrconsts.srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Pindahkan kursor naik satu halaman"
|
|
|
|
#: lazarusidestrconsts.srkmecpaste
|
|
#, fuzzy
|
|
#| msgid "Paste clipboard to current position"
|
|
msgctxt "lazarusidestrconsts.srkmecpaste"
|
|
msgid "Paste"
|
|
msgstr "Paste clipboard ke posisi saat ini"
|
|
|
|
#: lazarusidestrconsts.srkmecpause
|
|
msgid "pause program"
|
|
msgstr "pause program"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
|
msgid "Clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
|
msgid "Cursor keys clear all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
|
msgid "Cursor keys move all extra carets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
|
msgid "Add extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
|
msgid "Toggle extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
|
msgid "Remove extra caret"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Penanda sebelumnya"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Pergi ke editor sebelumnya"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
|
msgid "Go to previous editor in history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevsharededitor
|
|
msgid "Go to prior editor with same Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecprevwindow
|
|
msgid "Go to prior window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "kompilasi cepat, tanpa linking"
|
|
|
|
#: lazarusidestrconsts.srkmecremovebreakpoint
|
|
#, fuzzy
|
|
#| msgid "remove break point"
|
|
msgid "remove breakpoint"
|
|
msgstr "hapus break point"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveemptymethods
|
|
msgid "Remove Empty Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecremoveunusedunits
|
|
msgid "Remove Unused Units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrenameidentifier
|
|
#, fuzzy
|
|
#| msgid "Rename identifier"
|
|
msgid "Rename Identifier"
|
|
msgstr "Ganti nama pengenal"
|
|
|
|
#: lazarusidestrconsts.srkmecreplace
|
|
#, fuzzy
|
|
#| msgid "Replace text"
|
|
msgid "Replace Text"
|
|
msgstr "Ganti teks"
|
|
|
|
#: lazarusidestrconsts.srkmecreportingbug
|
|
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
|
msgid "Reporting a bug"
|
|
msgstr "Melaporkan bug..."
|
|
|
|
#: lazarusidestrconsts.srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "reset debugger"
|
|
|
|
#: lazarusidestrconsts.srkmecright
|
|
msgid "Move cursor right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrun
|
|
msgid "run program"
|
|
msgstr "jalankan program"
|
|
|
|
#: lazarusidestrconsts.srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "jalankan file"
|
|
|
|
#: lazarusidestrconsts.srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "parameter menjalankan"
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithoutdebugging
|
|
msgid "run without debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Gulung sebaris ke bawah"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Gulung satu karakter ke kiri"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Gulung satu karakter ke kanan"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Gulung sebaris ke atas"
|
|
|
|
#: lazarusidestrconsts.srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Pilih Turun"
|
|
|
|
#: lazarusidestrconsts.srkmecselectall
|
|
msgctxt "lazarusidestrconsts.srkmecselectall"
|
|
msgid "Select All"
|
|
msgstr "Pilih Semua"
|
|
|
|
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Ubah tab ke spasi dalam pilihan"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Pilih ke absolut akhir"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Pilih ke absolut awal"
|
|
|
|
#: lazarusidestrconsts.srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr "Pilih Pergi ke XY"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordleft
|
|
msgid "Select part-word left (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordright
|
|
msgid "Select part-word right (e.g. CamelCase)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselleft
|
|
#, fuzzy
|
|
#| msgid "SelLeft"
|
|
msgid "Select Left"
|
|
msgstr "PilihKiri"
|
|
|
|
#: lazarusidestrconsts.srkmecsellineend
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
|
msgid "Select Line End"
|
|
msgstr "Pilih Akhir Baris"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinestart
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Pilih Awal Baris"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinetextstart
|
|
msgid "Select to text start in line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselpagebottom
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Pilih Halaman ke Bawah"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Pilih Halaman Turun"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Pilih Halaman ke Kiri"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "Pilih Halaman ke Kanan"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagetop
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Pilih Halaman ke Atas"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Pilih Halaman Naik"
|
|
|
|
#: lazarusidestrconsts.srkmecselright
|
|
#, fuzzy
|
|
#| msgid "SelRight"
|
|
msgid "Select Right"
|
|
msgstr "Pilih Kanan"
|
|
|
|
#: lazarusidestrconsts.srkmecselsticky
|
|
msgid "Start sticky selecting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickycol
|
|
msgid "Start sticky selecting (Columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickyline
|
|
msgid "Start sticky selecting (Line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselstickystop
|
|
msgid "Stop sticky selecting"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Pilih Naik"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendleft
|
|
msgid "Select word-end left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendright
|
|
msgid "Select word-end right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecselwordleft
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Pilih Sekata ke Kiri"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordright
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Pilih Sekata ke Kanan"
|
|
|
|
#: lazarusidestrconsts.srkmecsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
|
msgid "Set a free Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsetmarker
|
|
#, fuzzy
|
|
#| msgid "Set Marker %d"
|
|
msgid "Set bookmark %d"
|
|
msgstr "Set Penanda %d"
|
|
|
|
#: lazarusidestrconsts.srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr "Shift Tab"
|
|
|
|
#: lazarusidestrconsts.srkmecshowabstractmethods
|
|
msgid "Show Abstract Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecshowcodecontext
|
|
#, fuzzy
|
|
#| msgid "Show code context"
|
|
msgid "Show Code Context"
|
|
msgstr "Tampilkan konteks kode"
|
|
|
|
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
|
msgid "show execution point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "hentikan program"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacroplay
|
|
msgid "Play Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacrorecord
|
|
msgid "Record Macro"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
|
msgid "Select Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
|
msgid "Next Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
|
msgid "Start Syncro edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
|
msgid "Select cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
|
msgid "Finish"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
|
msgid "Next Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
|
msgid "Next Cell (rotate)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
|
msgid "Next Cell (rotate / all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
|
msgid "Next Cell (rotate / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
|
msgid "Next Cell (rotate / all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsyntaxcheck
|
|
#, fuzzy
|
|
#| msgid "Syntax check"
|
|
msgid "Syntax Check"
|
|
msgstr "Pemeriksaan Sintaks"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleassembler
|
|
msgid "View assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoint
|
|
msgid "toggle breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Lihat breakpoint"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Lihat pemanggilan stack"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr "Lihat browser kode"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "Lihat Eksplorer Kode"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Lihat palet komponen"
|
|
|
|
#: lazarusidestrconsts.srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Lihat output debugger"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Tukar antara form dan unit"
|
|
|
|
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr "Lihat Editor Dokumentasi"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
|
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
|
msgid "View IDE speed buttons"
|
|
msgstr "Lihat tombol cepat IDE"
|
|
|
|
#: lazarusidestrconsts.srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Lihat variabel lokal"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarker
|
|
msgid "Toggle bookmark %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarkupword
|
|
msgid "Toggle Current-Word highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Lihat pesan"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Toggle Mode"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Lihat Inspektor Objek"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleregisters
|
|
msgid "View registers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Lihat Hasil Pencarian"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Lihat Editor Sumber"
|
|
|
|
#: lazarusidestrconsts.srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Lihat pengawasan"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldall
|
|
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldcurrent
|
|
msgid "Unfold at Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "perintah editor tidak dikenal"
|
|
|
|
#: lazarusidestrconsts.srkmecunusedunits
|
|
msgid "Unused Units ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecup
|
|
msgid "Move cursor up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Lihat editor anchor"
|
|
|
|
#: lazarusidestrconsts.srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecvieweditormacros
|
|
msgid "View editor macros"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Lihat form"
|
|
|
|
#: lazarusidestrconsts.srkmecviewhistory
|
|
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
|
msgid "View History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
|
msgid "View Terminal Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewtaborder
|
|
msgid "View Tab Order"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewthreads
|
|
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
|
msgid "View Threads"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Lihat ketergantungan unit"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Lihat informasi unit"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Lihat unit"
|
|
|
|
#: lazarusidestrconsts.srkmecwordcompletion
|
|
#, fuzzy
|
|
#| msgid "Word completion"
|
|
msgid "Word Completion"
|
|
msgstr "Penyempurnaan kata"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendleft
|
|
msgid "Move cursor word-end left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordendright
|
|
msgid "Move cursor word-end right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Pindahkan kursor sekata ke kiri"
|
|
|
|
#: lazarusidestrconsts.srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Pindahkan kursor sekata ke kanan"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomin
|
|
msgid "Zoom in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeczoomout
|
|
msgid "Zoom out"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeditforcmd
|
|
msgid "Edit keys of command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
|
msgid "Continue with next mouse up action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldcomments
|
|
msgid "Fold comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldcommentsinselection
|
|
msgid "Fold comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdef
|
|
msgid "Fold inactive Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
|
msgid "Fold inactive Ifdef (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
|
msgid "Fold inactive Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
|
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfhidecomments
|
|
msgid "Hide comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfhidecommentsinselection
|
|
msgid "Hide comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
|
msgid "Match action button of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
|
msgid "Match action line of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
|
msgid "Match action modifiers of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
|
msgid "Match action pos of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
|
msgid "Search all action of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdef
|
|
msgid "Unfold active Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
|
msgid "Unfold active Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldall
|
|
msgctxt "lazarusidestrconsts.synfunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdef
|
|
msgid "Unfold all Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
|
msgid "Unfold all Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldallinselection
|
|
msgid "Unfold all in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldcomments
|
|
msgid "Unfold comments"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
|
msgid "Unfold comments in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
|
msgid "Unfold inactive Ifdef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
|
msgid "Unfold inactive Ifdef in selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "File adalah hanya-baca"
|
|
|
|
#: lazarusidestrconsts.uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "File \""
|
|
|
|
#: lazarusidestrconsts.uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "\" tidak bisa ditulisi."
|
|
|
|
#: lazarusidestrconsts.uelocked
|
|
msgid "Locked"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemacrorecording
|
|
msgid "Recording"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemacrorecordingpaused
|
|
msgid "Rec-pause"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "Tambah &Pengawasan Di Kursor"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
|
msgid "Add Watch&Point At Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uembookmarkn
|
|
msgid "Bookmark"
|
|
msgstr "Penunjuk"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpages
|
|
msgid "Close All &Other Pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "&Tutup Halaman"
|
|
|
|
#: lazarusidestrconsts.uemcopyfilename
|
|
#, fuzzy
|
|
#| msgid "Copy filename"
|
|
msgid "Copy Filename"
|
|
msgstr "Copy nama file"
|
|
|
|
#: lazarusidestrconsts.uemcopytonewwindow
|
|
msgid "Clone to New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindow
|
|
msgid "Clone to Other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
|
msgid "New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemdebugword
|
|
msgctxt "lazarusidestrconsts.uemdebugword"
|
|
msgid "Debug"
|
|
msgstr "Debug"
|
|
|
|
#: lazarusidestrconsts.uemencoding
|
|
msgid "Encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemevaluatemodify
|
|
msgid "&Evaluate/Modify ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "&Cari Deklarasi"
|
|
|
|
#: lazarusidestrconsts.uemfindinotherwindow
|
|
msgid "Find in other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "Per&gi ke penujuk"
|
|
|
|
#: lazarusidestrconsts.uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.ueminspect
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.ueminspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Inspeksi ..."
|
|
|
|
#: lazarusidestrconsts.ueminvertassignment
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Balikkan Penempatan"
|
|
|
|
#: lazarusidestrconsts.uemlineending
|
|
msgid "Line Ending"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemlockpage
|
|
msgid "&Lock Page"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepageleft
|
|
msgid "Move Page Left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepageleftmost
|
|
msgid "Move Page Leftmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepageright
|
|
msgid "Move Page Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovepagerightmost
|
|
msgid "Move Page Rightmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovetonewwindow
|
|
msgid "Move to New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindow
|
|
msgid "Move to Other Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
|
msgid "New Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemnextbookmark
|
|
#, fuzzy
|
|
#| msgid "Goto next Bookmark"
|
|
msgid "Goto Next Bookmark"
|
|
msgstr "Pergi ke Penunjuk berikutnya"
|
|
|
|
#: lazarusidestrconsts.uemodified
|
|
msgid "Modified"
|
|
msgstr "Dimodifikasi"
|
|
|
|
#: lazarusidestrconsts.uemopenfileatcursor
|
|
#, fuzzy
|
|
#| msgid "&Open file at cursor"
|
|
msgid "&Open File at Cursor"
|
|
msgstr "&Buka file di kursor"
|
|
|
|
#: lazarusidestrconsts.uemprevbookmark
|
|
#, fuzzy
|
|
#| msgid "Goto previous Bookmark"
|
|
msgid "Goto Previous Bookmark"
|
|
msgstr "Pergi ke Penunjuk sebelumnya"
|
|
|
|
#: lazarusidestrconsts.uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Procedure Lompat"
|
|
|
|
#: lazarusidestrconsts.uemreadonly
|
|
msgctxt "lazarusidestrconsts.uemreadonly"
|
|
msgid "Read Only"
|
|
msgstr "Hanya Baca"
|
|
|
|
#: lazarusidestrconsts.uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Refactoring"
|
|
|
|
#: lazarusidestrconsts.uemruntocursor
|
|
msgid "&Run to Cursor"
|
|
msgstr "&Jalankan ke Kursor"
|
|
|
|
#: lazarusidestrconsts.uemsetfreebookmark
|
|
#, fuzzy
|
|
#| msgid "Set a free Bookmark"
|
|
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Set penunjuk bebas"
|
|
|
|
#: lazarusidestrconsts.uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Tampilkan Niomor Baris"
|
|
|
|
#: lazarusidestrconsts.uemsource
|
|
msgctxt "lazarusidestrconsts.uemsource"
|
|
msgid "Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmark
|
|
msgid "&Toggle Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemtogglebreakpoint
|
|
msgid "Toggle &Breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemviewcallstack
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Lihat Panggilan Stack"
|
|
|
|
#: lazarusidestrconsts.uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Belum Di Imlementasikan"
|
|
|
|
#: lazarusidestrconsts.uepins
|
|
msgid "INS"
|
|
msgstr "INS"
|
|
|
|
#: lazarusidestrconsts.uepovr
|
|
msgid "OVR"
|
|
msgstr "OVR"
|
|
|
|
#: lazarusidestrconsts.uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Hanya-baca"
|
|
|
|
#: lazarusidestrconsts.versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Info Versi"
|
|
|