lazarus/languages/lazaruside.ruutf.po

#: lazarusidestrconsts:srkmcommand1
msgid "    command1 \""
msgstr "   команда1 \""

#: lazarusidestrconsts:srkmcommand2
msgid "    command2 \""
msgstr "   команда2 \""

#: lazarusidestrconsts:liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "Элемент %s%s%s уже существует! "

#: lazarusidestrconsts:srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr "Клавика \"%s\" уже сопоставлена с \"%s\"."

#: lazarusidestrconsts:srkmconflicw
msgid " conflicts with "
msgstr " конфликтует с "

#: lazarusidestrconsts:liscompiling
msgid "%s (compiling ...)"
msgstr "%s (компилирую ...)"

#: lazarusidestrconsts:lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (идёт отладка ...)"

#: lazarusidestrconsts:lisnewproject
msgid "%s - (new project)"
msgstr "%s - (новый проект)"

#: lazarusidestrconsts:lisuidbytes
msgid "%s bytes"
msgstr "%s байт"

#: lazarusidestrconsts:liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s - это каталог"

#: lazarusidestrconsts:lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s - уже часть проекта."

#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "Каталог проекта %s"

#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s - некорректное имя проекта.%s Выберите другое (напр., project1.lpi)"

#: lazarusidestrconsts:lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s - некорректный идентификатор."

#: lazarusidestrconsts:lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s - некорректное название модуля"

#: lazarusidestrconsts:liscoclickokifaresuretodothat
msgid "%s%sClick OK if are sure to do that."
msgstr "%s%sНажмите ОК, если точно хотите это сделать."

#: lazarusidestrconsts:lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sИмя файла: %s%s%s"

#: lazarusidestrconsts:lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr ""

#: lazarusidestrconsts:lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sИмя модуля: %s%s%s"

#: lazarusidestrconsts:lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Страница: %s"

#: lazarusidestrconsts:liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, автосоздан"

#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, связан с проектом"

#: lazarusidestrconsts:lisuereadonly
msgid "%s/ReadOnly"
msgstr "%s/только чтение"

#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sДобавление новой зависимости пакета %s: пакет %s%s"

#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sДобавление новой зависимости проекта %s: пакет %s%s"

#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sОба пакета связаны. Это значит, что либо один из них использует другой, либо оба они используются третьим пакетом."

#: lazarusidestrconsts:lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sОписание: %s"

#: lazarusidestrconsts:lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sСуществующий файл: %s%s%s"

#: lazarusidestrconsts:lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sСм. Проект -> Инспектор проекта"

#: lazarusidestrconsts:lispckexplstate
msgid "%sState: "
msgstr "%sСостояние: "

#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sСледующие модули будут добавлены к секции uses %s%s:%s%s%s"

#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sЭтот пакет установлен, но файл lpk не найден"

#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sЭтот пакет был создан автоматически"

#: lazarusidestrconsts:uemaddbreakpoint
msgid "&Add Breakpoint"
msgstr "&Добав. точку останова"

#: lazarusidestrconsts:uemclosepage
msgid "&Close Page"
msgstr "&Закрыть страницу"

#: lazarusidestrconsts:lismenucomponents
msgid "&Components"
msgstr "Компоненты"

#: lazarusidestrconsts:lismenuedit
msgid "&Edit"
msgstr "&Правка"

#: lazarusidestrconsts:lismenufile
msgid "&File"
msgstr "&Файл"

#: lazarusidestrconsts:uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Найти описание"

#: lazarusidestrconsts:uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Переход по закладке"

#: lazarusidestrconsts:lismenuhelp
msgid "&Help"
msgstr "&Справка"

#: lazarusidestrconsts:uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Открыть файл у курсора"

#: lazarusidestrconsts:lismenuproject
msgid "&Project"
msgstr "Про&ект"

#: lazarusidestrconsts:dlgreplacewith
msgid "&Replace With"
msgstr "&Заменить на"

#: lazarusidestrconsts:lismenurun
msgid "&Run"
msgstr "&Запуск"

#: lazarusidestrconsts:uemruntocursor
msgid "&Run to Cursor"
msgstr "&Пуск до курсора"

#: lazarusidestrconsts:lismenusearch
msgid "&Search"
msgstr "&Поиск"

#: lazarusidestrconsts:uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Установить закладку"

#: lazarusidestrconsts:dlgtexttofing
msgid "&Text to Find"
msgstr "&Найти текст"

#: lazarusidestrconsts:lismenutools
msgid "&Tools"
msgstr "&Инструменты"

#: lazarusidestrconsts:lismenuview
msgid "&View"
msgstr "&Просмотр"

#: lazarusidestrconsts:lismenuwindows
msgid "&Windows"
msgstr "&Окна"

#: lazarusidestrconsts:dlgbakdirectory
msgid "(no subdirectoy)"
msgstr "(нет подкаталога)"

#: lazarusidestrconsts:listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(неизвестный макрос: %s)"

#: lazarusidestrconsts:lislazarusversionstring
msgid "0.9.9 beta"
msgstr ""

#: lazarusidestrconsts:lislazdocnotagcaption
msgid "<NONE>"
msgstr ""

#: lazarusidestrconsts:lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<выберите существующий файл>"

#: lazarusidestrconsts:lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Не выбрано переменных>"

#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s не может содержать компоненты TControl.%sВ него можно помещать только невизуальные компоненты."

#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Файл %s%s%s уже существует.%s Заменить?"

#: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Модуль паскаля должен иметь расширение .pp или .pas"

#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Требуемый пакет не найден. См. диаграмму пакетов."

#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Нормальный инструмент обязательно должен иметь заголовок и имя файла."

#: lazarusidestrconsts:lismenuabortbuild
msgid "Abort Build"
msgstr "Прервать сборку"

#: lazarusidestrconsts:lismenutemplateabout
msgid "About"
msgstr "О "

#: lazarusidestrconsts:lismenuaboutlazarus
msgid "About Lazarus"
msgstr "О проекте Lazarus"

#: lazarusidestrconsts:srvk_accept
msgid "Accept"
msgstr "Принять"

#: lazarusidestrconsts:liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Действие: %s"

#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Активировать синтаксис регулярных выражений для текста и замены (почти как в perl)"

#: lazarusidestrconsts:liscodetempladd
msgid "Add"
msgstr "Добавить"

#: lazarusidestrconsts:lisaddtoproject
msgid "Add %s to project?"
msgstr "Добавить %s к проекту?"

#: lazarusidestrconsts:uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Добавить &наблюдение у курсора"

#: lazarusidestrconsts:lisa2paddfile
msgid "Add File"
msgstr "Добавить файл"

#: lazarusidestrconsts:lisa2paddfiles
msgid "Add Files"
msgstr "Добавить файлы"

#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Добавить LFM, LRS файлы, если есть"

#: lazarusidestrconsts:lisa2paddunit
msgid "Add Unit"
msgstr "Добавить модуль"

#: lazarusidestrconsts:lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Добавить активный модуль к проекту"

#: lazarusidestrconsts:lispckeditaddanitem
msgid "Add an item"
msgstr "Добавить элемент"

#: lazarusidestrconsts:lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Добавить точку останова"

#: lazarusidestrconsts:liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Добавить шаблон кода"

#: lazarusidestrconsts:lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Добавить файл редактора к Проекту"

#: lazarusidestrconsts:lisprojaddeditorfile
msgid "Add editor files"
msgstr "Добавить файлы редактора"

#: lazarusidestrconsts:lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Добавить файл к пакету"

#: lazarusidestrconsts:lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Добавить файл к проекту"

#: lazarusidestrconsts:lisprojaddfiles
msgid "Add files"
msgstr "Добавить файлы"

#: lazarusidestrconsts:lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Добавить файлы к пакету"

#: lazarusidestrconsts:srkmecaddjumppoint
msgid "Add jump point"
msgstr "Добавить точку перехода"

#: lazarusidestrconsts:lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Добавить точку перехода в историю"

#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Добавить параметры к зависимым пакетам и проектам"

#: lazarusidestrconsts:lislazdocaddpathbutton
msgid "Add path"
msgstr ""

#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Добавить пути к зависимым пакетам/проектам"

#: lazarusidestrconsts:lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Добавить свойства в избранное"

#: lazarusidestrconsts:lisa2paddtopackage
msgid "Add to package"
msgstr "Добавить к пакету"

#: lazarusidestrconsts:lisprojaddtoproject
msgid "Add to project"
msgstr "Добавить к проекту"

#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr ""

#: lazarusidestrconsts:lismenuaddwatch
msgid "Add watch ..."
msgstr "Добавить наблюдение..."

#: lazarusidestrconsts:dlgedadd
msgid "Add..."
msgstr "Добав."

#: lazarusidestrconsts:dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Дополнительные пути исходников для всех проектов (.pp;.pas)"

#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Дополнительные параметры компилятора, унаследованные от пакетов"

#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Дополнительные файлы для поиска (напр. /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts:dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Выровнять верхнюю строку по комментарию"

#: lazarusidestrconsts:fdmalignword
msgid "Align"
msgstr "Выравнивание"

#: lazarusidestrconsts:lisalignment
msgid "Alignment"
msgstr "Выравнивание"

#: lazarusidestrconsts:lisallfiles
msgid "All Files"
msgstr "Все файлы"

#: lazarusidestrconsts:dlgallfiles
msgid "All files"
msgstr "Все файлы"

#: lazarusidestrconsts:lisedtdefallpackages
msgid "All packages"
msgstr "Все пакеты"

#: lazarusidestrconsts:dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Разрешить LABEL и GOTO"

#: lazarusidestrconsts:lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Разрешить поиск для нескольких строк"

#: lazarusidestrconsts:dlgalphabetically
msgid "Alphabetically"
msgstr "По алфавиту"

#: lazarusidestrconsts:lisedtexttoolalt
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts:dlgaltsetclmode
msgid "Alt-Key sets column mode"
msgstr "Кнопка Alt - режим колонок"

#: lazarusidestrconsts:srkmalternkey
msgid "Alternative Key"
msgstr "Альтернативная клавиша"

#: lazarusidestrconsts:lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Неясный тип предка"

#: lazarusidestrconsts:lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Неясное имя класса"

#: lazarusidestrconsts:lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Двусмысленное имя модуля"

#: lazarusidestrconsts:lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Найден модуль с тем же именем"

#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Найден дополнительный файл настроек компилятора с тем же именем"

#: lazarusidestrconsts:dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Неясное действие с файлом:"

#: lazarusidestrconsts:lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Найдены разные файлы"

#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Найден неправильный файл: %s%s%s%sОн может быть перепутан с %s%s%s%s%sУдалить этот файл?"

#: lazarusidestrconsts:lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Найдены разные файлы"

#: lazarusidestrconsts:lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Найдены модули с одинаково опознаваемыми именами"

#: lazarusidestrconsts:lisa2pancestortype
msgid "Ancestor Type"
msgstr "Тип предка"

#: lazarusidestrconsts:lismakeresstrappendtosection
msgid "Append to section"
msgstr "Добавить к секции"

#: lazarusidestrconsts:dlgpoapplication
msgid "Application"
msgstr "Приложение"

#: lazarusidestrconsts:dlgapplicationsettings
msgid "Application Settings"
msgstr "Параметры приложения"

#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr "Приложение%sГрафическая программа на lcl/freepascal. Программный файл автоматически поддерживается lazarus."

#: lazarusidestrconsts:dlgbutapply
msgid "Apply"
msgstr "Применить"

#: lazarusidestrconsts:lispckeditapplychanges
msgid "Apply changes"
msgstr "Применить"

#: lazarusidestrconsts:rslanguagearabic
msgid "Arabic"
msgstr "Арабский"

#: lazarusidestrconsts:dlgcoasis
msgid "As-Is"
msgstr "Как-есть"

#: lazarusidestrconsts:lissortselascending
msgid "Ascending"
msgstr "Наследуемый"

#: lazarusidestrconsts:dlgenvask
msgid "Ask"
msgstr "Спросить"

#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Спросить перед заменой каждого фрагмента"

#: lazarusidestrconsts:liscodetoolsoptsat
msgid "At"
msgstr "At"

#: lazarusidestrconsts:lispckoptsauthor
msgid "Author:"
msgstr "Автор:"

#: lazarusidestrconsts:dlgautoform
msgid "Auto create form when opening unit"
msgstr "Автосоздание форм при открытии модуля"

#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Автосоздаваемые элементы не могут ни редактироваться,%s ни содержать неавтосоздаваемые дочерние элементы"

#: lazarusidestrconsts:dlgautodel
msgid "Auto delete file"
msgstr "Автоудаление файлов"

#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Автосоздаваемые элементы не могут редактироваться."

#: lazarusidestrconsts:dlgautoident
msgid "Auto indent"
msgstr "Автовыделение"

#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Пересобрать при пересборке всех"

#: lazarusidestrconsts:dlgautoren
msgid "Auto rename file lowercase"
msgstr "Автопереименование в нижний регистр"

#: lazarusidestrconsts:dlgautosave
msgid "Auto save"
msgstr "Автосохранение"

#: lazarusidestrconsts:dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Автосоздаваемые формы:"

#: lazarusidestrconsts:lispckexplautocreated
msgid "AutoCreated"
msgstr "Автосоздан"

#: lazarusidestrconsts:rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Автоматически (или английский)"

#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Автоматически увеличить версию при сборке"

#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Автоустановленные пакеты"

#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Автоматически пересобирать по необходимости"

#: lazarusidestrconsts:dlgavailableforms
msgid "Available forms:"
msgstr "Доступные формы:"

#: lazarusidestrconsts:lisavailablepackages
msgid "Available packages"
msgstr "Доступные пакеты"

#: lazarusidestrconsts:dlgedback
msgid "Back"
msgstr "Назад"

#: lazarusidestrconsts:fdmorderbackone
msgid "Back one"
msgstr "Один назад"

#: lazarusidestrconsts:dlgbackcolor
msgid "Background"
msgstr ""

#: lazarusidestrconsts:srvk_back
msgid "Backspace"
msgstr "Забой"

#: lazarusidestrconsts:dlgenvbckup
msgid "Backup"
msgstr "Резервирование"

#: lazarusidestrconsts:lisbackupfilefailed
msgid "Backup file failed"
msgstr "Резервирование не удалось"

#: lazarusidestrconsts:lisfrbackwardsearch
msgid "Backward search"
msgstr "Обратный поиск"

#: lazarusidestrconsts:dlgbehindmethods
msgid "Behind methods"
msgstr "После методов"

#: lazarusidestrconsts:lispkgfiletypebinary
msgid "Binary"
msgstr "Двоичный"

#: lazarusidestrconsts:liscodetoolsdefsblock
msgid "Block"
msgstr "Блок"

#: lazarusidestrconsts:dlgblockindent
msgid "Block indent:"
msgstr "Выделение блока:"

#: lazarusidestrconsts:dlgedbold
msgid "Bold"
msgstr "Жирный"

#: lazarusidestrconsts:uembookmarkn
msgid "Bookmark"
msgstr "Закладка"

#: lazarusidestrconsts:lisbottomspaceequally
msgid "Bottom space equally"
msgstr ""

#: lazarusidestrconsts:lisbottoms
msgid "Bottoms"
msgstr ""

#: lazarusidestrconsts:dlgbrachighlight
msgid "Bracket highlighting"
msgstr "Подсветка скобок"

#: lazarusidestrconsts:lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Разрыв строк в выделенном"

#: lazarusidestrconsts:srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Разорвать строку, сдвинуть курсор"

#: lazarusidestrconsts:srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Разорвать строку, оставить курсор"

#: lazarusidestrconsts:lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Точки останова"

#: lazarusidestrconsts:lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Нарушенные зависимости"

#: lazarusidestrconsts:lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Нарушенная зависимость"

#: lazarusidestrconsts:lispatheditbrowse
msgid "Browse"
msgstr "Обзор"

#: lazarusidestrconsts:lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Обзор (поиск компилятора) (%s)"

#: lazarusidestrconsts:dlgunitdepbrowse
msgid "Browse..."
msgstr "Обзор..."

#: lazarusidestrconsts:lismenubuild
msgid "Build"
msgstr "Сборка"

#: lazarusidestrconsts:lisbuildcodetools
msgid "Build CodeTools"
msgstr "Собрать CodeTools"

#: lazarusidestrconsts:lisbuildcomponent
msgid "Build Component"
msgstr "Собрать компонент"

#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
msgid "Build Components (SynEdit, CodeTools)"
msgstr "Собрать компоненты (SynEdit, CodeTools)"

#: lazarusidestrconsts:lisbuildexamples
msgid "Build Examples"
msgstr "Собрать примеры"

#: lazarusidestrconsts:lismenubuildfile
msgid "Build File"
msgstr "Собрать файл"

#: lazarusidestrconsts:lisbuildide
msgid "Build IDE"
msgstr "Собрать IDE"

#: lazarusidestrconsts:lisbuildideintf
msgid "Build IDE Interface"
msgstr "Собрать интерфейс IDE"

#: lazarusidestrconsts:lisbuildjitform
msgid "Build JIT Form"
msgstr "Собрать JIT Form"

#: lazarusidestrconsts:lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Собрать JITForm"

#: lazarusidestrconsts:lisbuildlcl
msgid "Build LCL"
msgstr "Собрать LCL"

#: lazarusidestrconsts:lismenubuildlazarus
msgid "Build Lazarus"
msgstr "Собрать Lazarus"

#: lazarusidestrconsts:lisbuildnumber
msgid "Build Number"
msgstr "Номер сборки"

#: lazarusidestrconsts:lisbuildpkgreg
msgid "Build Package Registration"
msgstr "Зарегистрировать пакет"

#: lazarusidestrconsts:lisbuildstarter
msgid "Build Starter"
msgstr "Собрать Загрузчик"

#: lazarusidestrconsts:lisbuildsynedit
msgid "Build SynEdit"
msgstr "Собрать SynEdit"

#: lazarusidestrconsts:lismenubuildall
msgid "Build all"
msgstr "Собрать все"

#: lazarusidestrconsts:srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Собрать lazarus"

#: lazarusidestrconsts:lisbuildnewproject
msgid "Build new project"
msgstr "Собрать новый проект"

#: lazarusidestrconsts:dlgcmacro
msgid "C Style Macros (global)"
msgstr "Макросы стиля C (глобально)"

#: lazarusidestrconsts:dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Операторы стиля C (*=, +=, /= and -=)"

#: lazarusidestrconsts:dlgcppinline
msgid "C++ Styled INLINE"
msgstr "INLINE стиля C++"

#: lazarusidestrconsts:lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "Ключ CVS"

#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Вызвать процедуру %sRegister%s выбранного модуля"

#: lazarusidestrconsts:lismenuviewcallstack
msgid "Call Stack"
msgstr "Стек вызовов"

#: lazarusidestrconsts:liscocallon
msgid "Call on:"
msgstr "Вызов:"

#: lazarusidestrconsts:liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Не могу скопировать компонент верхнего уровня."

#: lazarusidestrconsts:liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Не могу создать файл %s%s%s"

#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Не могу зарегистрировать компоненты без модуля"

#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Возможно только изменить класс TComponents."

#: lazarusidestrconsts:dlgcancel
msgid "Cancel"
msgstr "Отмена"

#: lazarusidestrconsts:lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Не могу найти список благодарностей"

#: lazarusidestrconsts:liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Не могу найти пускатель lazarus:%s%s"

#: lazarusidestrconsts:srvk_capital
msgid "Capital"
msgstr "Заглавный"

#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Нечувствительный к регистру"

#: lazarusidestrconsts:dlgcasesensitive
msgid "Case Sensitive"
msgstr "С учетом регистра"

#: lazarusidestrconsts:lisfindfilecasesensitive
msgid "Case sensitive"
msgstr "С учётом регистра"

#: lazarusidestrconsts:rslanguagecatalan
msgid "Catalan"
msgstr "Каталанский"

#: lazarusidestrconsts:dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Курсор в центре"

#: lazarusidestrconsts:liscenterinwindow
msgid "Center in window"
msgstr "Центр окна"

#: lazarusidestrconsts:liscenters
msgid "Centers"
msgstr "Центры"

#: lazarusidestrconsts:liscodetemplchange
msgid "Change"
msgstr "Изменить"

#: lazarusidestrconsts:lischangeclass
msgid "Change Class"
msgstr "Изменить класс"

#: lazarusidestrconsts:lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Элемент ChangeLog"

#: lazarusidestrconsts:lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Изменённые файлы:"

#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Изменение имени пакета или версии нарушит зависимости. Изменить ли эти зависимости?%sВыберите Да для замены всех перечисленных зависимостей.%sПропуск - для разрыва зависимостей и продолжения."

#: lazarusidestrconsts:srkmecchar
msgid "Char"
msgstr "Символ"

#: lazarusidestrconsts:lischaractermap
msgid "Character Map"
msgstr "Таблица символов"

#: lazarusidestrconsts:lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Проверить файл LFM в редакторе"

#: lazarusidestrconsts:dlgcheckconsistency
msgid "Check consistency"
msgstr "Целостность?"

#: lazarusidestrconsts:dlgcochecks
msgid "Checks:"
msgstr "Проверка:"

#: lazarusidestrconsts:lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Выберите проект Delphi (*.dpr)"

#: lazarusidestrconsts:lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Выберите модуль Delphi (*.pas)"

#: lazarusidestrconsts:lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Выберите каталог"

#: lazarusidestrconsts:lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Выберите каталог исходников FPC"

#: lazarusidestrconsts:lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Выберите каталог Lazarus"

#: lazarusidestrconsts:lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Выбрать схему"

#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Выберите базовый класс для избранного свойства %s%s%s."

#: lazarusidestrconsts:lischooseadifferentname
msgid "Choose a different name"
msgstr "Выберите другое имя"

#: lazarusidestrconsts:dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Выберите файл шаблонов кода (*.dci)"

#: lazarusidestrconsts:lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Выберите имя компилятора (%s)"

#: lazarusidestrconsts:lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Выберите имя отладчика"

#: lazarusidestrconsts:lischoosedirectory
msgid "Choose directory"
msgstr "Выбор каталога"

#: lazarusidestrconsts:lischoosemakepath
msgid "Choose make path"
msgstr "Выберите путь make"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Выберите один из этих элементов для создания нового файла"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Выберите один из этих элементов для создания нового Пакета"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Выберите один из этих элементов для создания нового Проекта"

#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Выберите исходник программы (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts:lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Выберите структуру для заключения в неё выделения"

#: lazarusidestrconsts:lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Выберите каталог для проб"

#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Циклическая зависимость пакетов"

#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Класс %s%s%s - не зарегистрированный класс компонента.%sНе могу вставить."

#: lazarusidestrconsts:lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Класс %s%s%s не найден."

#: lazarusidestrconsts:lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Имя класса уже существует"

#: lazarusidestrconsts:lisclassnotfound
msgid "Class not found"
msgstr "Класс не найден"

#: lazarusidestrconsts:dlgcdtclassorder
msgid "Class order"
msgstr "В порядке классов"

#: lazarusidestrconsts:dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Политика вставки частей класса"

#: lazarusidestrconsts:liscldircleandirectory
msgid "Clean Directory"
msgstr "Очистить каталог"

#: lazarusidestrconsts:liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Очистить исходники Lazarus"

#: lazarusidestrconsts:lislazbuildcleanall
msgid "Clean all"
msgstr "Очистить всё"

#: lazarusidestrconsts:lismenucleandirectory
msgid "Clean directory"
msgstr "Очистить каталог"

#: lazarusidestrconsts:liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Очистить подкаталоги"

#: lazarusidestrconsts:lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Очистить+Собрать"

#: lazarusidestrconsts:srvk_clear
msgid "Clear"
msgstr "Очистить"

#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Выберите один из элементов выше, чтобы увидеть разницу"

#: lazarusidestrconsts:lismenuclose
msgid "Close"
msgstr "Закрыть"

#: lazarusidestrconsts:srkmeccloseall
msgid "Close all"
msgstr "Закрыть все"

#: lazarusidestrconsts:lismenucloseall
msgid "Close all editor files"
msgstr "Закрыть все файлы редактора"

#: lazarusidestrconsts:dlgcodegeneration
msgid "Code"
msgstr "Код"

#: lazarusidestrconsts:dlgcodecreation
msgid "Code Creation"
msgstr "Создание кода"

#: lazarusidestrconsts:lismenuviewcodeexplorer
msgid "Code Explorer"
msgstr "Обозреватель кода"

#: lazarusidestrconsts:lismenueditcodetemplates
msgid "Code Templates"
msgstr "Шаблоны кода"

#: lazarusidestrconsts:dlgcodetoolstab
msgid "Code Tools"
msgstr "CodeTools"

#: lazarusidestrconsts:dlgedcodeparams
msgid "Code parameters"
msgstr "Параметры кода"

#: lazarusidestrconsts:srkmecautocompletion
msgid "Code template completion"
msgstr "Завершение шаблонов кода"

#: lazarusidestrconsts:dlgedcodetempl
msgid "Code templates"
msgstr "Шаблоны кода"

#: lazarusidestrconsts:lisceocodeexplorer
msgid "CodeExplorer Options"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Просмотр настроек CodeTools"

#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Параметры каталогов CodeTools"

#: lazarusidestrconsts:dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Настройки CodeTools"

#: lazarusidestrconsts:srkmcatcodetools
msgid "CodeTools commands"
msgstr "Команды CodeTools"

#: lazarusidestrconsts:lismenucodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Настройки редактора CodeTools"

#: lazarusidestrconsts:lismenucodetoolsoptions
msgid "CodeTools options"
msgstr "Настройки CodeTools"

#: lazarusidestrconsts:srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr ""

#: lazarusidestrconsts:srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Настройки Codetools"

#: lazarusidestrconsts:lismenucollectpofil
msgid "Collect .po files"
msgstr "Собрать файлы .po"

#: lazarusidestrconsts:liscodetoolsoptscolon
msgid "Colon"
msgstr "Колонка"

#: lazarusidestrconsts:dlgedcolor
msgid "Color"
msgstr "Цвет"

#: lazarusidestrconsts:dlgclrscheme
msgid "Color Scheme:"
msgstr "Цветовая схема:"

#: lazarusidestrconsts:dlgenvcolors
msgid "Colors"
msgstr "Цвета"

#: lazarusidestrconsts:srkmeccolumnselect
msgid "Column selection mode"
msgstr "Режим выбора колонки"

#: lazarusidestrconsts:liscodetoolsoptscomma
msgid "Comma"
msgstr "Запятая"

#: lazarusidestrconsts:srkmcommand
msgid "Command "
msgstr "Команда"

#: lazarusidestrconsts:liscommandafter
msgid "Command after"
msgstr ""

#: lazarusidestrconsts:liscommandafterinvalid
msgid "Command after invalid"
msgstr "Команда \"после\" некорректна"

#: lazarusidestrconsts:liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Команда после установки модуля"

#: lazarusidestrconsts:srkmcatcmdcmd
msgid "Command commands"
msgstr "Команда команды"

#: lazarusidestrconsts:dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Параметры командной строки (без имени приложения)"

#: lazarusidestrconsts:liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Параметры командной строки программы"

#: lazarusidestrconsts:liscocommand
msgid "Command:"
msgstr "Команда:"

#: lazarusidestrconsts:lismenucommentselection
msgid "Comment selection"
msgstr "Закомментировать"

#: lazarusidestrconsts:liscodetemplcomment
msgid "Comment:"
msgstr "Комментарий:"

#: lazarusidestrconsts:dlgcocompilation
msgid "Compilation"
msgstr "Компиляция"

#: lazarusidestrconsts:liscocalloncompile
msgid "Compile"
msgstr "Компилировать"

#: lazarusidestrconsts:liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Компиляция IDE (без сборки)"

#: lazarusidestrconsts:lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Собрать всё?"

#: lazarusidestrconsts:lispckeditcompilepackage
msgid "Compile package"
msgstr "Собрать пакет"

#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "добавление CompiledSrcPath"

#: lazarusidestrconsts:liscompiler
msgid "Compiler"
msgstr "Компилятор"

#: lazarusidestrconsts:dlgcompileroptions
msgid "Compiler Options"
msgstr "Опции компилятора"

#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Параметры компилятора для пакета %s"

#: lazarusidestrconsts:liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Параметры компилятора для проекта: %s"

#: lazarusidestrconsts:lismenucompileroptions
msgid "Compiler Options..."
msgstr "Параметры компилятора..."

#: lazarusidestrconsts:liscompilererror
msgid "Compiler error"
msgstr "Ошибка компилятора"

#: lazarusidestrconsts:liscompilerfilename
msgid "Compiler filename"
msgstr "Имя файла компилятора"

#: lazarusidestrconsts:dlgfpcpath
msgid "Compiler path (%s)"
msgstr "Путь компилятора (%s)"

#: lazarusidestrconsts:lismenucompletecode
msgid "Complete Code"
msgstr "Завершить код"

#: lazarusidestrconsts:srkmeccompletecode
msgid "Complete code"
msgstr "Завершить код"

#: lazarusidestrconsts:dlgcompleteproperties
msgid "Complete properties"
msgstr "Завершать свойства"

#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Класс компонента %s%s%s уже определён"

#: lazarusidestrconsts:liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Имя компонента %s%s%s зарезервировано"

#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Имя компонента %s%s%s - некорректный идентификатор"

#: lazarusidestrconsts:srkmcatcomponentsmenu
msgid "Components menu commands"
msgstr "Команды компонентов меню"

#: lazarusidestrconsts:dlgconfigfiles
msgid "Config Files:"
msgstr "Файлы настроек:"

#: lazarusidestrconsts:lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Настроить %sСобрать Lazarus%s"

#: lazarusidestrconsts:lismenuconfigbuildfile
msgid "Configure Build+Run File"
msgstr "Настроить Собрать+Запустить Файл"

#: lazarusidestrconsts:lismenuconfigurehelp
msgid "Configure Help"
msgstr "Настроить Справку"

#: lazarusidestrconsts:lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Настроить \"Собрать Lazarus\""

#: lazarusidestrconsts:lismenuconfigcustomcomps
msgid "Configure custom components"
msgstr "Настроить компоненты пользователя"

#: lazarusidestrconsts:lismenusettings
msgid "Configure custom tools ..."
msgstr "Настроить инструменты пользователя"

#: lazarusidestrconsts:lismenueditinstallpkgs
msgid "Configure installed packages"
msgstr "Настроить установленные пакеты"

#: lazarusidestrconsts:lisconfirmchanges
msgid "Confirm changes"
msgstr "Подтвердить изменения"

#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Подтвердите удаление зависимости"

#: lazarusidestrconsts:lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Подтвердите удаление файла"

#: lazarusidestrconsts:srkmconflic
msgid "Conflict "
msgstr "Конфликт "

#: lazarusidestrconsts:dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Конструктор должен быть 'init' (деструктор - 'done')"

#: lazarusidestrconsts:lismenutemplatecontents
msgid "Contents"
msgstr "Содержание"

#: lazarusidestrconsts:lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Справка, зависимая от контекста"

#: lazarusidestrconsts:liscontributors
msgid "Contributors"
msgstr "Благодарности"

#: lazarusidestrconsts:srvk_control
msgid "Control"
msgstr "Элемент управления"

#: lazarusidestrconsts:liscontrolneedsparent
msgid "Control needs parent"
msgstr "Элемент управления требует \"родителя\""

#: lazarusidestrconsts:lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Настройки преобразований"

#: lazarusidestrconsts:lisconversionerror
msgid "Conversion error"
msgstr "Ошибка преобразования"

#: lazarusidestrconsts:srvk_convert
msgid "Convert"
msgstr "Преобразовать"

#: lazarusidestrconsts:lismenuconvertdfmtolfm
msgid "Convert DFM file to LFM"
msgstr "Преобразовать DFM в LFM"

#: lazarusidestrconsts:lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Преобразовать проект Delphi в проект Lazarus"

#: lazarusidestrconsts:lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Преобразовать модуль Delphi в Lazarus"

#: lazarusidestrconsts:liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Преобразовать элемент"

#: lazarusidestrconsts:srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Преобразовать ТАБ в пробелы в выделенном"

#: lazarusidestrconsts:lismenucopy
msgid "Copy"
msgstr "Копировать"

#: lazarusidestrconsts:liscopyerror
msgid "Copy Error"
msgstr "Ошибка копирования"

#: lazarusidestrconsts:liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr "Скопировать все сообщения в буфер"

#: lazarusidestrconsts:liscopyerror2
msgid "Copy error"
msgstr "Ошибка копирования"

#: lazarusidestrconsts:lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Скопировать выбранные компоненты в буфер"

#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr ""

#: lazarusidestrconsts:srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Копировать выделение в буфер"

#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Слово при пустом копировании"

#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Копирование всей формы не реализовано."

#: lazarusidestrconsts:lislgplnotice
msgid "Copyright (C) <year> <name of author>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "Авторское право (С) <год> <имя автора>%sЭта библиотека - бесплатное ПО; Вы можете распространять её и/или изменять по условиям GNU Library General Public License как опубликовано Free Software Foundation; или версии 2 Лицензии, или (на Ваш выбор) любой поздней версии. %sЭта программа распространяется с надеждой быть полезной, но БЕЗО ВСЯКОЙ ГАРАНТИИ; даже без подразумеваемой ТОРГОВОЙ гарантии или СООТВЕТСТВИЯ ОПРЕДЕЛЁННОЙ ЦЕЛИ. См. GNU Library General Public License для дальнейшей информации. %sВы должны были получить копию GNU Library General Public License с этой библиотекой; если нет, пишите в Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, США."

#: lazarusidestrconsts:lisgplnotice
msgid "Copyright (C) <year> <name of author>%sThis program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "Авторское право (С) <год> <имя автора>%sЭта программа - бесплатное ПО; Вы можете распространять её и/или изменять по условиям GNU General Public License как опубликовано Free Software Foundation; или версии 2 Лицензии, или (на Ваш выбор) любой поздней версии. %sЭта программа распространяется с надеждой быть полезной, но БЕЗО ВСЯКОЙ ГАРАНТИИ; даже без подразумеваемой ТОРГОВОЙ гарантии или СООТВЕТСТВИЯ ОПРЕДЕЛЁННОЙ ЦЕЛИ. См. GNU General Public License для дальнейшей информации. %sВы должны были получить копию GNU Library General Public License с этой программой; если нет, пишите в Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, США."

#: lazarusidestrconsts:dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Счетчик (.pp;1)"

#: lazarusidestrconsts:lisnpcreate
msgid "Create"
msgstr "Создать"

#: lazarusidestrconsts:lismenucreatepofile
msgid "Create .po files"
msgstr "Создать файлы .po"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Создать настройки для %s Каталога"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Создать настройки для %s Проекта"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcvssources
msgid "Create Defines for Free Pascal CVS Sources"
msgstr "Создать настройки для исходников CVS FPC"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Создать настройки для компилятора FreePascal"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Создать настройки для каталога Lazarus"

#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Создать макросы FPC и пути к каталогу проекта FPC"

#: lazarusidestrconsts:lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Создать подменю"

#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr "Создать новое приложение cgi.%sФайл программы поддерживается Lazarus"

#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Создать новый файл редактора.%s Выберите тип."

#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Создать новый пустой текстовый файл."

#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr "Создать новое графическое приложение.%sЭта программа поддерживается Lazarus."

#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Создать модуль паскаля."

#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Создать программу."

#: lazarusidestrconsts:lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr "Создать программу.%sФайл программы поддерживается Lazarus."

#: lazarusidestrconsts:lisnpcreateanewproject
msgid "Create a new project"
msgstr "Создать новый проект"

#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Создать проект.%sВыберите тип."

#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Создать стандартный пакет%sПакет - это набор модулей и компонентов."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Создать модуль с формой LCL."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Создать модуль с модулем данных."

#: lazarusidestrconsts:liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Создайте сперва проект!"

#: lazarusidestrconsts:lisa2pcreatenewfile
msgid "Create new file"
msgstr ""

#: lazarusidestrconsts:dlgruberbandcreationcolor
msgid "Creation"
msgstr "Создание"

#: lazarusidestrconsts:lisedtexttoolctrl
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts:lisedtdefcurrentproject
msgid "Current Project"
msgstr "Текущий проект"

#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Каталог текущего проекта"

#: lazarusidestrconsts:lismenuinsertdatetime
msgid "Current date and time"
msgstr "Текущие дата и время"

#: lazarusidestrconsts:lismenuinsertusername
msgid "Current username"
msgstr "Текущее имя пользователя"

#: lazarusidestrconsts:dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Курсор вне конца строки"

#: lazarusidestrconsts:liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Колонка курсора в этом редакторе"

#: lazarusidestrconsts:srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Команды перемещения курсора"

#: lazarusidestrconsts:liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Ряд курсора в этом редакторе"

#: lazarusidestrconsts:lispckoptscustom
msgid "Custom"
msgstr "Пользовательский"

#: lazarusidestrconsts:lismakeresstrcustomidentifier
msgid "Custom Identifier"
msgstr "Пользовательский ID"

#: lazarusidestrconsts:liscustomprogram
msgid "Custom Program"
msgstr "Программа пользователя"

#: lazarusidestrconsts:liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr "Программа пользователя%sПрограмма на языке FreePascal"

#: lazarusidestrconsts:liskeycatcustom
msgid "Custom commands"
msgstr "Команды пользователя"

#: lazarusidestrconsts:liscustomoptions2
msgid "Custom options"
msgstr "Параметры пользователя"

#: lazarusidestrconsts:rsiwpcustomposition
msgid "Custom position"
msgstr "Пользовательская позиция"

#: lazarusidestrconsts:srkmeccustomtool
msgid "Custom tool %d"
msgstr "Инструмент пользователя %d"

#: lazarusidestrconsts:lismenucut
msgid "Cut"
msgstr "Вырезать"

#: lazarusidestrconsts:lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Вырезать выбранные компоненты в буфер"

#: lazarusidestrconsts:srkmeccut
msgid "Cut selection to clipboard"
msgstr "Вырезать выделение в буфер"

#: lazarusidestrconsts:lishlpoptsdatabases
msgid "Databases"
msgstr "Базы данных"

#: lazarusidestrconsts:lisdate
msgid "Date"
msgstr "Дата"

#: lazarusidestrconsts:uemdebugword
msgid "Debug"
msgstr "Отладка"

#: lazarusidestrconsts:lismenuviewdebugoutput
msgid "Debug output"
msgstr "Вывод отладчика"

#: lazarusidestrconsts:lismenudebugwindows
msgid "Debug windows"
msgstr "Окно отладки..."

#: lazarusidestrconsts:lismendebuggeroptions
msgid "Debugger Options"
msgstr "Параметры отладчика"

#: lazarusidestrconsts:lisdebuggererror
msgid "Debugger error"
msgstr "Ошибка отладчика"

#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Ошибка отладчика%sОп, отладчик находится в нерабочем состоянии%sСохраните работу!%sНажмите Стоп и надейтесь на лучшее!"

#: lazarusidestrconsts:lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Неправильный отладчик"

#: lazarusidestrconsts:dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Дополнения к путям отладчика (нет):"

#: lazarusidestrconsts:dlgdebugtype
msgid "Debugger type and path"
msgstr "Тип отладчика и путь"

#: lazarusidestrconsts:dlgcodebugging
msgid "Debugging:"
msgstr "Отладка:"

#: lazarusidestrconsts:rsiwpdefault
msgid "Default"
msgstr "По умолчанию"

#: lazarusidestrconsts:dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Шрифт редактора по умолчанию"

#: lazarusidestrconsts:dlgpasext
msgid "Default pascal extension"
msgstr "Стандартное расширение паскаля"

#: lazarusidestrconsts:dlgdefvaluecolor
msgid "Default value"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsdefine
msgid "Define"
msgstr "Определение"

#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Определить рекурсивно"

#: lazarusidestrconsts:dlgeddelay
msgid "Delay"
msgstr "Задержка"

#: lazarusidestrconsts:dlgeddelete
msgid "Delete"
msgstr "Удалить"

#: lazarusidestrconsts:lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Удалить шаблон формы"

#: lazarusidestrconsts:lismenueditordeleteitem
msgid "Delete Item"
msgstr "Удалить элемент"

#: lazarusidestrconsts:srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Удалить последний символ"

#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Удалить старый файл пакета?"

#: lazarusidestrconsts:lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr ""

#: lazarusidestrconsts:lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Удалить файл с подобным именем?"

#: lazarusidestrconsts:srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Удалить символ у курсора"

#: lazarusidestrconsts:srkmecdeleteline
msgid "Delete current line"
msgstr "Удалить текущую строку"

#: lazarusidestrconsts:lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Удалить зависимость для %s?"

#: lazarusidestrconsts:lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Удаление не удалось"

#: lazarusidestrconsts:lisdeletefilefailed
msgid "Delete file failed"
msgstr "Удаление файла не удалось"

#: lazarusidestrconsts:liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Удалить элемент"

#: lazarusidestrconsts:lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Удалить старый файл %s%s%s?"

#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Удалить старый файл пакета %s%s%s?"

#: lazarusidestrconsts:fdmdeleteselection
msgid "Delete selection"
msgstr "Удалить выбранное"

#: lazarusidestrconsts:dlgdeltemplate
msgid "Delete template "
msgstr "Удалить шаблон "

#: lazarusidestrconsts:srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Удалить до начала строки"

#: lazarusidestrconsts:srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Удалить до конца строки"

#: lazarusidestrconsts:srkmecdeleteword
msgid "Delete to end of word"
msgstr "Удалить до конца слова"

#: lazarusidestrconsts:srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Удалить до начала слова"

#: lazarusidestrconsts:srkmecclearall
msgid "Delete whole text"
msgstr "Удалить весь текст"

#: lazarusidestrconsts:lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Удаление файла  %s%s%s не удалось."

#: lazarusidestrconsts:dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Расширения Delphi 2"

#: lazarusidestrconsts:dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Совместимость с Delphi"

#: lazarusidestrconsts:lisdelphiproject
msgid "Delphi project"
msgstr ""

#: lazarusidestrconsts:lisa2pdependency
msgid "Dependency"
msgstr "Зависимость"

#: lazarusidestrconsts:lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Свойства зависимости"

#: lazarusidestrconsts:lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Зависимость уже есть"

#: lazarusidestrconsts:lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Зависимость без владельца:%s"

#: lazarusidestrconsts:lissortseldescending
msgid "Descending"
msgstr "По убыванию"

#: lazarusidestrconsts:listodoldescription
msgid "Description"
msgstr "Описание"

#: lazarusidestrconsts:lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Описание/кратко"

#: lazarusidestrconsts:liscodetoolsdefsdescription
msgid "Description:"
msgstr "Описание:"

#: lazarusidestrconsts:lisoipdescription
msgid "Description:  "
msgstr "Описание: "

#: lazarusidestrconsts:liskeycatdesigner
msgid "Designer commands"
msgstr "Команды дизайнера"

#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "При разработке и запуске"

#: lazarusidestrconsts:lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Только для разработки"

#: lazarusidestrconsts:dlgdesktop
msgid "Desktop"
msgstr "Рабочий стол"

#: lazarusidestrconsts:dlgdesktopfiles
msgid "Desktop files"
msgstr "Файлы рабочего стола"

#: lazarusidestrconsts:lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Пакет назначения"

#: lazarusidestrconsts:lisdestinationdirectory
msgid "Destination directory"
msgstr ""

#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Каталог %s%s%s некорркетен.%sВыберите путь к компилятору."

#: lazarusidestrconsts:rslanguagedeutsch
msgid "Deutsch"
msgstr "Немецкий"

#: lazarusidestrconsts:lismenudiff
msgid "Diff"
msgstr "Разница Diff"

#: lazarusidestrconsts:dlgdirection
msgid "Direction"
msgstr "Направление"

#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Каталог"

#: lazarusidestrconsts:dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Каталог не существует"

#: lazarusidestrconsts:dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Каталог для сборки пробных проектов"

#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Каталог не найден"

#: lazarusidestrconsts:lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Настройки каталогов"

#: lazarusidestrconsts:dlgeddisplay
msgid "Display"
msgstr "Дисплей"

#: lazarusidestrconsts:dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Дисплей (не для win32, напр., 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts:dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Выдать номера строк в ошибках времени исполнения"

#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Различать регистр букв, например, А и а"

#: lazarusidestrconsts:lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr ""

#: lazarusidestrconsts:dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Не разрывать строку перед:"

#: lazarusidestrconsts:dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Не разрывать строку после:"

#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Вы действительно хотите сбросить все изменения в пакете %s и загрузить его из файла?"

#: lazarusidestrconsts:rsiwpdocked
msgid "Docked"
msgstr "Прикреплён"

#: lazarusidestrconsts:lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Редактор документации"

#: lazarusidestrconsts:lislazdocnodocumentation
msgid "Documentation entry does not exist"
msgstr ""

#: lazarusidestrconsts:lissortseldomain
msgid "Domain"
msgstr ""

#: lazarusidestrconsts:dlgdoubleclickline
msgid "Double click line"
msgstr "Выделить строку дв. щелчком"

#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr "Двойной щелчёк на переходах по сообщениям (иначе - одинарный)"

#: lazarusidestrconsts:dlgdownword
msgid "Down"
msgstr "Вниз"

#: lazarusidestrconsts:dlgdragdroped
msgid "Drag Drop editing"
msgstr ""

#: lazarusidestrconsts:dlgdropfiles
msgid "Drop files"
msgstr "Бросить файлы"

#: lazarusidestrconsts:lismenuenvironent
msgid "E&nvironment"
msgstr "&Окружение"

#: lazarusidestrconsts:liscodetoolsdefsedit
msgid "Edit"
msgstr "Правка"

#: lazarusidestrconsts:lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Изменить общие настройки"

#: lazarusidestrconsts:srkmeditkeys
msgid "Edit Keys"
msgstr "Изменить клавиши"

#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Изменить настройки для компиляции пакета"

#: lazarusidestrconsts:lisedtexttooledittool
msgid "Edit Tool"
msgstr "Инструмент правки"

#: lazarusidestrconsts:liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Править шаблоны кода"

#: lazarusidestrconsts:srkmeditforcmd
msgid "Edit keys for command"
msgstr "Править клавиши для команды"

#: lazarusidestrconsts:dlgededit
msgid "Edit..."
msgstr "Правка"

#: lazarusidestrconsts:dlgedfiles
msgid "Editor files"
msgstr "Файлы редактора"

#: lazarusidestrconsts:dlgeditorfont
msgid "Editor font"
msgstr "Шрифт редактора"

#: lazarusidestrconsts:dlgeditorfontheight
msgid "Editor font height"
msgstr "Высота шрифта"

#: lazarusidestrconsts:lismenueditoroptions
msgid "Editor options"
msgstr "Настройки редактора"

#: lazarusidestrconsts:uemeditorproperties
msgid "Editor properties"
msgstr "Настройки редактора"

#: lazarusidestrconsts:dlgedelement
msgid "Element"
msgstr "Элемент"

#: lazarusidestrconsts:liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts:liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts:lisenclose
msgid "Enclose"
msgstr "Заключить"

#: lazarusidestrconsts:uemencloseselection
msgid "Enclose Selection"
msgstr "Заключить выделенное"

#: lazarusidestrconsts:lismenuencloseselection
msgid "Enclose selection"
msgstr "Заключить выделение в..."

#: lazarusidestrconsts:srvk_end
msgid "End"
msgstr "End"

#: lazarusidestrconsts:rslanguageenglish
msgid "English"
msgstr "Английский"

#: lazarusidestrconsts:lismacropromptenterdata
msgid "Enter data"
msgstr "Введите данные"

#: lazarusidestrconsts:lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Введите параметры запуска"

#: lazarusidestrconsts:lisentertransla
msgid "Enter translation language"
msgstr "Введите язык перевода"

#: lazarusidestrconsts:dlgentirescope
msgid "Entire Scope"
msgstr "С начала"

#: lazarusidestrconsts:dlgrunoenvironment
msgid "Environment"
msgstr "Окружения"

#: lazarusidestrconsts:srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Команды меню окружения"

#: lazarusidestrconsts:lismenugeneraloptions
msgid "Environment options"
msgstr "Параметры окружения"

#: lazarusidestrconsts:liscodetemplerror
msgid "Error"
msgstr "Ошибка"

#: lazarusidestrconsts:lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Ошибка чтения пакета"

#: lazarusidestrconsts:lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Ошибка записи пакета"

#: lazarusidestrconsts:liserrorcreatingfile
msgid "Error creating file"
msgstr "Ошибка создания файла"

#: lazarusidestrconsts:liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Ошибка создания lrs"

#: lazarusidestrconsts:liserrordeletingfile
msgid "Error deleting file"
msgstr "Ошибка удаления файла"

#: lazarusidestrconsts:liserrorin
msgid "Error in %s"
msgstr "Ошибка в %s"

#: lazarusidestrconsts:lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Ошибка в регулярном выражении"

#: lazarusidestrconsts:liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Ошибка инициализации программы %s%s%s%s%sОшибка: %s"

#: lazarusidestrconsts:liserrormovingcomponent
msgid "Error moving component"
msgstr "Ошибка перемещения компонента"

#: lazarusidestrconsts:liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Ошибка перемещения компонента %s:%s"

#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Ошибка чтения %s%s%s%s%s"

#: lazarusidestrconsts:lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Ошибка чтения файла"

#: lazarusidestrconsts:lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Ошибка чтения файла: %s"

#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Ошибка чтения списка пакетов из файла%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Ошибка чтения файла сведений проекта %s%s%s%s%s"

#: lazarusidestrconsts:liserrorrenamingfile
msgid "Error renaming file"
msgstr "Ошибка переименования файла"

#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Ошибка записи %s%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Ошибка записи проекта в файл %s%s%s%s%s"

#: lazarusidestrconsts:lispkgmangerrorwritingfile
msgid "Error writing file"
msgstr "Ошибка записи файла"

#: lazarusidestrconsts:liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Ошибка записи списка пакетов в файл%s%s%s%s"

#: lazarusidestrconsts:liserror
msgid "Error: "
msgstr "Ошибка:"

#: lazarusidestrconsts:liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Ошибка: неправильный компилятор:%s"

#: lazarusidestrconsts:liserrors
msgid "Errors"
msgstr "Ошибки"

#: lazarusidestrconsts:srvk_escape
msgid "Escape"
msgstr "Escape"

#: lazarusidestrconsts:lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Вычислить/Изменить..."

#: lazarusidestrconsts:lisexcludefilter
msgid "Exclude Filter"
msgstr ""

#: lazarusidestrconsts:srvk_execute
msgid "Execute"
msgstr "Выполнить"

#: lazarusidestrconsts:liscoexecuteafter
msgid "Execute after"
msgstr "Выполнить после"

#: lazarusidestrconsts:liscoexecutebefore
msgid "Execute before"
msgstr "Выполнить перед"

#: lazarusidestrconsts:lisexecutingcommandafter
msgid "Executing command after"
msgstr "Выполнить команду после"

#: lazarusidestrconsts:lisexecutingcommandbefore
msgid "Executing command befor"
msgstr "Выполнить команду до"

#: lazarusidestrconsts:lisexecutionpaused
msgid "Execution paused"
msgstr "Выполнение приостановлено"

#: lazarusidestrconsts:lisexecutionpausedadress
msgid "Execution paused%s  Adress: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Выполнение остановлено%s Адрес: %s%s Процедура: %s%s Файл: %s%s(Когда-нибудь здесь появится окно ассемблера :)%s"

#: lazarusidestrconsts:lisexecutionstopped
msgid "Execution stopped"
msgstr "Выполнение остановлено"

#: lazarusidestrconsts:lisexecutionstoppedon
msgid "Execution stopped%s"
msgstr "Выполнение остановлено %s"

#: lazarusidestrconsts:liscodetoolsdefsexit
msgid "Exit"
msgstr "Выход"

#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Выход без сохранения"

#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Полное имя файла в данном редакторе"

#: lazarusidestrconsts:lisexportlist
msgid "Export list"
msgstr "Список экспорта"

#: lazarusidestrconsts:lisexttoolexternaltools
msgid "External Tools"
msgstr "Внешние инструменты"

#: lazarusidestrconsts:srkmecexttool
msgid "External tool %d"
msgstr "Внешний инструмент %d"

#: lazarusidestrconsts:srkmecexttoolsettings
msgid "External tools settings"
msgstr "Настройки внешнего инструмента"

#: lazarusidestrconsts:dlgextralinespacing
msgid "Extra line spacing"
msgstr "Межстрочный интервал"

#: lazarusidestrconsts:lisextract
msgid "Extract"
msgstr "Извлечь"

#: lazarusidestrconsts:uemextractproc
msgid "Extract Procedure"
msgstr "Выделить процедуру"

#: lazarusidestrconsts:lismenuextractproc
msgid "Extract procedure"
msgstr "Выделить процедуру"

#: lazarusidestrconsts:liscodetoolsdefsfpccvssourcedirectory
msgid "FPC CVS source directory"
msgstr "CVS-каталог исходников FPC"

#: lazarusidestrconsts:lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Ошибка каталога исходников FPC"

#: lazarusidestrconsts:dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Каталог исходников FPC"

#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Каталог исходников FPC \"%s\" не найден."

#: lazarusidestrconsts:lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Не удалось запустить инструмент"

#: lazarusidestrconsts:dlgcofast
msgid "Faster Code"
msgstr "Быстрый код"

#: lazarusidestrconsts:listodolfile
msgid "File"
msgstr "Файл"

#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Файл %s%s%s уже есть в проекте."

#: lazarusidestrconsts:lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Файл %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts:lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Файл %s%s%s виртуальный."

#: lazarusidestrconsts:lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Файл %s%s%s не найден."

#: lazarusidestrconsts:lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Файл %s%s%s не найден.%s"

#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Файл %s%s%s не найден.%sСоздать его?%s"

#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Файл %s%s%s%sне похож на текстовый.%sВсё равно открыть?"

#: lazarusidestrconsts:lispckeditfileproperties
msgid "File Properties"
msgstr "Свойства файла"

#: lazarusidestrconsts:lisaf2pfiletype
msgid "File Type"
msgstr "Тип файла"

#: lazarusidestrconsts:lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Файл уже существует"

#: lazarusidestrconsts:lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Файл уже в пакете"

#: lazarusidestrconsts:dlgfileexts
msgid "File extensions:"
msgstr "Расш-я файлов:"

#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Файл уже есть в пакете"

#: lazarusidestrconsts:lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Файл в проекте"

#: lazarusidestrconsts:lisfileisnotwritable
msgid "File is not writable"
msgstr "В файл нельзя писать"

#: lazarusidestrconsts:uefilerocap
msgid "File is readonly"
msgstr "Файл только для чтения"

#: lazarusidestrconsts:lisa2pfileisused
msgid "File is used"
msgstr "Файл используется"

#: lazarusidestrconsts:lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Маска файла (*;*.*;*.bak?)"

#: lazarusidestrconsts:srkmcatfilemenu
msgid "File menu commands"
msgstr "Команды меню файл"

#: lazarusidestrconsts:lisa2pfilename
msgid "File name:"
msgstr "Имя файла:"

#: lazarusidestrconsts:lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Файл не исполняемый"

#: lazarusidestrconsts:lisfilenotfound
msgid "File not found"
msgstr "Файл не найден"

#: lazarusidestrconsts:lisfilenotlowercase
msgid "File not lowercase"
msgstr "Файл не в нижнем регистре"

#: lazarusidestrconsts:lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Файл не сохранён"

#: lazarusidestrconsts:lisfilenottext
msgid "File not text"
msgstr "Файл не текстовый"

#: lazarusidestrconsts:lisa2pfilenotunit
msgid "File not unit"
msgstr "Файл - не модуль"

#: lazarusidestrconsts:lisa2pfilename2
msgid "Filename"
msgstr "Имя файла"

#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Имя файла отличается от имени пакета"

#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Имя файла использовано другим пакетом"

#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Имя файла использовано проектом"

#: lazarusidestrconsts:lisoipfilename
msgid "Filename:  %s"
msgstr "Имя файла: %s"

#: lazarusidestrconsts:dlgenvfiles
msgid "Files"
msgstr "Файлы"

#: lazarusidestrconsts:srvk_final
msgid "Final"
msgstr "Финальный"

#: lazarusidestrconsts:lismenufind
msgid "Find"
msgstr "Найти"

#: lazarusidestrconsts:lismenufindnext
msgid "Find &Next"
msgstr "Найти впереди"

#: lazarusidestrconsts:lismenufindprevious
msgid "Find &Previous"
msgstr "Найти сзади"

#: lazarusidestrconsts:lismenufindinfiles
msgid "Find &in files"
msgstr "Поиск в файлах"

#: lazarusidestrconsts:lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Найти описание под курсора"

#: lazarusidestrconsts:lismenufindidentifierrefs
msgid "Find Identifier References"
msgstr "Найти ссылки на идентификатор"

#: lazarusidestrconsts:lismenutemplatefindnext
msgid "Find Next"
msgstr "Найти далее"

#: lazarusidestrconsts:lisfrifindreferences
msgid "Find References"
msgstr "Найти ссылки"

#: lazarusidestrconsts:srkmecfindblockotherend
msgid "Find block other end"
msgstr "Найти другой конец блока"

#: lazarusidestrconsts:srkmecfindblockstart
msgid "Find block start"
msgstr "Найти начало блока"

#: lazarusidestrconsts:lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Найти начало блока кода"

#: lazarusidestrconsts:srkmecfinddeclaration
msgid "Find declaration"
msgstr "Найти описание"

#: lazarusidestrconsts:srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Найти ссылки на идентификатор"

#: lazarusidestrconsts:srkmecfindinfiles
msgid "Find in files"
msgstr "Найти в файлах"

#: lazarusidestrconsts:srkmecfindnext
msgid "Find next"
msgstr "Найти далее"

#: lazarusidestrconsts:lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Найти или переименовать ID"

#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Найти другой конец блока кода"

#: lazarusidestrconsts:srkmecfindprevious
msgid "Find previous"
msgstr "Найти предыдущее"

#: lazarusidestrconsts:srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Найти описание процедуры"

#: lazarusidestrconsts:srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Найти метод процедуры"

#: lazarusidestrconsts:srkmecfind
msgid "Find text"
msgstr "Найти текст"

#: lazarusidestrconsts:dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Найти текст под курсором"

#: lazarusidestrconsts:rslanguagefinnish
msgid "Finnish"
msgstr "Финский"

#: lazarusidestrconsts:rslanguagefinnishwin
msgid "Finnish for MS Windows"
msgstr "Финский для MS Windows"

#: lazarusidestrconsts:lisfixlfmfile
msgid "Fix LFM file"
msgstr "Исправить файл LFM"

#: lazarusidestrconsts:srkmecjumptoeditor
msgid "Focus to source editor"
msgstr "Фокус в редактор исходников"

#: lazarusidestrconsts:dlgforecolor
msgid "Foreground color"
msgstr "Цвет текста"

#: lazarusidestrconsts:dlgfrmeditor
msgid "Form Editor"
msgstr "Редактор форм"

#: lazarusidestrconsts:lisformloaderror
msgid "Form load error"
msgstr "Ошибка загрузки формы"

#: lazarusidestrconsts:lisformaterror
msgid "Format error"
msgstr "Ошибка форматирования"

#: lazarusidestrconsts:dlgpofroms
msgid "Forms"
msgstr "Формы"

#: lazarusidestrconsts:lismenuviewforms
msgid "Forms..."
msgstr "Формы..."

#: lazarusidestrconsts:fdmorderforwardone
msgid "Forward one"
msgstr ""

#: lazarusidestrconsts:lisfrforwardsearch
msgid "Forward search"
msgstr "Поиск вперёд"

#: lazarusidestrconsts:lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Компилятор FreePascal не найден"

#: lazarusidestrconsts:lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Не найдены исходники FreePascal"

#: lazarusidestrconsts:lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr ""

#: lazarusidestrconsts:lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Каталог исходников FreePascal"

#: lazarusidestrconsts:rslanguagefrench
msgid "French"
msgstr "Французский"

#: lazarusidestrconsts:dlgfromcursor
msgid "From Cursor"
msgstr "От курсора"

#: lazarusidestrconsts:listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Функция: добавить разделитель путей"

#: lazarusidestrconsts:listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Функция: убрать разделитель путей"

#: lazarusidestrconsts:listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Функция: извлечь расширение файла"

#: lazarusidestrconsts:listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Функция: извлечь только имя файла"

#: lazarusidestrconsts:listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Функция: извлечь имя файла с расширением"

#: lazarusidestrconsts:listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Функция: извлечь путь файла"

#: lazarusidestrconsts:dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "Совместимость с GPC (GNU Pascal Compiler)"

#: lazarusidestrconsts:lismenuinsertgplnotice
msgid "GPL notice"
msgstr "Заметка GPL"

#: lazarusidestrconsts:lismenuinsertgeneral
msgid "General"
msgstr "Общие"

#: lazarusidestrconsts:lispckeditgeneraloptions
msgid "General Options"
msgstr "Общие настройки"

#: lazarusidestrconsts:srkmecenvironmentoptions
msgid "General environment options"
msgstr "Общие настройки окружения"

#: lazarusidestrconsts:dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Генерировать информацию для DBX (замедляет сборку)"

#: lazarusidestrconsts:dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Генерировать информацию для GDB (замедляет сборку)"

#: lazarusidestrconsts:dlggprof
msgid "Generate code for gprof"
msgstr "Создать код для gprof"

#: lazarusidestrconsts:dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Создать код для valgrind"

#: lazarusidestrconsts:dlgcogenerate
msgid "Generate:"
msgstr "Создать:"

#: lazarusidestrconsts:dlggetposition
msgid "Get position"
msgstr "Принять позицию"

#: lazarusidestrconsts:dlgglobal
msgid "Global"
msgstr "Везде"

#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Глобально добавить путь исходников"

#: lazarusidestrconsts:srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Переход к маркеру %d"

#: lazarusidestrconsts:srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Переход к редактору %d"

#: lazarusidestrconsts:srkmecgotolinenumber
msgid "Go to line number"
msgstr "Переход к строке номер"

#: lazarusidestrconsts:srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Переход к соотв. скобке"

#: lazarusidestrconsts:srkmecnexteditor
msgid "Go to next editor"
msgstr "Переход к следующему редактору"

#: lazarusidestrconsts:srkmecpreveditor
msgid "Go to prior editor"
msgstr "Переход к предыдущему редактору"

#: lazarusidestrconsts:srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Переход по директиве include текущего включаемого файла"

#: lazarusidestrconsts:srkmecgotoxy
msgid "Goto XY"
msgstr "Переход по координате"

#: lazarusidestrconsts:lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Переход по директиве $I"

#: lazarusidestrconsts:lismenugotoline
msgid "Goto line"
msgstr "Переход к строке"

#: lazarusidestrconsts:lisuegotoline
msgid "Goto line :"
msgstr "Строка :"

#: lazarusidestrconsts:uemnextbookmark
msgid "Goto next Bookmark"
msgstr ""

#: lazarusidestrconsts:uemprevbookmark
msgid "Goto previous Bookmark"
msgstr ""

#: lazarusidestrconsts:listodolistgotoline
msgid "Goto selected source line"
msgstr "Переход к выделенной строке исходника"

#: lazarusidestrconsts:srkmgrabkey
msgid "Grab Key"
msgstr "Захват клавиш"

#: lazarusidestrconsts:dlggrabbercolor
msgid "Grabber color"
msgstr "Цвет выделения"

#: lazarusidestrconsts:dlgenvgrid
msgid "Grid"
msgstr "Сетка"

#: lazarusidestrconsts:dlggridcolor
msgid "Grid color"
msgstr "Цвет сетки"

#: lazarusidestrconsts:dlggridx
msgid "Grid size X"
msgstr "Размер X сетки"

#: lazarusidestrconsts:dlggridy
msgid "Grid size Y"
msgstr "Размер Y сетки"

#: lazarusidestrconsts:srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Предположить отсутствие $IFDEF"

#: lazarusidestrconsts:lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Исправить несоответствие IFDEF/ENDIF"

#: lazarusidestrconsts:lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Исправить незаконченный блок"

#: lazarusidestrconsts:dlgenvlguidelines
msgid "Guide lines"
msgstr "Линии помощи"

#: lazarusidestrconsts:dlgguttercolor
msgid "Gutter color"
msgstr "Цвет поля (лев)"

#: lazarusidestrconsts:dlggutterwidth
msgid "Gutter width"
msgstr "Ширина поля (лев)"

#: lazarusidestrconsts:dlghalfpagescroll
msgid "Half page scroll"
msgstr "Прокрутка на половину страницы"

#: lazarusidestrconsts:lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Обработать событие OnClick"

#: lazarusidestrconsts:srvk_hanja
msgid "Hanja"
msgstr "Hanja"

#: lazarusidestrconsts:lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Имеет проц-ру Register"

#: lazarusidestrconsts:lisheadercommentforclass
msgid "Header comment for class"
msgstr "Комментарий-заголовок для класса"

#: lazarusidestrconsts:dlgheapsize
msgid "Heap Size"
msgstr "Размер кучи"

#: lazarusidestrconsts:rslanguagehebrew
msgid "Hebrew"
msgstr ""

#: lazarusidestrconsts:dlgheightpos
msgid "Height:"
msgstr "Высота:"

#: lazarusidestrconsts:srvk_help
msgid "Help"
msgstr "Справка"

#: lazarusidestrconsts:lishelpcontextnotfound
msgid "Help Context not found"
msgstr "Контекст справки не найден"

#: lazarusidestrconsts:lishelpdatabasenotfound
msgid "Help Database not found"
msgstr "База данных справки не найдена"

#: lazarusidestrconsts:lishlpoptshelpoptions
msgid "Help Options"
msgstr "Параметры справки"

#: lazarusidestrconsts:lishelpselectorerror
msgid "Help Selector Error"
msgstr "Ошибка выбора справки"

#: lazarusidestrconsts:lishelpviewererror
msgid "Help Viewer Error"
msgstr "Ошибка просмотра справки"

#: lazarusidestrconsts:lishelpviewernotfound
msgid "Help Viewer not found"
msgstr "Просмотрщик справки не найден"

#: lazarusidestrconsts:srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Команды меню Справка"

#: lazarusidestrconsts:lishelpnotfound
msgid "Help not found"
msgstr "Справки не найдено"

#: lazarusidestrconsts:dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Скрыть окна IDE при пуске"

#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите только строковое выражение и попробуйте снова."

#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The Make Resourcestring Function expects a string constant.%sPlease select the expression and try again."
msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите выражение и попробуйте снова."

#: lazarusidestrconsts:dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr "Подсказка: щелкните по команде, которая Вам нужна"

#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Подсказка: Вы можете задать путь компилятора в Окружение->Параметры окружения->Файлы->Путь компилятора"

#: lazarusidestrconsts:dlgpalhints
msgid "Hints for component palette"
msgstr "Подсказки палитры компонентов"

#: lazarusidestrconsts:dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Подсказки командных кнопок (открыть, сохранить и т.д.)"

#: lazarusidestrconsts:srvk_home
msgid "Home"
msgstr "Home"

#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr ""

#: lazarusidestrconsts:lishorizontal
msgid "Horizontal"
msgstr "Горизонтально"

#: lazarusidestrconsts:dlggridxhint
msgid "Horizontal grid step size"
msgstr "Шаг сетки по горизонтали"

#: lazarusidestrconsts:dlghostapplication
msgid "Host application"
msgstr "Главное приложение"

#: lazarusidestrconsts:uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Вам сказано - не реализовано"

#: lazarusidestrconsts:lispckoptsideintegration
msgid "IDE Integration"
msgstr "Встраивание в IDE"

#: lazarusidestrconsts:lisideoptions
msgid "IDE Options:"
msgstr "Параметры IDE:"

#: lazarusidestrconsts:uepins
msgid "INS"
msgstr "ВСТ"

#: lazarusidestrconsts:liscodetoolsoptsidentifier
msgid "Identifier"
msgstr "Идентификатор"

#: lazarusidestrconsts:lismakeresstridentifierlength
msgid "Identifier Length:"
msgstr "Длина идентификатора:"

#: lazarusidestrconsts:lismakeresstridentifierprefix
msgid "Identifier Prefix:"
msgstr "Префикс идентификатора:"

#: lazarusidestrconsts:dlgedidcomlet
msgid "Identifier completion"
msgstr "Завершение идентификаторов"

#: lazarusidestrconsts:dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Политика идентификаторов"

#: lazarusidestrconsts:lisfriidentifier
msgid "Identifier: %s"
msgstr "Идентификатор: %s"

#: lazarusidestrconsts:liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts:uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Если Вы можете помочь нам реализовать эту функцию, пишите lazarus@miraclec.com"

#: lazarusidestrconsts:liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts:liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts:dlgignoreverb
msgid "Ignore"
msgstr "Пропуск"

#: lazarusidestrconsts:lissortselignorespace
msgid "Ignore Space"
msgstr "Игнорировать пробелы"

#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Игнорировать количество пробелов"

#: lazarusidestrconsts:lisignorebinaries
msgid "Ignore binaries"
msgstr ""

#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Игнорировать разные концы строк (напр., #10 = #13#10)"

#: lazarusidestrconsts:lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Игнорировать изменения на диске"

#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Игнорировать добавление/удаление пустых строк"

#: lazarusidestrconsts:lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Игнорировать пробелы (не включая перевод строки)"

#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Игнорировать пробелы в конце строки"

#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Игнорировать пробелы в начале строки"

#: lazarusidestrconsts:srkmecimestr
msgid "Ime Str"
msgstr ""

#: lazarusidestrconsts:lisimportlist
msgid "Import list"
msgstr "Список импорта"

#: lazarusidestrconsts:dlginfrontofmethods
msgid "In front of methods"
msgstr "Перед методами"

#: lazarusidestrconsts:lispckoptsinclude
msgid "Include"
msgstr "Включает"

#: lazarusidestrconsts:dlgassertcode
msgid "Include Assertion Code"
msgstr "Включить код Assert"

#: lazarusidestrconsts:dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Включаемые файлы (-Fi):"

#: lazarusidestrconsts:lisincludefilter
msgid "Include Filter"
msgstr ""

#: lazarusidestrconsts:lispkgfiletypeinclude
msgid "Include file"
msgstr "Включаемый файл:"

#: lazarusidestrconsts:lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Включить подкаталоги"

#: lazarusidestrconsts:dlgincludesystemvariables
msgid "Include system variables"
msgstr "Включить системные переменные"

#: lazarusidestrconsts:lisuidincludedby
msgid "Included by:"
msgstr "Включён:"

#: lazarusidestrconsts:lismenuincrementalfind
msgid "Incremental Find"
msgstr "Поиск с нарастанием"

#: lazarusidestrconsts:srkmecblockindent
msgid "Indent block"
msgstr "Отделить блок"

#: lazarusidestrconsts:dlgindentcodeto
msgid "Indent code to"
msgstr "Выровнять код по"

#: lazarusidestrconsts:lismenuindentselection
msgid "Indent selection"
msgstr "Сдвинуть блок вправо"

#: lazarusidestrconsts:lisinformationaboutunit
msgid "Information about %s"
msgstr "Информация о %s"

#: lazarusidestrconsts:dlgcoinherited
msgid "Inherited"
msgstr "Унаследован"

#: lazarusidestrconsts:srvk_insert
msgid "Insert"
msgstr "Вставить"

#: lazarusidestrconsts:lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Вставить $IFDEF..."

#: lazarusidestrconsts:srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Вставить ключевое слово CVS Author"

#: lazarusidestrconsts:srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Вставить ключевое слово CVS Date"

#: lazarusidestrconsts:srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Вставить ключевое слово CVS Header"

#: lazarusidestrconsts:srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Вставить ключевое слово CVS ID"

#: lazarusidestrconsts:srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Вставить ключевое слово CVS Log"

#: lazarusidestrconsts:srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Вставить ключевое слово CVS Name"

#: lazarusidestrconsts:srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Вставить ключевое слово CVS Revision"

#: lazarusidestrconsts:srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Вставить ключевое слово CVS Source"

#: lazarusidestrconsts:srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Вставить элемент ChangeLog"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 5"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Вставить шаблон каталога Delphi 5"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Вставить шаблон проекта Delphi 5"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 6"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Вставить шаблон каталога Delphi 6"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Вставить шаблон проекта Delphi 6"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 7"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Вставить шаблон каталога Delphi 7"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Вставить шаблон проекта Delphi 7"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcvssource
msgid "Insert Free Pascal CVS Source Template"
msgstr "Вставить шаблон исходника CVS FreePascal"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Вставить шаблон компилятора FreePascal"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Вставить шаблон проекта FreePascal"

#: lazarusidestrconsts:lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Вставить шаблон формы..."

#: lazarusidestrconsts:srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Вставить заметку о GPL"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Вставить шаблон компилятора Kylix 3"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Вставить шаблон каталога Kylix 3"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Вставить шаблон проекта Kylix 3"

#: lazarusidestrconsts:srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Вставить заметку о LGPL"

#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Вставить шаблон каталога Lazarus"

#: lazarusidestrconsts:srkmecinsertmode
msgid "Insert Mode"
msgstr "Режим вставки"

#: lazarusidestrconsts:lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Вставить новый пункт (после)"

#: lazarusidestrconsts:lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Вставить новый пункт (перед)"

#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Вставить шаблон"

#: lazarusidestrconsts:lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Вставить по алфавиту"

#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Вставить с учётом контекста"

#: lazarusidestrconsts:srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Вставить текущие дату и время"

#: lazarusidestrconsts:srkmecinsertusername
msgid "Insert current username"
msgstr "Вставить текущее имя пользователя"

#: lazarusidestrconsts:lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Вставить из таблицы символов"

#: lazarusidestrconsts:srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Вставить из таблицы символов"

#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Вставить элемент как дочерний"

#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Вставить элемент ниже"

#: lazarusidestrconsts:dlginsspaceafter
msgid "Insert space after"
msgstr "Вставлять пробелы после"

#: lazarusidestrconsts:dlginsspacefront
msgid "Insert space in front of"
msgstr "Вставлять пробелы перед"

#: lazarusidestrconsts:lismenuinserttext
msgid "Insert text"
msgstr "Вставить текст"

#: lazarusidestrconsts:lismenuinspect
msgid "Inspect ..."
msgstr "Следить за ..."

#: lazarusidestrconsts:lispckeditinstall
msgid "Install"
msgstr "Установить"

#: lazarusidestrconsts:lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Установить при след. запуске"

#: lazarusidestrconsts:lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Установить пакет в IDE"

#: lazarusidestrconsts:lisinstallselection
msgid "Install selection"
msgstr "Установить выбранное"

#: lazarusidestrconsts:lispckexplinstalled
msgid "Installed"
msgstr "Установлен"

#: lazarusidestrconsts:lisinstalledpackages
msgid "Installed Packages"
msgstr "Установленные пакеты"

#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr ""

#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr ""

#: lazarusidestrconsts:dlgintvinsec
msgid "Interval in secs"
msgstr "Интервал в сек"

#: lazarusidestrconsts:lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Неправильный тип предка"

#: lazarusidestrconsts:lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Неправильный цикл"

#: lazarusidestrconsts:lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Неправильное имя класса"

#: lazarusidestrconsts:lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Неправильное имя файла компилятора"

#: lazarusidestrconsts:lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Неправильный фильтр исключений"

#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Неправильный каталог исходников FPC"

#: lazarusidestrconsts:lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Некорректный идентификатор"

#: lazarusidestrconsts:lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Неправильный фильтр включений"

#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Неправильные версии (минимальная/максимальная)"

#: lazarusidestrconsts:lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Неправильный пакет"

#: lazarusidestrconsts:lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Неправильное имя пакета"

#: lazarusidestrconsts:lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Некорректный идентификатор паскаля"

#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Неправильная секция Resourcestring"

#: lazarusidestrconsts:lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Неправильное имя модуля"

#: lazarusidestrconsts:lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Неправильное имя модуля: %s"

#: lazarusidestrconsts:lisinvalidcommand
msgid "Invalid command"
msgstr "Неправильная команда"

#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Некорректное имя компилятора"

#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Неправильный класс компонента"

#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Некорректное имя отладчика"

#: lazarusidestrconsts:lisinvaliddelete
msgid "Invalid delete"
msgstr "Недопустимое удаление"

#: lazarusidestrconsts:lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Неправильный каталог назначения"

#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The Make Resourcestring Function expects a string constant in a single file. Please select the expression and try again."
msgstr "Неправильное выражение.%sПодсказка: функция Создать строку ресурсов требует строковую константу в одном файле. Выделите выражение и попробуйте ещё."

#: lazarusidestrconsts:lisa2pinvalidfile
msgid "Invalid file"
msgstr "Неправильный файл"

#: lazarusidestrconsts:lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Неправильное расширение файла"

#: lazarusidestrconsts:lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Неправильное имя файла"

#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Неправильное имя файла make"

#: lazarusidestrconsts:lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Неправильная максимальная версия"

#: lazarusidestrconsts:lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Неправильная минимальная версия"

#: lazarusidestrconsts:lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Неправильный множественный выбор"

#: lazarusidestrconsts:fdinvalidmutliselectioncap
msgid "Invalid mutliselection"
msgstr "Неправильный множественный выбор"

#: lazarusidestrconsts:lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Неправильный идентификатор пакета: %s%s%s"

#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Неправильное расширение файла пакета"

#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Неправильное имя файла пакета"

#: lazarusidestrconsts:lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Неправильное имя пакета"

#: lazarusidestrconsts:lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Неправильный тип пакета"

#: lazarusidestrconsts:lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Неправильное имя пакета"

#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Неправильный \"предок\""

#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Неправильный родительский элемент"

#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Неправильное имя модуля паскаля"

#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Неправильный предыдущий элемент"

#: lazarusidestrconsts:lisinvalidprocname
msgid "Invalid proc name"
msgstr "Неправильное имя проц-ры"

#: lazarusidestrconsts:lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Неправильное имя файла проекта"

#: lazarusidestrconsts:lisinvalidselection
msgid "Invalid selection"
msgstr "Неправильное выделение"

#: lazarusidestrconsts:lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Неправильное имя переменной"

#: lazarusidestrconsts:lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Неправильная версия"

#: lazarusidestrconsts:ueminvertassignment
msgid "Invert Assignment"
msgstr "Инвертировать присвоение"

#: lazarusidestrconsts:srkmecinvertassignment
msgid "Invert assignment"
msgstr "Инвертировать присвоение"

#: lazarusidestrconsts:srvk_irregular
msgid "Irregular "
msgstr "Нерегулярный "

#: lazarusidestrconsts:rslanguageitalian
msgid "Italian"
msgstr "итальянский"

#: lazarusidestrconsts:rslanguageitalianiso
msgid "Italian(ISO 8859-1)"
msgstr "Итальянский (ISO 8859-1)"

#: lazarusidestrconsts:dlgedital
msgid "Italic"
msgstr "Курсив"

#: lazarusidestrconsts:dlgoiitemheight
msgid "Item height"
msgstr "Высота элемента"

#: lazarusidestrconsts:lismenujumpback
msgid "Jump back"
msgstr "Переход назад"

#: lazarusidestrconsts:lismenujumpforward
msgid "Jump forward"
msgstr "Переход вперед"

#: lazarusidestrconsts:lismenujumpto
msgid "Jump to"
msgstr ""

#: lazarusidestrconsts:lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr ""

#: lazarusidestrconsts:lismenujumptonexterror
msgid "Jump to next error"
msgstr "Переход к след. ошибке"

#: lazarusidestrconsts:lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr ""

#: lazarusidestrconsts:lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Переход к пред. ошибке"

#: lazarusidestrconsts:dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Переход (например, по методу)"

#: lazarusidestrconsts:srvk_junja
msgid "Junja"
msgstr "Junja"

#: lazarusidestrconsts:srvk_kana
msgid "Kana"
msgstr "Kana"

#: lazarusidestrconsts:dlgkeepcaretx
msgid "Keep X caret"
msgstr "Сохранять Х курсора"

#: lazarusidestrconsts:liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Оставлять все текстовые файлы"

#: lazarusidestrconsts:dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Хранить нек. переменные в регистрах"

#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Сохранять файлы, соотв. фильтру"

#: lazarusidestrconsts:dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Сохранять порядок процедур"

#: lazarusidestrconsts:srkmkey
msgid "Key"
msgstr "Клавиша"

#: lazarusidestrconsts:dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Схема раскладки клавиш"

#: lazarusidestrconsts:dlgkeymapping
msgid "Key Mappings"
msgstr "Клавиши"

#: lazarusidestrconsts:dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Ошибки комбинаций клавиш"

#: lazarusidestrconsts:liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Ключевое слово"

#: lazarusidestrconsts:dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Политика ключевых слов"

#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Опции LCL, зависящие от интерфейса:"

#: lazarusidestrconsts:lislclwidgettype
msgid "LCL Widget Type"
msgstr "Тип элемента управления LCL"

#: lazarusidestrconsts:lislazbuildlclinterface
msgid "LCL interface"
msgstr "интерфейс LCL"

#: lazarusidestrconsts:lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Отсутствует путь модуля LCL"

#: lazarusidestrconsts:lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - текст формы Lazarus"

#: lazarusidestrconsts:lislfmfile
msgid "LFM file"
msgstr "Файл LFM"

#: lazarusidestrconsts:lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Файл LFM повреждён"

#: lazarusidestrconsts:lislfmfilenotfound
msgid "LFM file not found"
msgstr "Файл LFM не найден"

#: lazarusidestrconsts:lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "Заметка о LGPL"

#: lazarusidestrconsts:lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - ресурс Lazarus"

#: lazarusidestrconsts:dlgenvlanguage
msgid "Language"
msgstr "Язык"

#: lazarusidestrconsts:dlglang
msgid "Language:"
msgstr "Язык:"

#: lazarusidestrconsts:dlgcdtlast
msgid "Last"
msgstr "Последним"

#: lazarusidestrconsts:dlglast
msgid "Last (i.e. at end of source)"
msgstr "Последний (т.е. в конце исходника)"

#: lazarusidestrconsts:lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Запускающее приложение недопустимо"

#: lazarusidestrconsts:lislaunchingcmdline
msgid "Launching target command line"
msgstr "Командная строка для запуска"

#: lazarusidestrconsts:lislazdoc
msgid "LazDoc"
msgstr ""

#: lazarusidestrconsts:lismenulazdoc
msgid "LazDoc Editor"
msgstr ""

#: lazarusidestrconsts:lislazdocmainformcaption
msgid "LazDoc editor"
msgstr ""

#: lazarusidestrconsts:lislazdocpathsgroupbox
msgid "LazDoc settings"
msgstr ""

#: lazarusidestrconsts:lispkgmanglazarus
msgid "Lazarus"
msgstr ""

#: lazarusidestrconsts:lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Каталог Lazarus"

#: lazarusidestrconsts:lislazaruseditorv
msgid "Lazarus Editor v%s"
msgstr "Редактор Lazarus v%s"

#: lazarusidestrconsts:lislazarusfile
msgid "Lazarus File"
msgstr ""

#: lazarusidestrconsts:lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr ""

#: lazarusidestrconsts:locwndsrceditor
msgid "Lazarus Source Editor"
msgstr "Редактор исходного кода Lazarus"

#: lazarusidestrconsts:lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Каталог конфигурации Lazarus"

#: lazarusidestrconsts:lislazarusdirectory
msgid "Lazarus directory"
msgstr "Каталог Lazarus"

#: lazarusidestrconsts:dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Каталог Lazarus (общий для всех проектов)"

#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Каталог Lazarus \"%s\" не найден."

#: lazarusidestrconsts:lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Каталог Lazarus не найден"

#: lazarusidestrconsts:lislazarusform
msgid "Lazarus form"
msgstr ""

#: lazarusidestrconsts:lislazaruspackage
msgid "Lazarus package"
msgstr ""

#: lazarusidestrconsts:lislazarusproject
msgid "Lazarus project"
msgstr ""

#: lazarusidestrconsts:lislazarusprojectsource
msgid "Lazarus project source"
msgstr ""

#: lazarusidestrconsts:lislazarusunit
msgid "Lazarus unit"
msgstr ""

#: lazarusidestrconsts:lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Оставьте пустым для файла .po по умолчанию"

#: lazarusidestrconsts:srvk_left
msgid "Left"
msgstr "Влево"

#: lazarusidestrconsts:lisleftsides
msgid "Left sides"
msgstr "Левые края"

#: lazarusidestrconsts:lisleftspaceequally
msgid "Left space equally"
msgstr ""

#: lazarusidestrconsts:dlgleftpos
msgid "Left:"
msgstr "Слева:"

#: lazarusidestrconsts:dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Уровень 0 (без особой оптимизации)"

#: lazarusidestrconsts:dlglevel1opt
msgid "Level 1 (Quick Optimizations)"
msgstr "Уровень 1 (быстрая)"

#: lazarusidestrconsts:dlglevel2opt
msgid "Level 2 (Level 1 + Slower Optimizations)"
msgstr "Уровень 2 (уровень 1 + более медленная)"

#: lazarusidestrconsts:dlglevel3opt
msgid "Level 3 (Level 2 + Uncertain)"
msgstr "Уровень 3 (уровень 3 + нестандартная)"

#: lazarusidestrconsts:dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Библиотеки (-Fl):"

#: lazarusidestrconsts:lispckoptslibrary
msgid "Library"
msgstr "Библиотека"

#: lazarusidestrconsts:lispckoptslicense
msgid "License:"
msgstr "Лицензия:"

#: lazarusidestrconsts:lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers."
msgstr "Лицензия: GPL/LGPL%sLazarus - это библиотеки классов для FreePascal, эмулирующие Delphi. FreePascal - это (L)GPL'ьный компилятор, работающий под Linux, Win32, OS/2, 68K и др. FreePascal разработан, чтобы разбирать и компилировать программы с синтаксисом Delphi, который, естественно, ООП.%sLazarus - недостающее звено цепи, позволяющей Вам разрабатывать программы типа Delphi на всех вышеуказанных платформах. IDE вдруг станет инструментом RAD, как Delphi.%sТ.к. проект Lazarus растёт, нам нужно больше разработчиков."

#: lazarusidestrconsts:listodolline
msgid "Line"
msgstr "Строка"

#: lazarusidestrconsts:dlglinesplitting
msgid "Line Splitting"
msgstr "Разрыв строк"

#: lazarusidestrconsts:srkmeclineselect
msgid "Line selection mode"
msgstr "Режим выбора строк"

#: lazarusidestrconsts:lissortsellines
msgid "Lines"
msgstr "Строки"

#: lazarusidestrconsts:lisuidlines
msgid "Lines:"
msgstr ""

#: lazarusidestrconsts:dlglinksmart
msgid "Link Smart"
msgstr "Умное связывание"

#: lazarusidestrconsts:dlglinklibraries
msgid "Link Style:"
msgstr "Стиль сборки:"

#: lazarusidestrconsts:lispckoptslinker
msgid "Linker"
msgstr "Линкер"

#: lazarusidestrconsts:dlgcolinking
msgid "Linking"
msgstr "Связывание"

#: lazarusidestrconsts:dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Загр. рабочий стол из файла"

#: lazarusidestrconsts:dlgcoloadsave
msgid "Load/Save"
msgstr "Загрузка/сохранение"

#: lazarusidestrconsts:lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Загруженные пакеты:"

#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Загрузка пакета %s заменит пакет %s%sиз файла %s.%sСтарый пакет изменён. Сохранить старый пакет %s?"

#: lazarusidestrconsts:dlgrunolocal
msgid "Local"
msgstr "Локальные"

#: lazarusidestrconsts:lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Локальные переменные"

#: lazarusidestrconsts:lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Нижний регистр выделения"

#: lazarusidestrconsts:dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Только 1я буква заглавная"

#: lazarusidestrconsts:lisedtexttoolmacros
msgid "Macros"
msgstr "Макросы"

#: lazarusidestrconsts:dlgmainmenu
msgid "Main Menu"
msgstr "Главное меню"

#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Главный модуль имеет выражения Application.CreateForm"

#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Главный модуль имеет выражение Application.Title"

#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Главный модуль имеет секцию uses, включающую все модули проекта"

#: lazarusidestrconsts:lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "Главный модуль - исходник Паскаля"

#: lazarusidestrconsts:lispckoptsmajor
msgid "Major"
msgstr "Главная"

#: lazarusidestrconsts:lismakeexe
msgid "Make Executable"
msgstr "Создать исполняемый"

#: lazarusidestrconsts:lismenumakeresourcestring
msgid "Make Resource String"
msgstr "Создать строку ресурсов"

#: lazarusidestrconsts:lismakeresourcestring
msgid "Make ResourceString"
msgstr "Создать строку ресурсов"

#: lazarusidestrconsts:lismakenotfound
msgid "Make not found"
msgstr "Не найден Make"

#: lazarusidestrconsts:dlgmakepath
msgid "Make path"
msgstr "путь к Make"

#: lazarusidestrconsts:srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Создать строку ресурсов"

#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Ручная компиляция (не автоматически)"

#: lazarusidestrconsts:dlgmargingutter
msgid "Margin and gutter"
msgstr "Границы"

#: lazarusidestrconsts:dlgmarkercolor
msgid "Marker color"
msgstr "Цвет маркера"

#: lazarusidestrconsts:lissmatches
msgid "Matches"
msgstr ""

#: lazarusidestrconsts:dlgmaxlinelength
msgid "Max line length:"
msgstr "max длина строки:"

#: lazarusidestrconsts:dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Предел недавних файлов"

#: lazarusidestrconsts:dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Предел недавних проектов"

#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Достигнут предел инструментов"

#: lazarusidestrconsts:lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Макс. версия (по выбору):"

#: lazarusidestrconsts:lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Макс. версия"

#: lazarusidestrconsts:dlgmaxcntr
msgid "Maximum counter"
msgstr "Максимальный счетчик"

#: lazarusidestrconsts:srvk_menu
msgid "Menu"
msgstr "Меню"

#: lazarusidestrconsts:lismenueditormenueditor
msgid "Menu Editor"
msgstr "Редактор меню"

#: lazarusidestrconsts:lismenuviewmessages
msgid "Messages"
msgstr "Сообщения..."

#: lazarusidestrconsts:dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Политика вставки методов"

#: lazarusidestrconsts:dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr "Минимизировать все при минимизации главной"

#: lazarusidestrconsts:lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Миним. версия (по выбору):"

#: lazarusidestrconsts:lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Миним. версия:"

#: lazarusidestrconsts:lispckoptsminor
msgid "Minor"
msgstr "Вторичная"

#: lazarusidestrconsts:fdmmirrorhorizontal
msgid "Mirror horizontal"
msgstr "Отразить по горизонтали"

#: lazarusidestrconsts:fdmmirrorvertical
msgid "Mirror vertical"
msgstr "Отразить по вертикали"

#: lazarusidestrconsts:dlgenvmisc
msgid "Miscellaneous"
msgstr "Разное"

#: lazarusidestrconsts:lismissingpackages
msgid "Missing Packages"
msgstr "Отсутствующие пакеты"

#: lazarusidestrconsts:dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Смешивать методы и свойства"

#: lazarusidestrconsts:srvk_modechange
msgid "Mode Change"
msgstr "Сменить режим"

#: lazarusidestrconsts:uemodified
msgid "Modified"
msgstr "Изменён"

#: lazarusidestrconsts:lispckeditmodified
msgid "Modified: %s"
msgstr "Изменён: %s"

#: lazarusidestrconsts:lispckeditmore
msgid "More ..."
msgstr "Больше..."

#: lazarusidestrconsts:srvk_lbutton
msgid "Mouse Button Left"
msgstr "Левая кнопка мыши"

#: lazarusidestrconsts:srvk_mbutton
msgid "Mouse Button Middle"
msgstr "Средняя кнопка мыши"

#: lazarusidestrconsts:srvk_rbutton
msgid "Mouse Button Right"
msgstr "Правая кнопка мыши"

#: lazarusidestrconsts:dlgmouselinks
msgid "Mouse links"
msgstr "Ссылки мыши"

#: lazarusidestrconsts:lisexttoolmovedown
msgid "Move Down"
msgstr "Сдвинуть вниз"

#: lazarusidestrconsts:lismenueditormovedown
msgid "Move Down (or right)"
msgstr ""

#: lazarusidestrconsts:uemmoveeditorleft
msgid "Move Editor Left"
msgstr "Подвинуть страницу влево"

#: lazarusidestrconsts:uemmoveeditorright
msgid "Move Editor Right"
msgstr "Подвинуть страницу вправо"

#: lazarusidestrconsts:lisexttoolmoveup
msgid "Move Up"
msgstr "Вверх"

#: lazarusidestrconsts:lismenueditormoveup
msgid "Move Up (or left)"
msgstr ""

#: lazarusidestrconsts:lisdsgorderbackone
msgid "Move component one back"
msgstr ""

#: lazarusidestrconsts:lisdsgorderforwardone
msgid "Move component one forward"
msgstr ""

#: lazarusidestrconsts:lisdsgordermovetoback
msgid "Move component to back"
msgstr ""

#: lazarusidestrconsts:lisdsgordermovetofront
msgid "Move component to front"
msgstr ""

#: lazarusidestrconsts:srkmecpagedown
msgid "Move cursor down one page"
msgstr "Переместить курсор вниз на 1 страницу"

#: lazarusidestrconsts:srkmecpageleft
msgid "Move cursor left one page"
msgstr "Переместить курсор влево на 1 страницу"

#: lazarusidestrconsts:srkmecpageright
msgid "Move cursor right one page"
msgstr "Переместить курсор вправо на 1 страницу"

#: lazarusidestrconsts:srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Переместить курсор в самое начало"

#: lazarusidestrconsts:srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Переместить курсор в самый конец"

#: lazarusidestrconsts:srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Переместить курсор в конец страницы"

#: lazarusidestrconsts:srkmeclineend
msgid "Move cursor to line end"
msgstr "Переместить курсор в конец строки"

#: lazarusidestrconsts:srkmeclinestart
msgid "Move cursor to line start"
msgstr "Переместить курсор в начало строки"

#: lazarusidestrconsts:srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Переместить курсор в начало страницы"

#: lazarusidestrconsts:srkmecpageup
msgid "Move cursor up one page"
msgstr "Переместить курсор вверх на одну страницу"

#: lazarusidestrconsts:srkmecwordleft
msgid "Move cursor word left"
msgstr "Переместить курсор на слово влево"

#: lazarusidestrconsts:srkmecwordright
msgid "Move cursor word right"
msgstr "Переместить курсор на слово вправо"

#: lazarusidestrconsts:lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Зависимость - вниз"

#: lazarusidestrconsts:lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Зависимость вверх"

#: lazarusidestrconsts:srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Сместить редактор влево"

#: lazarusidestrconsts:srkmecmoveeditorright
msgid "Move editor right"
msgstr "Сместить редактор вправо"

#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Переместить элемент вниз"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Переместить элемент на уровень вниз"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Переместить элемент на уровень вверх"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Переместить элемент вверх"

#: lazarusidestrconsts:lispatheditmovepathdown
msgid "Move path down"
msgstr "Путь - вниз"

#: lazarusidestrconsts:lispatheditmovepathup
msgid "Move path up"
msgstr "Путь - вверх"

#: lazarusidestrconsts:fdmordermovetoback
msgid "Move to back"
msgstr ""

#: lazarusidestrconsts:fdmordermovetofront
msgid "Move to front"
msgstr ""

#: lazarusidestrconsts:dlgmulti
msgid "Multi"
msgstr "Мульти"

#: lazarusidestrconsts:dlgmultiline
msgid "Multi Line"
msgstr "Многострочный"

#: lazarusidestrconsts:fdinvalidmutliselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Множественный выбор компонентов должен быть на одной форме"

#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "ЗАМЕТКА: Не могу создать шаблон определений из исходников FPC"

#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "ЗАМЕТКА: Не могу создать шаблон определений из исходников Lazarus"

#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "ЗАМЕТКА: файл настроек CodeTools не найден - используем умолчания"

#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "ЗАМЕТКА: грузим старый файл настроек CodeTools: "

#: lazarusidestrconsts:lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Имя новой процедуры"

#: lazarusidestrconsts:liscodetoolsdefsname
msgid "Name:"
msgstr "Имя:"

#: lazarusidestrconsts:dlgnaming
msgid "Naming"
msgstr "Названия"

#: lazarusidestrconsts:lisceoneveronlymanually
msgid "Never, only manually"
msgstr ""

#: lazarusidestrconsts:srkmecnew
msgid "New"
msgstr "Создать"

#: lazarusidestrconsts:lismenunewother
msgid "New ..."
msgstr "Создать ..."

#: lazarusidestrconsts:lisnewancestors
msgid "New Ancestors"
msgstr ""

#: lazarusidestrconsts:lisnewclass
msgid "New Class"
msgstr ""

#: lazarusidestrconsts:lisa2pnewcomponent
msgid "New Component"
msgstr "Новый компонент"

#: lazarusidestrconsts:lisa2pnewfile
msgid "New File"
msgstr ""

#: lazarusidestrconsts:lismenunewform
msgid "New Form"
msgstr "Создать форму"

#: lazarusidestrconsts:lismenunewproject
msgid "New Project"
msgstr "Создать проект"

#: lazarusidestrconsts:lismenunewprojectfromfile
msgid "New Project from file"
msgstr "Создать проект из файла"

#: lazarusidestrconsts:lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Новое требование"

#: lazarusidestrconsts:lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Новое описание шаблона..."

#: lazarusidestrconsts:lismenunewunit
msgid "New Unit"
msgstr "Создать модуль"

#: lazarusidestrconsts:lisa2pnewclassname
msgid "New class name:"
msgstr "Новое имя класса:"

#: lazarusidestrconsts:srkmecnewform
msgid "New form"
msgstr "Создать форму"

#: lazarusidestrconsts:srkmecnewunit
msgid "New unit"
msgstr "Создать модуль"

#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Новый модуль не в пути поиска"

#: lazarusidestrconsts:liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Новый элемент"

#: lazarusidestrconsts:lispkgmangnewpackage
msgid "NewPackage"
msgstr "Новый Пакет"

#: lazarusidestrconsts:liscodetoolsoptsnewline
msgid "Newline"
msgstr "Новая строка"

#: lazarusidestrconsts:srvk_next
msgid "Next"
msgstr "Следующий"

#: lazarusidestrconsts:srkmecnextbookmark
msgid "Next Bookmark"
msgstr ""

#: lazarusidestrconsts:lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Не найдено секции ResourceString"

#: lazarusidestrconsts:lisnostringconstantfound
msgid "No String Constant Found"
msgstr "Не найдено строковой константы"

#: lazarusidestrconsts:lisnochange
msgid "No change"
msgstr "Без изменений"

#: lazarusidestrconsts:lisnocodeselected
msgid "No code selected"
msgstr "Не выбрано кода"

#: lazarusidestrconsts:lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Не унаследовано параметров компилятора."

#: lazarusidestrconsts:dlgednoerr
msgid "No errors in key mapping found."
msgstr "Не найдено ошибок раскладок."

#: lazarusidestrconsts:lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Не выделено элементов"

#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Не найдено пакета для зависимости %s%s%s.%sВыберите существующий пакет."

#: lazarusidestrconsts:lisoipnopackageselected
msgid "No package selected"
msgstr "Не выбрано пакетов"

#: lazarusidestrconsts:lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Файла программы %s%s%s не найдено."

#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Элемент и его \"потомки\" доступны только для этого проекта"

#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Элемент только для чтения"

#: lazarusidestrconsts:srvk_nonconvert
msgid "Nonconvert"
msgstr "Без конвертации"

#: lazarusidestrconsts:dlgenvnone
msgid "None"
msgstr "Нет"

#: lazarusidestrconsts:dlgconormal
msgid "Normal Code"
msgstr "Нормальный код"

#: lazarusidestrconsts:srkmecnormalselect
msgid "Normal selection mode"
msgstr "Нормальный режим выбора"

#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr ""

#: lazarusidestrconsts:lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Не проект Delphi"

#: lazarusidestrconsts:lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Не модуль Delphi"

#: lazarusidestrconsts:lisuenotfound
msgid "Not found"
msgstr "Не найден"

#: lazarusidestrconsts:uenotimplcap
msgid "Not implemented yet"
msgstr "Еще не реализовано"

#: lazarusidestrconsts:lisnotnow
msgid "Not now"
msgstr "Не сейчас"

#: lazarusidestrconsts:dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Внимание, файлы проекта - все файлы в его каталоге"

#: lazarusidestrconsts:liscodetoolsoptsnumber
msgid "Number"
msgstr "Число"

#: lazarusidestrconsts:srvk_numlock
msgid "Numlock"
msgstr "NumLock"

#: lazarusidestrconsts:srvk_numpad
msgid "Numpad %d"
msgstr "%d цифровой клавиатуры"

#: lazarusidestrconsts:uepovr
msgid "OVR"
msgstr "ЗАМ"

#: lazarusidestrconsts:lispckoptsobject
msgid "Object"
msgstr "Объект"

#: lazarusidestrconsts:lismenuviewobjectinspector
msgid "Object Inspector"
msgstr "Инспектор объектов"

#: lazarusidestrconsts:lislazbuildok
msgid "Ok"
msgstr "ОК"

#: lazarusidestrconsts:lisoldancestors
msgid "Old Ancestors"
msgstr ""

#: lazarusidestrconsts:lisoldclass
msgid "Old Class"
msgstr ""

#: lazarusidestrconsts:lisceoonidle
msgid "On idle"
msgstr ""

#: lazarusidestrconsts:lismenuonlinehelp
msgid "Online Help"
msgstr ""

#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Контекстная справка ещё не реализована"

#: lazarusidestrconsts:lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Поиск только целых слов"

#: lazarusidestrconsts:lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Только выбранное"

#: lazarusidestrconsts:lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Только текстовые файлы"

#: lazarusidestrconsts:lismenuopen
msgid "Open"
msgstr "Открыть"

#: lazarusidestrconsts:lisopenlfm
msgid "Open %s"
msgstr ""

#: lazarusidestrconsts:lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Откр. Diff в редакторе"

#: lazarusidestrconsts:lisopenpackagefile
msgid "Open Package File"
msgstr "Открыть файл пакета"

#: lazarusidestrconsts:lisopenpackage
msgid "Open Package?"
msgstr "Открыть пакет?"

#: lazarusidestrconsts:lisctdefsopenpreview
msgid "Open Preview"
msgstr "Открыть предпросмотр"

#: lazarusidestrconsts:lismenuopenproject
msgid "Open Project"
msgstr "Открыть проект"

#: lazarusidestrconsts:lisopenprojectfile
msgid "Open Project File"
msgstr "Открыть проект"

#: lazarusidestrconsts:lisopenproject
msgid "Open Project?"
msgstr "Открыть проект?"

#: lazarusidestrconsts:lismenuopenrecent
msgid "Open Recent"
msgstr "Открыть недавнее"

#: lazarusidestrconsts:lismenuopenrecentproject
msgid "Open Recent Project"
msgstr "Открыть недавний проект"

#: lazarusidestrconsts:lisopenfile
msgid "Open file"
msgstr "Открыть файл"

#: lazarusidestrconsts:srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Открыть файл у курсора"

#: lazarusidestrconsts:lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Открыть имя файла под курсором"

#: lazarusidestrconsts:dlgqopenlastprj
msgid "Open last project at start"
msgstr "Грузить последний проект при пуске"

#: lazarusidestrconsts:lismenuopenpackage
msgid "Open loaded package"
msgstr "Открыть загруженный пакет"

#: lazarusidestrconsts:liscomppalopenpackage
msgid "Open package"
msgstr "Открыть пакет"

#: lazarusidestrconsts:lismenuopenpackagefile
msgid "Open package file (.lpk)"
msgstr "Открыть файл пакета (.lpk)"

#: lazarusidestrconsts:lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Открыть пакет текущего модуля"

#: lazarusidestrconsts:lismenuopenrecentpkg
msgid "Open recent package"
msgstr "Открыть недавний пакет"

#: lazarusidestrconsts:lisopenthepackageanswernotoloaditasxmlfile
msgid "Open the package %s?%sAnswer No to load it as xml file."
msgstr "Открыть пакет %s?%s Ответьте Нет, чтобы загрузить его как xml."

#: lazarusidestrconsts:lisopentheprojectanswernotoloaditasxmlfile
msgid "Open the project %s?%sAnswer No to load it as xml file."
msgstr "Открыть проект %s?%s Ответьте Нет, чтобы загрузить его как xml."

#: lazarusidestrconsts:liscomppalopenunit
msgid "Open unit"
msgstr "Открыть модуль"

#: lazarusidestrconsts:dlgoptimiz
msgid "Optimizations:"
msgstr "Оптимизация:"

#: lazarusidestrconsts:fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Параметр: Выровнять по сетке"

#: lazarusidestrconsts:fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Параметр: Выровнять по линиям помощи"

#: lazarusidestrconsts:dlgfropts
msgid "Options"
msgstr "Параметры"

#: lazarusidestrconsts:lislazbuildoptions
msgid "Options:"
msgstr "Параметры:"

#: lazarusidestrconsts:dlgcoopts
msgid "Options: "
msgstr "Параметры: "

#: lazarusidestrconsts:fdmorder
msgid "Order"
msgstr ""

#: lazarusidestrconsts:dlgsrorigin
msgid "Origin"
msgstr "Начинать"

#: lazarusidestrconsts:dlgcoother
msgid "Other"
msgstr "Другое"

#: lazarusidestrconsts:dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Другие исходники (.pp/.pas files, нужны только IDE, не компилятору)"

#: lazarusidestrconsts:dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Другие модули (-Fu) (разделитель точка с запятой):"

#: lazarusidestrconsts:dlgenvotherfiles
msgid "Other files"
msgstr "Др. файлы"

#: lazarusidestrconsts:dlgpooutputsettings
msgid "Output Settings"
msgstr "Параметры вывода"

#: lazarusidestrconsts:lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Каталог сохранений"

#: lazarusidestrconsts:dlgcooverflow
msgid "Overflow"
msgstr "Переполнения"

#: lazarusidestrconsts:lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr ""

#: lazarusidestrconsts:lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Перекрыть системную переменную"

#: lazarusidestrconsts:srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Режим замены"

#: lazarusidestrconsts:lisoverwritefile
msgid "Overwrite file?"
msgstr "Переписать файл?"

#: lazarusidestrconsts:lispackage
msgid "Package"
msgstr ""

#: lazarusidestrconsts:lispckeditpackage
msgid "Package %s"
msgstr "Пакет %s"

#: lazarusidestrconsts:lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Пакет %s не найден"

#: lazarusidestrconsts:lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Пакет %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Пакет %s%s%s изменён.%s Сохранить пакет?"

#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Пакет %s%s%s не имеет правильного каталога сохранений:%s%s%s%s"

#: lazarusidestrconsts:lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Пакет %s%s%s не найден"

#: lazarusidestrconsts:lismenupackagegraph
msgid "Package Graph"
msgstr "Диаграмма пакетов"

#: lazarusidestrconsts:lisoippackagename
msgid "Package Name"
msgstr "Имя пакета"

#: lazarusidestrconsts:lisprojaddpackagename
msgid "Package Name:"
msgstr "Имя пакета:"

#: lazarusidestrconsts:lispckoptspackageoptions
msgid "Package Options"
msgstr "Параметры пакета"

#: lazarusidestrconsts:lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Метка каталога исходника пакета"

#: lazarusidestrconsts:lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Конфликты пакетов"

#: lazarusidestrconsts:lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Файл пакета не найден"

#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Пакет - не пакет разработки"

#: lazarusidestrconsts:lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Пакет только для чтения"

#: lazarusidestrconsts:lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Требуется пакет"

#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Имя пакета уже занято"

#: lazarusidestrconsts:lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Пакет требует установки"

#: lazarusidestrconsts:lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Пакет не найден"

#: lazarusidestrconsts:lispkgmangpackage
msgid "Package: %s"
msgstr "Пакет: %s"

#: lazarusidestrconsts:lispckoptspackagetype
msgid "PackageType"
msgstr "Тип пакета"

#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Пакеты должны иметь расширение .lpk"

#: lazarusidestrconsts:lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Пакеты для установки в IDE"

#: lazarusidestrconsts:lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Имя страницы слишком длинное"

#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Рисовать элементы дизайнеров только в паузах (уменьшает нагрузку на медленных машинах)"

#: lazarusidestrconsts:lisa2ppalettepage
msgid "Palette Page:"
msgstr "Страница палитры:"

#: lazarusidestrconsts:lissortselparagraphs
msgid "Paragraphs"
msgstr "Абзацы"

#: lazarusidestrconsts:lisedtexttoolparameters
msgid "Parameters:"
msgstr "Параметры:"

#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Родительский элемент не может содержать дочерних."

#: lazarusidestrconsts:dlgcoparsing
msgid "Parsing"
msgstr "Обработка"

#: lazarusidestrconsts:lispascalsourcefile
msgid "Pascal source file"
msgstr ""

#: lazarusidestrconsts:lispascalunit
msgid "Pascal unit"
msgstr ""

#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Модули паскаля должны иметь расширение .pp или .pas"

#: lazarusidestrconsts:dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Передать опции линкеру (отделять пробелами)"

#: lazarusidestrconsts:lismenupaste
msgid "Paste"
msgstr "Вставить"

#: lazarusidestrconsts:srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Вставить из буфера в текущую позицию"

#: lazarusidestrconsts:lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Вставить выбранные компоненты из буфера"

#: lazarusidestrconsts:lispatheditpathtemplates
msgid "Path templates"
msgstr "Шаблоны пути"

#: lazarusidestrconsts:listofpcpath
msgid "Path:"
msgstr "Путь:"

#: lazarusidestrconsts:dlgsearchpaths
msgid "Paths"
msgstr "Пути"

#: lazarusidestrconsts:lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Пути (только чтение)"

#: lazarusidestrconsts:lismenupause
msgid "Pause"
msgstr "Пауза"

#: lazarusidestrconsts:srvk_pause
msgid "Pause key"
msgstr "Клавиша Pause"

#: lazarusidestrconsts:dlgpersistentcaret
msgid "Persistent caret"
msgstr "Неподвижный курсор"

#: lazarusidestrconsts:lisplzcheckthecompilername
msgid "Please check the compiler name"
msgstr "Проверьте имя компилятора"

#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr "Проверьте каталог исходников FreePascal"

#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring
msgid "Please choose a resourstring section from the list."
msgstr "Выберите секцию resourcestring из списка."

#: lazarusidestrconsts:lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Откройте модуль перед запуском."

#: lazarusidestrconsts:srkmpresskey
msgid "Please press a key ..."
msgstr "Нажмите любую клавишу..."

#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Сохраните файл перед добавлением в пакет."

#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr ""

#: lazarusidestrconsts:lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Выберите пакет"

#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Выберите пакет, чтобы открыть"

#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Выберите сначала элемент"

#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Выделите некоторый код, чтобы извлечь новую процедуру/метод."

#: lazarusidestrconsts:liscodetoolsoptspoint
msgid "Point"
msgstr "Точка"

#: lazarusidestrconsts:rslanguagepolish
msgid "Polish"
msgstr "Польский"

#: lazarusidestrconsts:rslanguagepolishwin
msgid "Polish(CP1250)"
msgstr "Польский(CP1250)"

#: lazarusidestrconsts:rslanguagepolishiso
msgid "Polish(ISO 8859-2)"
msgstr "Польский(ISO 8859-2)"

#: lazarusidestrconsts:rslanguageportugues
msgid "Portuguese"
msgstr ""

#: lazarusidestrconsts:dlgwrdpreview
msgid "Preview"
msgstr "Предпросмотр"

#: lazarusidestrconsts:dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Предпросмотр(max длина=1)"

#: lazarusidestrconsts:srkmecprevbookmark
msgid "Previous Bookmark"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Предыдущий элемент не может содержать дочерних."

#: lazarusidestrconsts:srvk_print
msgid "Print"
msgstr "Печать"

#: lazarusidestrconsts:listodolistprintlist
msgid "Print todo items"
msgstr "Распечатать элементы todo"

#: lazarusidestrconsts:srvk_prior
msgid "Prior"
msgstr "Перед"

#: lazarusidestrconsts:lisprivatemethod
msgid "Private Method"
msgstr "Скрытый метод"

#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr ""

#: lazarusidestrconsts:lisprocedure
msgid "Procedure"
msgstr "Процедура"

#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Политика вставки процедур"

#: lazarusidestrconsts:lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Процедура с интерфейсом"

#: lazarusidestrconsts:lisprogram
msgid "Program"
msgstr "Программа"

#: lazarusidestrconsts:lisprogramdetected
msgid "Program detected"
msgstr "Обнаружена программа"

#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Исходник программы должен иметь расширение паскаля, напр. .pas, .pp или .lpr"

#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr "Программа%sПрограмма freepascal. Файл программы автоматически поддерживается lazarus."

#: lazarusidestrconsts:lisedtexttoolprogramfilename
msgid "Programfilename:"
msgstr "Имя файла программы:"

#: lazarusidestrconsts:dlgenvproject
msgid "Project"
msgstr "Проект"

#: lazarusidestrconsts:lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built. :)"
msgstr "Проект %s%s%s успешно собран. :)"

#: lazarusidestrconsts:lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Путь вкл.проекта"

#: lazarusidestrconsts:lisprojectincpath
msgid "Project Include Path"
msgstr "Пути включений проекта"

#: lazarusidestrconsts:lisprojectinformation
msgid "Project Information"
msgstr ""

#: lazarusidestrconsts:lismenuprojectinspector
msgid "Project Inspector"
msgstr "Инспектор проекта"

#: lazarusidestrconsts:lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Инспектор проекта - %s"

#: lazarusidestrconsts:dlgprojectoptions
msgid "Project Options"
msgstr "Параметры проекта"

#: lazarusidestrconsts:lismenuprojectoptions
msgid "Project Options..."
msgstr "Параметры проекта..."

#: lazarusidestrconsts:lisprojectsrcpath
msgid "Project Src Path"
msgstr "Путь исходников проекта"

#: lazarusidestrconsts:lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Путь исх. проекта"

#: lazarusidestrconsts:lisprojectunitpath
msgid "Project Unit Path"
msgstr "Путь модулей проекта"

#: lazarusidestrconsts:lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Путь модулей проекта"

#: lazarusidestrconsts:lisprojectchanged
msgid "Project changed"
msgstr "Проект изменен"

#: lazarusidestrconsts:lisprojectdirectory
msgid "Project directory"
msgstr "Имя каталога проекта"

#: lazarusidestrconsts:lisprojectfilename
msgid "Project filename"
msgstr "Имя файла проекта"

#: lazarusidestrconsts:dlgprojfiles
msgid "Project files"
msgstr "Файлы проекта"

#: lazarusidestrconsts:lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Обнаружен файл сведений проекта"

#: lazarusidestrconsts:lisprojectisrunnable
msgid "Project is runnable"
msgstr "Проект запускаемый"

#: lazarusidestrconsts:lisprojectmakroproperties
msgid "Project makro properties"
msgstr ""

#: lazarusidestrconsts:srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Команды меню Проект"

#: lazarusidestrconsts:lispkgmangproject
msgid "Project: %s"
msgstr "Проект: %s"

#: lazarusidestrconsts:dlgpromptonreplace
msgid "Prompt On Replace"
msgstr "Подтверждать замену"

#: lazarusidestrconsts:lispromptforvalue
msgid "Prompt for value"
msgstr "Подсказка по значению"

#: lazarusidestrconsts:lishlpoptsproperties
msgid "Properties:"
msgstr "Свойства:"

#: lazarusidestrconsts:dlgpropertycompletion
msgid "Property completion"
msgstr "Завершение свойств"

#: lazarusidestrconsts:dlgpropnamecolor
msgid "Property name"
msgstr ""

#: lazarusidestrconsts:lisprotectedmethod
msgid "Protected Method"
msgstr "Защищённый метод"

#: lazarusidestrconsts:lispublicmethod
msgid "Public Method"
msgstr "Общий метод"

#: lazarusidestrconsts:lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Опубликовать пакет"

#: lazarusidestrconsts:lismenupublishproject
msgid "Publish Project"
msgstr "Опубликовать проект"

#: lazarusidestrconsts:lispublishprojdir
msgid "Publish project directory"
msgstr "Каталог публикации проекта"

#: lazarusidestrconsts:lispublishedmethod
msgid "Published Method"
msgstr "Опубликованный метод"

#: lazarusidestrconsts:lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Быстрая проверка синтаксиса"

#: lazarusidestrconsts:lismenuquit
msgid "Quit"
msgstr "Выход"

#: lazarusidestrconsts:dlgcorange
msgid "Range"
msgstr "Диапазона"

#: lazarusidestrconsts:lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Обновить зависимость"

#: lazarusidestrconsts:lispckeditreaddfile
msgid "Re-Add file"
msgstr "Обновить файл"

#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Перекомпилировать"

#: lazarusidestrconsts:lisreaderror
msgid "Read Error"
msgstr "Ошибка чтения"

#: lazarusidestrconsts:uemreadonly
msgid "Read Only"
msgstr "Только чтение"

#: lazarusidestrconsts:lispckeditreadonly
msgid "Read Only: %s"
msgstr "Только чтение:%s"

#: lazarusidestrconsts:liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Ошибка чтения"

#: lazarusidestrconsts:dlgcdtreadprefix
msgid "Read prefix"
msgstr "Префикс READ"

#: lazarusidestrconsts:uepreadonly
msgid "Readonly"
msgstr "Только чтение"

#: lazarusidestrconsts:lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Пересобрать Lazarus?"

#: lazarusidestrconsts:lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Требуется пересобрать все"

#: lazarusidestrconsts:lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Чистая пересборка"

#: lazarusidestrconsts:lismenuredo
msgid "Redo"
msgstr "Вернуть"

#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Уменьшить прорисовку дизайнеров"

#: lazarusidestrconsts:uemrefactor
msgid "Refactoring"
msgstr "Переработка кода"

#: lazarusidestrconsts:dlgreferencecolor
msgid "Reference"
msgstr ""

#: lazarusidestrconsts:dlgunitdeprefresh
msgid "Refresh"
msgstr "Обновить"

#: lazarusidestrconsts:lisceorefreshautomatically
msgid "Refresh automatically"
msgstr ""

#: lazarusidestrconsts:listodolistrefresh
msgid "Refresh todo items"
msgstr "Обновить элементы todo"

#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Процедура регистрации пуста"

#: lazarusidestrconsts:lispckeditregisterunit
msgid "Register unit"
msgstr "Зарегистрировать модуль"

#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Был вызван RegisterUnit, но пакетов не зарегистрировано."

#: lazarusidestrconsts:lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Зарегистрированные дополнения"

#: lazarusidestrconsts:lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Ошибка регистрации"

#: lazarusidestrconsts:dlgregularexpressions
msgid "Regular Expressions"
msgstr "Целые выражения"

#: lazarusidestrconsts:lisfindfileregularexpressions
msgid "Regular expressions"
msgstr "Регулярное выражение"

#: lazarusidestrconsts:lispckoptsrelease
msgid "Release"
msgstr "Релиз"

#: lazarusidestrconsts:lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Перегрузить с диска"

#: lazarusidestrconsts:lisexttoolremove
msgid "Remove"
msgstr "Удалить"

#: lazarusidestrconsts:lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Удалить зависимость?"

#: lazarusidestrconsts:lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Удалить все некорректные свойства"

#: lazarusidestrconsts:lispckeditremovedependency
msgid "Remove dependency"
msgstr "Удалить зависимость"

#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Удалить зависимость %s%s%s%sиз пакета %s%s%s?"

#: lazarusidestrconsts:lispckeditremovefile
msgid "Remove file"
msgstr "Удалить файл"

#: lazarusidestrconsts:lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Удалить файл %s из проекта?"

#: lazarusidestrconsts:lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Удалить файл %s%s%s%s из пакета %s%s%s?"

#: lazarusidestrconsts:lispckeditremovefile2
msgid "Remove file?"
msgstr "Удалить файл?"

#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Удалить файлы по фильтру"

#: lazarusidestrconsts:lismenuremovefromproject
msgid "Remove from Project"
msgstr "Убрать из проекта"

#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr ""

#: lazarusidestrconsts:lisremovefromproject
msgid "Remove from project"
msgstr "Удалить из проекта"

#: lazarusidestrconsts:lislazdocdeletepathbutton
msgid "Remove path"
msgstr ""

#: lazarusidestrconsts:lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Удалить выбранный элемент"

#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Удалённые файлы (эти элементы не сохранятся в lpk-файле)"

#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Удалены требуемые пакеты"

#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Удалены требуемые пакеты (они не сохранятся в lpk-файле)"

#: lazarusidestrconsts:lisfrirename
msgid "Rename"
msgstr "Переименовать"

#: lazarusidestrconsts:lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Переименовать файл в нижн.рег-ре?"

#: lazarusidestrconsts:lismenurenameidentifier
msgid "Rename Identifier"
msgstr "Переименовать ID"

#: lazarusidestrconsts:lisfrirenameallreferences
msgid "Rename all References"
msgstr "Переименовать все ссылки"

#: lazarusidestrconsts:lisrenamefilefailed
msgid "Rename file failed"
msgstr "Не удалось переименовать файл"

#: lazarusidestrconsts:lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Переименовать файл в пакете?"

#: lazarusidestrconsts:lisrenamefile
msgid "Rename file?"
msgstr "Переименовать файл?"

#: lazarusidestrconsts:srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Переименовать ID"

#: lazarusidestrconsts:lisfrirenameto
msgid "Rename to"
msgstr "Переименовать в"

#: lazarusidestrconsts:lismenureplace
msgid "Replace"
msgstr "Замена"

#: lazarusidestrconsts:dlgreplaceall
msgid "Replace All"
msgstr "Заменить все"

#: lazarusidestrconsts:lispkgmangreplacefile
msgid "Replace File"
msgstr "Заменить файл"

#: lazarusidestrconsts:lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Заменить существующий файл %s%s%s?"

#: lazarusidestrconsts:srkmecreplace
msgid "Replace text"
msgstr "Заменить текст"

#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Заменить %s%s%s%s на %s%s%s в этом месте?"

#: lazarusidestrconsts:lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr ""

#: lazarusidestrconsts:dlgreport
msgid "Report"
msgstr "Отчет"

#: lazarusidestrconsts:lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Требуемые пакеты"

#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Пересмотреть каталог исходников FPC"

#: lazarusidestrconsts:lismenuresetdebugger
msgid "Reset debugger"
msgstr "Сброс отладчика"

#: lazarusidestrconsts:lisresourceloaderror
msgid "Resource load error"
msgstr "Ошибка загрузки ресурса"

#: lazarusidestrconsts:lisresourcesaveerror
msgid "Resource save error"
msgstr "Ошибка сохранения ресурса"

#: lazarusidestrconsts:lismakeresstrresourcestringsection
msgid "Resourcestring Section:"
msgstr "Секция Resourcestring:"

#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Строка ресурсов уже существует"

#: lazarusidestrconsts:lismenurestart
msgid "Restart"
msgstr "Перезапуск"

#: lazarusidestrconsts:lislazbuildrestartafterbuild
msgid "Restart After Successfull Build"
msgstr "Перезапуск после успешной сборки"

#: lazarusidestrconsts:rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Восстановить геометрию окна"

#: lazarusidestrconsts:rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Восстановить размер окна"

#: lazarusidestrconsts:srvk_return
msgid "Return"
msgstr "Возврат"

#: lazarusidestrconsts:lismenurevert
msgid "Revert"
msgstr "Обратный экспорт"

#: lazarusidestrconsts:lisrevertfailed
msgid "Revert failed"
msgstr "Обращение не удалось"

#: lazarusidestrconsts:lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Вернуть пакет?"

#: lazarusidestrconsts:srvk_right
msgid "Right"
msgstr "Справа"

#: lazarusidestrconsts:dlgrightclickselects
msgid "Right Click selects"
msgstr "Выбор правым щелчком"

#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Правый щелчок на элементе дерева даст меню со всеми доступными функциями пакета."

#: lazarusidestrconsts:dlgrightmargin
msgid "Right margin"
msgstr "Правая граница"

#: lazarusidestrconsts:dlgrightmargincolor
msgid "Right margin color"
msgstr "Цвет правой границы"

#: lazarusidestrconsts:dlgrightmousemovescursor
msgid "Right mouse moves caret"
msgstr "Правая кнопка перемещает курсор"

#: lazarusidestrconsts:lisrightsides
msgid "Right sides"
msgstr "Правые края"

#: lazarusidestrconsts:lisrightspaceequally
msgid "Right space equally"
msgstr ""

#: lazarusidestrconsts:dlgrubberbandgroup
msgid "Rubber band"
msgstr "Поле заметок"

#: lazarusidestrconsts:lismenuprojectrun
msgid "Run"
msgstr "Запуск"

#: lazarusidestrconsts:lismenurunfile
msgid "Run File"
msgstr "Запустить файл"

#: lazarusidestrconsts:lismenurunparameters
msgid "Run Parameters ..."
msgstr "Параметры запуска ..."

#: lazarusidestrconsts:srkmcatrunmenu
msgid "Run menu commands"
msgstr "Комаднды меню Запуск"

#: lazarusidestrconsts:dlgrunparameters
msgid "Run parameters"
msgstr "Параметры запуска"

#: lazarusidestrconsts:lismenuruntocursor
msgid "Run to cursor"
msgstr "Запуск до курсора"

#: lazarusidestrconsts:lisruntofailed
msgid "Run-to failed"
msgstr "Запуск-до не удался"

#: lazarusidestrconsts:lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Времени исполнения"

#: lazarusidestrconsts:rslanguagerussian
msgid "Russian"
msgstr "Русский"

#: lazarusidestrconsts:rslanguagerussianwin
msgid "Russian(CP1251)"
msgstr "Русский(CP1251)"

#: lazarusidestrconsts:rslanguagerussianutf
msgid "Russian(UTF8)"
msgstr "Русский (UTF8)"

#: lazarusidestrconsts:lissvnrevision
msgid "SVN Revision: "
msgstr ""

#: lazarusidestrconsts:dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "То же имя (в подкаталоге)"

#: lazarusidestrconsts:lismenusave
msgid "Save"
msgstr "Сохранить"

#: lazarusidestrconsts:lissavespace
msgid "Save "
msgstr "Сохранить "

#: lazarusidestrconsts:lismenusaveall
msgid "Save All"
msgstr "Сохранить все"

#: lazarusidestrconsts:lismenusaveas
msgid "Save As"
msgstr "Сохранить как"

#: lazarusidestrconsts:dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Сохранить как-автопереименовать в нижний регистр"

#: lazarusidestrconsts:lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Сохранить как шаблон..."

#: lazarusidestrconsts:lispckeditsavechanges
msgid "Save Changes?"
msgstr "Сохранить изменения?"

#: lazarusidestrconsts:lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Сохранить пакет %s (*.lpk)"

#: lazarusidestrconsts:lispkgmangsavepackage
msgid "Save Package?"
msgstr "Сохранить пакет?"

#: lazarusidestrconsts:lismenusaveproject
msgid "Save Project"
msgstr "Сохранить проект"

#: lazarusidestrconsts:lissaveprojectlpi
msgid "Save Project %s (*.lpi)"
msgstr "Сохранить прокет %s (*.lpi)"

#: lazarusidestrconsts:lismenusaveprojectas
msgid "Save Project As..."
msgstr "Сохранить проект как..."

#: lazarusidestrconsts:lissavesettings
msgid "Save Settings"
msgstr ""

#: lazarusidestrconsts:lishintsaveall
msgid "Save all"
msgstr "Сохранить все"

#: lazarusidestrconsts:lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Сохранить все сообщения в файл"

#: lazarusidestrconsts:liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Сохранить и выйти"

#: lazarusidestrconsts:lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Сохранить и выйти из диалога"

#: lazarusidestrconsts:lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Сохранить и перезапустить IDE"

#: lazarusidestrconsts:srkmecsaveas
msgid "Save as"
msgstr "Сохранить как"

#: lazarusidestrconsts:lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Сохранить изменения в проект %s?"

#: lazarusidestrconsts:lissavechanges
msgid "Save changes?"
msgstr "Сохранить изменения?"

#: lazarusidestrconsts:dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Сохр. рабочий стол в файл"

#: lazarusidestrconsts:dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Сохранять сведения о закрываемых файлах"

#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr ""

#: lazarusidestrconsts:dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Сохранять сведения только о файлах проекта"

#: lazarusidestrconsts:lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Сохранить файл %s%s%sперед закрытием формы %s%s%s?"

#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr ""

#: lazarusidestrconsts:lispckeditsavepackage
msgid "Save package"
msgstr "Сохранить пакет"

#: lazarusidestrconsts:lispkgmangsavepackage2
msgid "Save package?"
msgstr "Сохранить пакет?"

#: lazarusidestrconsts:fdmscaleword
msgid "Scale"
msgstr "Масштаб"

#: lazarusidestrconsts:lisscalingfactor
msgid "Scaling factor:"
msgstr "Масштабный фактор:"

#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Искать в модуле имя и процедуру Register"

#: lazarusidestrconsts:liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Поиск сообщений FPC"

#: lazarusidestrconsts:liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Поиск сообщений Make"

#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Поиск сообщений компилятора FreePascal в выводе"

#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Поиск сообщений make в выводе"

#: lazarusidestrconsts:dlgscope
msgid "Scope"
msgstr "Где"

#: lazarusidestrconsts:srvk_scroll
msgid "Scroll"
msgstr "Прокрутить"

#: lazarusidestrconsts:dlgscrollbyoneless
msgid "Scroll by one less"
msgstr ""

#: lazarusidestrconsts:srkmecscrolldown
msgid "Scroll down one line"
msgstr "Прокрутить вниз 1 строку"

#: lazarusidestrconsts:srkmecscrollleft
msgid "Scroll left one char"
msgstr "Прокрутить влево 1 символ"

#: lazarusidestrconsts:dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Прокрутить до конца файла"

#: lazarusidestrconsts:dlgscrollpastendline
msgid "Scroll past end of line"
msgstr "Прокрутить до конца строки"

#: lazarusidestrconsts:srkmecscrollright
msgid "Scroll right one char"
msgstr "Прокрутить влево 1 символ"

#: lazarusidestrconsts:srkmecscrollup
msgid "Scroll up one line"
msgstr "Прокрутить вверх 1 строку"

#: lazarusidestrconsts:lissearchfor
msgid "Search For "
msgstr "Искать "

#: lazarusidestrconsts:lismenuviewsearchresults
msgid "Search Results"
msgstr "Результаты поиска"

#: lazarusidestrconsts:lissearchagain
msgid "Search again"
msgstr "Искать снова"

#: lazarusidestrconsts:lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Искать и в комментариях"

#: lazarusidestrconsts:lispatheditsearchpaths
msgid "Search paths:"
msgstr "Пути поиска:"

#: lazarusidestrconsts:lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Строка поиска '%s' не найдена!"

#: lazarusidestrconsts:dlgsearchabort
msgid "Search terminated by user."
msgstr "Поиск прерван пользователем."

#: lazarusidestrconsts:lisssearchtext
msgid "Search text"
msgstr ""

#: lazarusidestrconsts:lisfrisearchwhere
msgid "Search where"
msgstr "Искать где"

#: lazarusidestrconsts:lisssearching
msgid "Searching"
msgstr ""

#: lazarusidestrconsts:dlgsearchcaption
msgid "Searching..."
msgstr "Поиск..."

#: lazarusidestrconsts:lisuesearching
msgid "Searching: %s"
msgstr "Ищу: %s"

#: lazarusidestrconsts:lisseemessages
msgid "See messages."
msgstr "См. сообщения."

#: lazarusidestrconsts:srkmecselleft
msgid "SelLeft"
msgstr "SelLeft"

#: lazarusidestrconsts:srkmecselright
msgid "SelRight"
msgstr "SelRight"

#: lazarusidestrconsts:lismenuselect
msgid "Select"
msgstr "Выделить"

#: lazarusidestrconsts:srkmecselectall
msgid "Select All"
msgstr "Выбрать все"

#: lazarusidestrconsts:lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Выберите файлы форм Delphi (*.dfm)"

#: lazarusidestrconsts:srkmecseldown
msgid "Select Down"
msgstr "Выделить вниз"

#: lazarusidestrconsts:srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Выделить переход по коорд."

#: lazarusidestrconsts:srkmecsellineend
msgid "Select Line End"
msgstr "Выделить конец строки"

#: lazarusidestrconsts:srkmecsellinestart
msgid "Select Line Start"
msgstr "Выделить начало строки"

#: lazarusidestrconsts:lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Выбрать меню:"

#: lazarusidestrconsts:srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Выделить низ страницы"

#: lazarusidestrconsts:srkmecselpagedown
msgid "Select Page Down"
msgstr "Выделить страницу снизу"

#: lazarusidestrconsts:srkmecselpageleft
msgid "Select Page Left"
msgstr "Выделить страницу слева"

#: lazarusidestrconsts:srkmecselpageright
msgid "Select Page Right"
msgstr "Выделить страницу справа"

#: lazarusidestrconsts:srkmecselpagetop
msgid "Select Page Top"
msgstr "Выделить верх страницы"

#: lazarusidestrconsts:srkmecselpageup
msgid "Select Page Up"
msgstr "Выделить страницу сверху"

#: lazarusidestrconsts:lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Выбрать шаблон:"

#: lazarusidestrconsts:srkmecselup
msgid "Select Up"
msgstr "Выделить вверх"

#: lazarusidestrconsts:srkmecselwordleft
msgid "Select Word Left"
msgstr "Выделить слово слева"

#: lazarusidestrconsts:srkmecselwordright
msgid "Select Word Right"
msgstr "Выделить слово справа"

#: lazarusidestrconsts:lisselectahelpitem
msgid "Select a help item:"
msgstr "Искать элемент справки:"

#: lazarusidestrconsts:lisselectanode
msgid "Select a node"
msgstr "Выберите элемент"

#: lazarusidestrconsts:lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Выберите тип проекта"

#: lazarusidestrconsts:lismenuselectall
msgid "Select all"
msgstr "Выделить все"

#: lazarusidestrconsts:lismenuselectcodeblock
msgid "Select code block"
msgstr "Выделить блок кода"

#: lazarusidestrconsts:lispatheditselectdirectory
msgid "Select directory"
msgstr "Выбрать каталог"

#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
msgid "Select grand childs"
msgstr ""

#: lazarusidestrconsts:lismenuselectline
msgid "Select line"
msgstr "Выделить строку"

#: lazarusidestrconsts:lismenuselectparagraph
msgid "Select paragraph"
msgstr "Выделить абзац"

#: lazarusidestrconsts:lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Выбрать родительский компонент"

#: lazarusidestrconsts:srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Выделить до самого начала"

#: lazarusidestrconsts:srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Выделить до самого конца"

#: lazarusidestrconsts:lismenuselecttobrace
msgid "Select to brace"
msgstr "Выделить до скобки"

#: lazarusidestrconsts:lismenuselectword
msgid "Select word"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Выделить элемент:"

#: lazarusidestrconsts:dlgselectedtext
msgid "Selected Text"
msgstr "В выделенном"

#: lazarusidestrconsts:lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Выбранный пакет нужен для:"

#: lazarusidestrconsts:dlgruberbandselectioncolor
msgid "Selection"
msgstr "Выделение"

#: lazarusidestrconsts:lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Выбор превышает строковую константу"

#: lazarusidestrconsts:lisselectiontool
msgid "Selection tool"
msgstr "Инструмент выбора"

#: lazarusidestrconsts:liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Точка с запятой"

#: lazarusidestrconsts:srkmecsetmarker
msgid "Set Marker %d"
msgstr "Установить маркер %d"

#: lazarusidestrconsts:uemsetfreebookmark
msgid "Set a free Bookmark"
msgstr ""

#: lazarusidestrconsts:lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr ""

#: lazarusidestrconsts:dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Установить все элементы по умолчанию"

#: lazarusidestrconsts:dlgsetelementdefault
msgid "Set element to default"
msgstr "Установить элемент по умолчанию"

#: lazarusidestrconsts:dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Переменная свойства"

#: lazarusidestrconsts:lislazbuildsettobuildall
msgid "Set to %sBuild All%s"
msgstr "Установить %sСобрать все%s"

#: lazarusidestrconsts:srvk_shift
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts:srkmecshifttab
msgid "Shift Tab"
msgstr ""

#: lazarusidestrconsts:lislazdocshorttag
msgid "Short"
msgstr ""

#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Должен ли файл быть переименован в нижн. рег. в %s%s%s%s?"

#: lazarusidestrconsts:lisaf2pshowall
msgid "Show All"
msgstr "Показать все"

#: lazarusidestrconsts:lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Показать значения CodeTools"

#: lazarusidestrconsts:dlgcoshowerr
msgid "Show Errors"
msgstr "Показать ошибки"

#: lazarusidestrconsts:dlgguidelines
msgid "Show Guide Lines"
msgstr "Показать линии помощи"

#: lazarusidestrconsts:dlgshowhint
msgid "Show Hints"
msgstr "Показать подсказки"

#: lazarusidestrconsts:dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Подсказки для ненужных модулей в главном исходнике"

#: lazarusidestrconsts:uemshowlinenumbers
msgid "Show Line Numbers"
msgstr ""

#: lazarusidestrconsts:dlgshownotes
msgid "Show Notes"
msgstr "Показать заметки"

#: lazarusidestrconsts:dlgcoshowoptions
msgid "Show Options"
msgstr "Показать опции"

#: lazarusidestrconsts:fdmshowoptions
msgid "Show Options for form editing"
msgstr "Показать настройки для редактирования форм"

#: lazarusidestrconsts:dlgshowwarnings
msgid "Show Warnings"
msgstr "Показать предупреждения"

#: lazarusidestrconsts:lisa2pshowall
msgid "Show all"
msgstr "Показать все"

#: lazarusidestrconsts:liscoshowallmessages
msgid "Show all messages"
msgstr "Показать все сообщения"

#: lazarusidestrconsts:dlgshowprocserror
msgid "Show all procs on error"
msgstr "Все проц-ры при ошибках"

#: lazarusidestrconsts:dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Показать кнопки закрытия закладок"

#: lazarusidestrconsts:srkmecshowcodecontext
msgid "Show code context"
msgstr ""

#: lazarusidestrconsts:dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Показать компилируемые процедуры"

#: lazarusidestrconsts:dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Показать опции компилятора"

#: lazarusidestrconsts:dlgshowcaps
msgid "Show component captions"
msgstr "Показать названия компонентов"

#: lazarusidestrconsts:dlgshowconditionals
msgid "Show conditionals"
msgstr "Показать условия"

#: lazarusidestrconsts:dlgshowdebuginfo
msgid "Show debug info"
msgstr "Показать отладочную инф-ю"

#: lazarusidestrconsts:dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Показать определённые макросы"

#: lazarusidestrconsts:dlgshowedrhints
msgid "Show editor hints"
msgstr "Показвать подсказки редактора"

#: lazarusidestrconsts:dlgshoweverything
msgid "Show everything"
msgstr "Показать всё"

#: lazarusidestrconsts:dlgshowgeneralinfo
msgid "Show general info"
msgstr "Показать общие сведения"

#: lazarusidestrconsts:dlgqshowgrid
msgid "Show grid"
msgstr "Показать сетку"

#: lazarusidestrconsts:dlgshowgutterhints
msgid "Show gutter hints"
msgstr ""

#: lazarusidestrconsts:lisshowhintsinobjectinspector
msgid "Show hints in Object Inspector"
msgstr ""

#: lazarusidestrconsts:dlgshowlinenumbers
msgid "Show line numbers"
msgstr "Показать номера строк"

#: lazarusidestrconsts:dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Ничего не показывать(только ошибки)"

#: lazarusidestrconsts:dlgshowscrollhint
msgid "Show scroll hint"
msgstr ""

#: lazarusidestrconsts:dlgshowsummary
msgid "Show summary"
msgstr "Показать обзор"

#: lazarusidestrconsts:dlgshowtriedfiles
msgid "Show tried files"
msgstr ""

#: lazarusidestrconsts:dlgshowusedfiles
msgid "Show used files"
msgstr "Показать используемые файлы"

#: lazarusidestrconsts:lissimplesyntax
msgid "Simple Syntax"
msgstr ""

#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Простой синтаксис (напр., * вместо .*)"

#: lazarusidestrconsts:fdmsizeword
msgid "Size"
msgstr "Размер"

#: lazarusidestrconsts:lisuidsize
msgid "Size:"
msgstr ""

#: lazarusidestrconsts:liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Пропуск вызова компилятора"

#: lazarusidestrconsts:lisskiploadinglastproject
msgid "Skip loading last project"
msgstr ""

#: lazarusidestrconsts:dlgcosmaller
msgid "Smaller Code"
msgstr "Меньший код"

#: lazarusidestrconsts:dlgcosmartlinkable
msgid "Smart Linkable"
msgstr ""

#: lazarusidestrconsts:dlgsmarttabs
msgid "Smart tabs"
msgstr ""

#: lazarusidestrconsts:dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Выравнивать по линиям помощи"

#: lazarusidestrconsts:dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Выравнивать по сетке"

#: lazarusidestrconsts:srvk_snapshot
msgid "Snapshot"
msgstr "Снимок"

#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Некоторые файлы изменены на диске:"

#: lazarusidestrconsts:lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Извините, пока не реализовано"

#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Извините, этот тип ещё не реализован"

#: lazarusidestrconsts:lismenusortselection
msgid "Sort selection"
msgstr "Сортировка выбранного"

#: lazarusidestrconsts:lismenuviewsourceeditor
msgid "Source Editor"
msgstr "Редактор исходников"

#: lazarusidestrconsts:srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Команды закладок исходника"

#: lazarusidestrconsts:lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Источник и назначение одинаковы:%s%s"

#: lazarusidestrconsts:lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Точка останова в исходнике"

#: lazarusidestrconsts:lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr ""

#: lazarusidestrconsts:lissourcemodified
msgid "Source modified"
msgstr "Исходник изменён"

#: lazarusidestrconsts:lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Исходник страницы %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts:lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Предпросмотр исходника"

#: lazarusidestrconsts:dlgspacenotcosmos
msgid "Space"
msgstr "Пробел"

#: lazarusidestrconsts:lisspaceequally
msgid "Space equally"
msgstr ""

#: lazarusidestrconsts:srvk_space
msgid "Space key"
msgstr "Кнопка пробел"

#: lazarusidestrconsts:rslanguagespanish
msgid "Spanish"
msgstr "Испанский"

#: lazarusidestrconsts:rslanguagespanishutf
msgid "Spanish (UTF8)"
msgstr "Испанский (UTF8)"

#: lazarusidestrconsts:lisuidsrc
msgid "Src"
msgstr "Исх"

#: lazarusidestrconsts:dlgcostack
msgid "Stack"
msgstr "Стека"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Стандартное меню Правка"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Стандартное меню Файл"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Стандартное меню Справка"

#: lazarusidestrconsts:lisoipstate
msgid "State"
msgstr "Состояние"

#: lazarusidestrconsts:dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "Ключевое слово Static в объектах"

#: lazarusidestrconsts:lishintstepinto
msgid "Step Into"
msgstr "Шаг со входом"

#: lazarusidestrconsts:lishintstepover
msgid "Step Over"
msgstr "Шаг в обход"

#: lazarusidestrconsts:lismenustepinto
msgid "Step into"
msgstr "Шаг со входом"

#: lazarusidestrconsts:lismenustepover
msgid "Step over"
msgstr "Шаг в обход"

#: lazarusidestrconsts:lismenustop
msgid "Stop"
msgstr "Останов"

#: lazarusidestrconsts:lisstopdebugging
msgid "Stop Debugging?"
msgstr "Остановить отладку?"

#: lazarusidestrconsts:dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Останов после числа ошибок"

#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr ""

#: lazarusidestrconsts:lisstopdebugging2
msgid "Stop debugging?"
msgstr ""

#: lazarusidestrconsts:lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Остановить отладку?"

#: lazarusidestrconsts:dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Префикс STORED"

#: lazarusidestrconsts:lisstreamingerror
msgid "Streaming error"
msgstr "Ошибка потоков"

#: lazarusidestrconsts:lismakeresstrstringconstantinsource
msgid "String Constant in source"
msgstr "Строковая константа в исходнике"

#: lazarusidestrconsts:liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Строковая константа"

#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Строки с тем же значением:"

#: lazarusidestrconsts:dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Вырезать символы из бинарника"

#: lazarusidestrconsts:dlgcostyle
msgid "Style:"
msgstr "Стиль:"

#: lazarusidestrconsts:lissubprocedure
msgid "Sub Procedure"
msgstr "Подпроцедура"

#: lazarusidestrconsts:lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Подпроцедура того же уровня"

#: lazarusidestrconsts:dlgedbsubdir
msgid "Sub directory"
msgstr "Подкаталог"

#: lazarusidestrconsts:dlgsubpropkcolor
msgid "Subpropertes"
msgstr ""

#: lazarusidestrconsts:lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Переключить пути"

#: lazarusidestrconsts:srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Переключить модуль/форму"

#: lazarusidestrconsts:liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Символ"

#: lazarusidestrconsts:dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Символ сзади (.~pp)"

#: lazarusidestrconsts:dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Символ спереди (.~pp)"

#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - компонент редактора, используемый Lazarus. http://sourceforge.net/projects/synedit/"

#: lazarusidestrconsts:srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Проверка синтаксиса"

#: lazarusidestrconsts:dlgsyntaxoptions
msgid "Syntax options"
msgstr ""

#: lazarusidestrconsts:dlgrunosystemvariables
msgid "System variables"
msgstr "Системные переменные"

#: lazarusidestrconsts:dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Совместимость с TP/BP 7.0"

#: lazarusidestrconsts:srvk_tab
msgid "Tab"
msgstr "ТАБ"

#: lazarusidestrconsts:dlgtabindent
msgid "Tab indents blocks"
msgstr "ТАБ выделяет блоки"

#: lazarusidestrconsts:fdmtaborder
msgid "Tab order..."
msgstr ""

#: lazarusidestrconsts:dlgtabwidths
msgid "Tab widths:"
msgstr "Ширина табулятора"

#: lazarusidestrconsts:dlgtabstospaces
msgid "Tabs to spaces"
msgstr "ТАБ в пробелы"

#: lazarusidestrconsts:lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "ТАБ сделать пробелами в выделенном"

#: lazarusidestrconsts:listargetcpu
msgid "Target CPU"
msgstr "Для ЦП:"

#: lazarusidestrconsts:lislazbuildtargetdirectory
msgid "Target Directory:"
msgstr "Каталог назначения:"

#: lazarusidestrconsts:listargetos
msgid "Target OS"
msgstr "Для какой ОС"

#: lazarusidestrconsts:liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Специфические параметры ОС"

#: lazarusidestrconsts:lislazbuildtargetos
msgid "Target OS:"
msgstr "Для ОС:"

#: lazarusidestrconsts:dlgtargetproc
msgid "Target Processor:"
msgstr "Процессор бинарника:"

#: lazarusidestrconsts:dlgpotargetfilename
msgid "Target file name:"
msgstr "Имя исполняемого файла:"

#: lazarusidestrconsts:listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Имя файла бинарника с параметрами"

#: lazarusidestrconsts:listargetfilenameofproject
msgid "Target filename of project"
msgstr "Имя файла бинарника проекта"

#: lazarusidestrconsts:lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Просмотр шаблона"

#: lazarusidestrconsts:dlgtplfname
msgid "Template file name"
msgstr "Имя файла шаблона"

#: lazarusidestrconsts:lisctdtemplates
msgid "Templates"
msgstr ""

#: lazarusidestrconsts:liscomptest
msgid "Test"
msgstr "Тест"

#: lazarusidestrconsts:listestdirectory
msgid "Test directory"
msgstr "Каталог проб"

#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Каталог проб \"%s\" не найден."

#: lazarusidestrconsts:lispkgfiletypetext
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts:dlgtextattributes
msgid "Text attributes"
msgstr "Параметры текста"

#: lazarusidestrconsts:srkmcatediting
msgid "Text editing commands"
msgstr "Команды редактирования текста"

#: lazarusidestrconsts:srkmcatmarker
msgid "Text marker commands"
msgstr "Команды маркера текста"

#: lazarusidestrconsts:srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Команды поиска и замены текста"

#: lazarusidestrconsts:srkmcatselection
msgid "Text selection commands"
msgstr "Команды выделения текста"

#: lazarusidestrconsts:lisfindfiletexttofind
msgid "Text to find:"
msgstr "Искать текст:"

#: lazarusidestrconsts:lisdiffdlgtext1
msgid "Text1"
msgstr "Текст1"

#: lazarusidestrconsts:lisdiffdlgtext2
msgid "Text2"
msgstr "Текст2"

#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Главный каталог %s,%sгде Borland установил %s исходники,%sкоторые использует этот %s проект.%sНапример: /home/user/kylix%s"

#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Главный каталог %s, %sгде Borland установил все исходники %s,используемые проектом %s. %sНапример: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Главный каталог %s,%sгде Borland установил все %s исходники.%sНапример: /home/user/kylix%s"

#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Главный каталог %s, %sгде Borland установил все исходники %s. %sНапример: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Каталог %s проекта,%sсодержащий файлы .dpr, dpk."

#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "FCL - библиотека компонентов FreePascal - обеспечивает базовые классы для объектного паскаля."

#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ."
msgstr "Каталог исходников FPC \"%s\" выглядит некорректно. Обычно он содержит каталоги rtl, fcl, packages, compiler, ... ."

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedir
msgid "The Free Pascal CVS source directory."
msgstr "Каталог исходников CVS FreePascal"

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal CVS source directory. Not required. This will improve find declarationand debugging."
msgstr "Каталог исходников CVS FreePascal. Не требуется. Улучшит поиск описаний и отладку."

#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Компилятор FreePascal (имя файла: %s) не найден.%sВам рекомендуется установить fpc"

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Каталог проекта FreePascal."

#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "Каталог исходников FPC не найден.%sОтдельные действия с кодом не будут работать.%sРекомендуется установить его и установить путь%sEnvironment -> Environment Options -> Files"

#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL - Библиотека компонентов Lazarus - содержит все основные компоненты для редактирования форм."

#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "LFM-файл (файл формы Lazarus) содержит некорректные свойства. Это значит, например, что он содержит некоторые свойства/классы, которых нет в текущей версии LCL. Обычно следует убрать эти свойства из lfm и (если надо) исправить код паскаля вручную."

#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files"
msgstr "Каталог Lazarus не найден.%sВы не сможете создавать приложения LCL.Проверьте Environment -> Environment Options -> Files"

#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Главный каталог Lazarus."

#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Максимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"

#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Максимальная версия меньше минимальной."

#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Минимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"

#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Пробный каталог не найден:%s%s%s%s%s (см. настройки окружения)"

#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Название типа предка %s%s%s совпадает с%sмодулем %s%s%sю"

#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Тип предка %s%s%s - неправильный идентификатор паскаля"

#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Класс %s%s%s - элемент управления (TControl), его нельзя вставить на что-то другое.%sНе могу вставить."

#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Имя класса %s%s%s и его предка %s%s%s совпадают."

#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Имя класса %s%s%s уже есть в%sПакете %s%sФайл: %s%s%s"

#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Имя класса %s%s%s совпадает с %s именем модуля %s%s%s."

#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Имя класса %s%s%s - недопустимый идентификатор паскаля"

#: lazarusidestrconsts:listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Команда после %s%s%s"

#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Команда после опубликования некорректна:%s%s%s%s"

#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Файл компилятора \"%s\" не исполняемый."

#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Файл компилятора для пакета %s - недопустимый исполняемый:%s%s"

#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Редактор компонента для класса %s%s%sсвязанный со словом #%s %s%s%sвызвал ошибку:%s%s%s%s"

#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%shas created the error:%s%s%s%s"
msgstr "Редактор компонента для класса %s%s%sвызвал ошибку:%s%s%s%s"

#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Текущий каталог исходников FPC %s%s%s%sвыглядит неправильно.%sПроверьте Environment -> Environment Options -> Files"

#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Текущий каталог исходников FPC %s%s%s%sвыглядит неправильно.%sВыберите ОК чтобы вернуть используемый по умолчанию %s%s%s,%s или же проверьте Environment -> Environment Options -> Files"

#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Текущий каталог Lazarus %s%s%s%sвыглядит неправильно.%sБез него Вы не сможете создавать приложения LCL.%sПроверьте Environment -> Environment Options -> Files"

#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Текущий каталог Lazarus %s%s%s%sвыглядит неправильно.%sБез него Вы не сможете создавать приложения LCL.%sВыберите ОК для использования каталога по умолчанию %s%s%s,%s или же проверьте Environment -> Environment Options -> Files"

#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "%s%s%s.%sИначе проверьте Окружение->Настройки окружения->Файлы"

#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files"
msgstr "Текущее имя компилятора %s%s%s%s - не исполняемый файл.%sПроверьте Environment -> Environment Options -> Files"

#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Текущий путь модуля для файла %s%s%s%s - %s%s%s%s.%s%sПуть к модулям LCL %s%s%s отсутствует.%s%sПодсказка для новичков:%sСоздайте приложение lazarus и поместите файл в каталог проекта."

#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr ""

#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Файл отладчика \"%s\" не исполняемый."

#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Зависимость %s%s%s не найдена.%sВыберите существующий пакет."

#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Каталог назначения%s%s%s%s не существует."

#: lazarusidestrconsts:dlgthedirectory
msgid "The directory \""
msgstr "Каталог \""

#: lazarusidestrconsts:listhefile
msgid "The file %s%s%s"
msgstr "Файл %s%s%s"

#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Файл %s%s%s уже в пакете."

#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "Файл %s%s%s не проект Delphi (.dpr)"

#: lazarusidestrconsts:listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "Файл %s%s%s - не модуль Delphi."

#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Файл %s%s%s - не пакет Lazarus."

#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Файл %s%s%s - часть текущего проекта.%sНе лучшая идея - делить файлы между проектами и пакетами."

#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Файл %s%s%s%sуже в пакете %s."

#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Файл %s%s%s%sсейчас не находится в списке путей модулей пакета.%s%sДобавить его туда?"

#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Файл %s%s%s%sвыглядит как программа. Закрыть текущий проект и создать новый проект lazarus для этой программы?%s\"Нет\" откроет файл как обычный исходник."

#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarus
msgid "The file %s%s%s%sseems to be the program file of an existing lazarus Project1.%sOpen project?%sCancel will load the file as normal source."
msgstr "Файл %s%s%s%s похож на файл программы существующего Проекта1 lazarus.%sОткрыть проект?%sОтмена загрузит файл как обычный исходник."

#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Файл %s%s%s%sнайден в одном из каталогов исходника пакета %s, и он выглядит как откомпилированный модуль. Такие модули должны быть в специальном каталоге пакета, иначе другие пакеты не смогут правильно использовать пакте.%s%sУдалить такие файлы?"

#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Файл %s%s%s%sне найден.%sВы хотите поискать его самостоятельно?%s"

#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Файл %s%s%s%sне найден.%sПропуск продолжит загрузку проекта,%sПрервать - остановит загрузку."

#: lazarusidestrconsts:uefilerotext1
msgid "The file \""
msgstr "Файл \""

#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Имя файла %s%s%s - часть текущего проекта.%sПроекты и пакеты не должны бы делить файлы."

#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Имя файла %s%s%sиспользуется%sпакетом %s%s%s%sв файле %s%s%s."

#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Имя файла %s%s%s не соответствует имени пакета %s%s%s в файле.%sСменить имя пакета на %s%s%s?"

#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr ""

#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr ""

#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr ""

#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or the units came from a case insensitive file system (windows/Delphi) and are now on a case sensitive filesystem (linux, bsd, macosx). In this case you should abort now, rename the units all lowercase and try again.%s3) Or you can ignore the missing units and continue.%s%sShould the missing units be commented out?"
msgstr "Не найдены следующие модули:%s%s%s%s1)Либо этих модулей нет в пути поиска модулей, тогда прервите операцию сейчас, исправьте пути модулей и попробуйте снова.%s2) Возможно, модули поступили из регистронезависимой системы (windows/Delphi), а сейчас на регистрозависимой системе (linux, bsd, macosx). В этом случае сейчас прервите операцию, переименуйте модули в нижний регистр и попробуйте снова.%s3) Можно игнорировать отсутствуюзие модули и продолжить.%s%sДолжны ли отсутствующие модули быть закомментированы?"

#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Главное приложение %s%s%s - не исполняемый файл."

#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr ""

#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Каталог lazarus \"%s\" выглядит некорректно. Обычно он содержит каталоги lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Файл make \"%s\" - не исполняемый файл."

#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Максимальная версия %s%s%s - неправильная версия пакета.%s(хороший пример 1.2.3.4)"

#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Минимальная версия %s%s%s - неправильная версия пакета.%s(хороший пример 1.2.3.4)"

#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Имя %s%s%s - неправильный идентификатор паскаля."

#: lazarusidestrconsts:lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Слово \"%s\" - неправильный идентификатор языка паскаль."

#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Пакет %s - пакет только времени выполнения.%sТакие пакеты не могут встраиваться в IDE."

#: lazarusidestrconsts:lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Пакет %s только для чтения."

#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Пакет %s требуется для %s, который помечен на установку.%sСмотри диаграмму пакетов."

#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Пакет %s имеет файл%s%s%s%s.%sДолжен ли файл быть переименован, как и пакет?"

#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Пакет %s%s%s имеет метку Автоинсталляция.%sЭто значит, что он автоматически встроится в IDE. Устанавливаемые пакеты%sдолжны быть для разработки."

#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file was found.%sA broken dummy package was created."
msgstr "Пакет %s%s%s установлен, но не было найдено правильного файла пакета.%sБыл создан пустой псевдопакет."

#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Пакет %s%s%s отмечен на установку, но не найден.%sУдалить зависимость из списка установки пакетов?"

#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Пакет %s%s%s помечен на установку.%sСейчас lazarus поддерживает только статически связанные пакеты. Настоящая установка требует пересборки и перезапуска lazarus.%s%sВы хотите перебрать Lazarus сейчас?"

#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Пакет %s%s%s отмечен.%sСейчас lazarus поддерживает только статически связанные пакеты. Настоящее удаление требует пересборки и перезапуска lazarus.%s%sВы хотите перебрать Lazarus сейчас?"

#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Имя пакета %s%s%s в%s%s%s%s -  неправильное имя пакета lazarus."

#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Пакет уже имеет зависимость от пакета %s%s%s"

#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Имя пакета %s%s%s некорректно.%sВыберите существующий пакет."

#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Имя пакета %s%s%s некорректно.%sВыберите существующий пакет."

#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Имя пакета %s%s%s некорректно.%sВыберите другой пакет (напр., package1.lpk)."

#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Имя пакета %s%s%s %sфайла %s%s%s некорректно."

#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Имя пакета %s%s%s слишком длинное (надо до 100 симв.)."

#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC CVS source below. Used to autocreate macros."
msgstr "Путь к компилятору FreePascal для этого проекта. Требуется только если Вы ранее установили FPC CVS. Используется для автосоздания макросов."

#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Путь к компилятору FreePascal.%s Например, %s/usr/bin%s -n%s или %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Программа %smake%s не найдена.%sЭтот инструмент нужен, чтобы собрать lazarus.%s"

#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Проект уже зависит от пакета %s%s%s."

#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Файл сведений проекта %s%s%s%sсовпадает с главным исходником!"

#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Проект надо сохранить до компиляции%sЕсли Вы установите каталог проб в настройках окружения,%sВы можете создавать новые проекты и собирать их сразу.%sСохранить прокет?"

#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Проект требует пакет %s%s%s.%sНо он не найден. См. Прокет -> Инспектор проекта."

#: lazarusidestrconsts:lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Строка ресурсов %s%s%s уже есть. %sВыберите другое имя. %s Используйте Пропуск, чтобы добавить как есть."

#: lazarusidestrconsts:listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Компонент верхнего уровня не может быть удалён."

#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Модуль %s%s%s уже есть. Пропуск приведёт к переименованию,%sОтмена отменить сохранение этого файла, а%sПрервать - отменит сохранение вообще."

#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
msgstr "Модуль %s%s%s не в нижнем регистре.%sКомпилятор FreePascal 1.0.x требует имена в нижнем регистре. Если Вы не используете fpc 1.0.x для сборки этого модуля, можно игнорировать это сообщение.%s%sПереименовать файл?"

#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Модуль уже называется %s%s%s. Идентификаторы паскаля должны быть уникальны."

#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Имя модуля %s%s%s уже есть в проекте%sв файле: %s%s%s."

#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Имя модуля %s%s%s уже есть в выделении%sв файле: %s%s%s."

#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s and filename differ."
msgstr "Имя модуля %s%s%s и имя файла разные."

#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Имя модуля %s%s%s не соответствует имени файла"

#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Имя модуля %s%s%s - недопустимый идентификатор паскаля."

#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Имя модуля совпадает с зарегистрированным компонентом.%sЭто может привести к странным сообщениям об ошибках."

#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Имя модуля %s%s%s уже занято в этом пакете:%s%s"

#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Имя модуля %s%s%s уже занято в этом пакете."

#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Во всплывающем меню больше функций"

#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "В каталоге есть и другие файлы с таким же именем,%sотличающиеся только регистром:%s%s%sУдалить их?"

#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Есть два модуля с одинаковым именем:%s%s1. %s%s%s из %s%s2. %s%s%s из %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Есть модуль FPC с таким же именем, как и пакет:%s%s%s%s%s%s"

#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Есть модуль FPC с таким же именем, как:%s%s%s%s%s из %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Обнаружен цикл зависимостей пакетов. Смотрите диаграмму пакетов."

#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "На диске есть файл с таким же именем и похожим расширением%sФайл: %s%sПохожий файл: %s%s%sУдалить второй файл?"

#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Допускается максимум %s инструментов."

#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose
msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name"
msgstr "В проекте есть модуль с именем %s%s%s.%sВыберите другое имя"

#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Есть модуль с тем же именем, что и пакет: %s%s1. %s%s%s из %s%s2. %s%s%s%s"

#: lazarusidestrconsts:listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Уже есть форма с именем %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Уже загружен пакет %s%s%s %sиз файла %s%s%s.%sСм. Компоненты -> Диаграмма пакетов.%sЗамена невозможна."

#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Уже есть модуль, называемый %s%s%s. Идентификаторы паскаля должны быть уникальны."

#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Уже есть другой пакет с именем %s%s%s.%sКонфликтующий пакет:%s%s%s%sФайл: %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Среди требуемых пакетов есть несохранённый. См. диаграмму пакетов."

#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Произошла ошибка при записи выбранных компонентов %s:%s:%s%s"

#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Произошла ошибка при преобразовании бинарного потока выбранного компонента %s:%s:%s%s"

#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Произошла ошибка при копировании потока компонента в буфер:%s%s"

#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Этот файл отсутствует во всех загруженных пакетах."

#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr ""

#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr ""

#: lazarusidestrconsts:lisresourcefilecomment
msgid "This is an automatically generated lazarus resource file"
msgstr "Это - файл ресурсов, автоматически созданный lazarus"

#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Это - пакет по умолчанию. Используется только для компонентов без пакета. Такие компоненты устарели."

#: lazarusidestrconsts:listhislookslikeapascalfilefpc10xexpectspascalfiles
msgid "This looks like a pascal file.%sfpc 1.0.x expects pascal files lowercase.%sRename it to lowercase?"
msgstr "Это похоже на файл паскаля.%sfpc 1.0.х требует файлы паскаля в нижнем регистре.%sПереименовать?"

#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found.All its components are deactivated. Please fix this."
msgstr "Этот пакет установлен, но файл lpk не найден.Все компоненты инактивированы. Исправьте."

#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr ""

#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Это выражение не может быть извлечено.%sВыберите какой-то код, чтобы извлечь новую процедуру/метод."

#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Требуются заголовок и имя файла"

#: lazarusidestrconsts:dlgpotitle
msgid "Title:"
msgstr "Заголовок:"

#: lazarusidestrconsts:listodolistcaption
msgid "ToDo List"
msgstr "Список ToDo"

#: lazarusidestrconsts:listodolistoptions
msgid "ToDo options..."
msgstr "Настройки ToDo..."

#: lazarusidestrconsts:lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Переключить форму/модуль"

#: lazarusidestrconsts:srkmectogglemode
msgid "Toggle Mode"
msgstr "Переключить режим"

#: lazarusidestrconsts:lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Переключить форму/модуль"

#: lazarusidestrconsts:liscodetempltoken
msgid "Token:"
msgstr ""

#: lazarusidestrconsts:lisctdefstools
msgid "Tools"
msgstr "Инструменты"

#: lazarusidestrconsts:srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Команды меню Инструменты"

#: lazarusidestrconsts:dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr ""

#: lazarusidestrconsts:dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr ""

#: lazarusidestrconsts:listopspaceequally
msgid "Top space equally"
msgstr ""

#: lazarusidestrconsts:dlgtoppos
msgid "Top:"
msgstr "Верх:"

#: lazarusidestrconsts:listops
msgid "Tops"
msgstr ""

#: lazarusidestrconsts:dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Обрезать хвостовые пробелы"

#: lazarusidestrconsts:lismenutemplatetutorial
msgid "Tutorial"
msgstr "Учебник"

#: lazarusidestrconsts:dlgenvtype
msgid "Type"
msgstr "Тип"

#: lazarusidestrconsts:lisuidtype
msgid "Type:"
msgstr "Тип:"

#: lazarusidestrconsts:dlgcdtuppercase
msgid "UPPERCASE"
msgstr "ВЕРХНИЙ РЕГИСТР"

#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Не могу преобразовать бинарный поток в текст"

#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Не могу скопировать компоненты в буфер"

#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Не могу добавить %s к проекту, т.к. в проекте уже есть модуль с таким именем."

#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Не могу добавить ресурс T%s:FORMDATA к файлу ресурсов %s%s%s%s.%sВозможно, ошибка синтаксиса."

#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Не могу добавить комментарий заголовка ресурса к файлу ресурса %s%s%s%s.%sВозможно, ошибка синтаксиса."

#: lazarusidestrconsts:lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Не могу сохранить резервный файл %s%s%s как %s%s%s!"

#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first."
msgstr "Не могу изменить список автосоздаваемых форм в исходнике программы.%sИсправьте сначала ошибки."

#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Не могу очистить %s%s%s.%sПроверьте доступ."

#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Не могу очистить каталог назначения"

#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Не могу преобразовать компонент из текстового в бинарный формат:%s%s"

#: lazarusidestrconsts:lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Не могу перевести файл %s%s%s%sОшибка: %s"

#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Невозможно преобразовать lfm в lrs и записать lrs-файл."

#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Не могу превратить текстовые данные формы файла %s%s%s%s%sв двоичный поток. (%s)"

#: lazarusidestrconsts:lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Не могу скопировать файл"

#: lazarusidestrconsts:lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Не могу скопировать файл %s%s%s%sв %s%s%s"

#: lazarusidestrconsts:lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Не могу скопировать файл %s%s%s%sв %s%s%s."

#: lazarusidestrconsts:lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Не могу создать резервный каталог %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Не могу создать каталог"

#: lazarusidestrconsts:lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Не могу создать каталог %s%s%s"

#: lazarusidestrconsts:lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Не могу создать каталог %s%s%s."

#: lazarusidestrconsts:lisunabletocreatefile
msgid "Unable to create file"
msgstr "Не могу создать файл"

#: lazarusidestrconsts:lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Не могу создать файл %s%s%s"

#: lazarusidestrconsts:lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Не могу создать файл %s%s%s."

#: lazarusidestrconsts:lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Не могу создать файл %s%s%s%s"

#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin
msgid "Unable to create new method. Plz fix the error shown in the message window."
msgstr "Не могу создать новый метод. Исправьте ошибки, указанные в окне сообщений."

#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Не могу создать каталог вывода %s%s%s%sиз пакета %s."

#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Не могу создать каталог исходника пакета %s%s%s%sдля пакета %s."

#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Не могу создать каталог цели для lazarus:%s%s%s%s.%sЭтот каталог нужен для вновь изменённой IDE lazarus с вашими пакетами."

#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr ""

#: lazarusidestrconsts:lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Не могу удалить двусмысленный файл %s%s%s"

#: lazarusidestrconsts:lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Не могу удалить файл"

#: lazarusidestrconsts:lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Не могу удалить файл %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Не могу удалить старый файл %s%s%s%s из пакета %s."

#: lazarusidestrconsts:lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr ""

#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Не могу найти секцию ResourceStribg в этом или любом используемом модуле."

#: lazarusidestrconsts:lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Не могу найти правильное имя класса в %s%s%s"

#: lazarusidestrconsts:lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Не могу найти файл %s%s%s."

#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files"
msgstr "Не могу найти файл %s%s%s.%sПроверьте путь поиска в%sПроект->Параметры компилятора...->Пути->Другие файлы модулей"

#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage
msgid "Unable to find method. Plz fix the error shown in the message window."
msgstr "Не могу найти метод. Исправьте ошибки в окне сообщений."

#: lazarusidestrconsts:lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr ""

#: lazarusidestrconsts:lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr ""

#: lazarusidestrconsts:lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Не могу загрузить файл"

#: lazarusidestrconsts:lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Не могу загрузить файл %s%s%s."

#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Не могу загрузить старый ресурсный файл.%sЭтот файл - первый включаемый файл в%s раздел инициализации.%sНапример, {$I %s.lrs}.%sВозможно, ошибка синтаксиса."

#: lazarusidestrconsts:lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Не могу загрузить пакет"

#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr ""

#: lazarusidestrconsts:lisunabletoreadfile
msgid "Unable to read file"
msgstr "Не могу прочитать файл"

#: lazarusidestrconsts:lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Не могу прочитать файл %s%s%s!"

#: lazarusidestrconsts:lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Не могу прочитать файл %s%s%s%sОшибка: %s"

#: lazarusidestrconsts:lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Не могу прочитать файл %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletoreadpackagefile
msgid "Unable to read package file %s%s%s."
msgstr "Не могу прочитать файл пакета %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Не могу прочитать файл состояния %s%s%s%sпакета %s.%sОшибка: %s"

#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Не могу стереть старый резервный файл %s%s%s!"

#: lazarusidestrconsts:lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Не могу переименовать двусмысленный файо %s%s%s%sв %s%s%s"

#: lazarusidestrconsts:lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Не могу переименовать файл"

#: lazarusidestrconsts:lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Не могу переименовать файл %s%s%s в %s%s%s!"

#: lazarusidestrconsts:lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Не могу переименовать файл %s%s%s%sв %s%s%s."

#: lazarusidestrconsts:lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Невозможно переименовать форму в исходнике"

#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag
msgid "Unable to rename method. Plz fix the error shown in the message window."
msgstr "Не могу переименовать метод. Исправьте ошибку, см. окно сообщений."

#: lazarusidestrconsts:lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Невозможно переименовать переменную в исходнике."

#: lazarusidestrconsts:lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Не могу запустить инструмент %s%s%s:%s%s"

#: lazarusidestrconsts:lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Не могу сохранить файл %s%s%s"

#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage
msgid "Unable to show method. Plz fix the error shown in the message window."
msgstr "Не могу показать метод. Исправьте ошибку, см. окно сообщений."

#: lazarusidestrconsts:lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Не могу сделать поток %s:T%s."

#: lazarusidestrconsts:lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Не могу скопировать выбранные компоненты в поток"

#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr ""

#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Не могу перевести двоичный компонент потока %s:T%s в текст."

#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Невозможно обновить выражение CreateForm в исходнике проекта"

#: lazarusidestrconsts:lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Не могу записать %s%s%s%s%s."

#: lazarusidestrconsts:lisunabletowritefile
msgid "Unable to write file"
msgstr "Не могу записать файл"

#: lazarusidestrconsts:lisunabletowritefile2
msgid "Unable to write file %s%s%s"
msgstr "Не могу записать файл %s%s%s"

#: lazarusidestrconsts:lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Не могу записать файл %s%s%s%sError: %s"

#: lazarusidestrconsts:lisunabletowritefilename
msgid "Unable to write file %s%s%s."
msgstr "Не могу записать файл %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Не могу записать пакет %s%s%s%sв файл %s%s%s.%sОшибка: %s"

#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Не могу записать файл состояния %s%s%s%sпакета %s.%sОшибка: %s"

#: lazarusidestrconsts:lisunabletowritetofile2
msgid "Unable to write to file %s%s%s"
msgstr "Не могу записать в файл %s%s%s"

#: lazarusidestrconsts:lisunabletowritetofile
msgid "Unable to write to file %s%s%s!"
msgstr "Не могу записать в файл %s%s%s!"

#: lazarusidestrconsts:dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Нестандартная оптимизация"

#: lazarusidestrconsts:lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Раскомментировать"

#: lazarusidestrconsts:liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Снять определение"

#: lazarusidestrconsts:liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Снять определение со всех"

#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Рекурсивно снять определение"

#: lazarusidestrconsts:dlgedunder
msgid "Underline"
msgstr "Подчеркнутый"

#: lazarusidestrconsts:lismenuundo
msgid "Undo"
msgstr "Отменить"

#: lazarusidestrconsts:dlgundoaftersave
msgid "Undo after save"
msgstr "Откат после сохранения"

#: lazarusidestrconsts:dlgundolimit
msgid "Undo limit:"
msgstr "Предел откатов:"

#: lazarusidestrconsts:srkmecblockunindent
msgid "Unindent block"
msgstr "Отменить отделение блока"

#: lazarusidestrconsts:lismenuunindentselection
msgid "Unindent selection"
msgstr "Сдвинуть блок влево"

#: lazarusidestrconsts:lispckedituninstall
msgid "Uninstall"
msgstr "Деинсталлировать"

#: lazarusidestrconsts:lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Деинсталлировать при след. пуске"

#: lazarusidestrconsts:lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Деинсталлировать пакет %s?"

#: lazarusidestrconsts:lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Деинсталлировать пакет?"

#: lazarusidestrconsts:lisuninstallselection
msgid "Uninstall selection"
msgstr "Деинсталлировать выделение"

#: lazarusidestrconsts:lispkgfiletypeunit
msgid "Unit"
msgstr "Модуль"

#: lazarusidestrconsts:lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Модуль %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Модуль %s%s%s был удалён из пакета"

#: lazarusidestrconsts:lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Имя файла модуля:"

#: lazarusidestrconsts:uemshowunitinfo
msgid "Unit Info"
msgstr "Сведения о модуле"

#: lazarusidestrconsts:lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Имя модуля недопустимо"

#: lazarusidestrconsts:lisa2punitname
msgid "Unit Name:"
msgstr "Имя модуля:"

#: lazarusidestrconsts:lisaf2punitname
msgid "Unit Name: "
msgstr "Имя модуля: "

#: lazarusidestrconsts:lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Каталог для генерации модулей"

#: lazarusidestrconsts:lispkgdefsunitpath
msgid "Unit Path"
msgstr "Путь модуля"

#: lazarusidestrconsts:dlgcounitstyle
msgid "Unit Style:"
msgstr "Стиль модулей:"

#: lazarusidestrconsts:dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Зависимости модуля"

#: lazarusidestrconsts:lisa2punitfilename
msgid "Unit file name:"
msgstr "Имя файла модуля:"

#: lazarusidestrconsts:lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Идентификатор модуля существует"

#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Имя модуля уже есть"

#: lazarusidestrconsts:lisunitnotfound
msgid "Unit not found"
msgstr ""

#: lazarusidestrconsts:lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Модуль не найден: %s%s%s"

#: lazarusidestrconsts:dlgunitoutp
msgid "Unit output directory (-FE):"
msgstr "Каталог для генерации модулей (-FE):"

#: lazarusidestrconsts:lisunitlfmfile
msgid "Unit: %s%sLFM file: %s"
msgstr "Модуль: %s%sФайл LFM: %s"

#: lazarusidestrconsts:lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Имя модуля уже есть"

#: lazarusidestrconsts:lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Модуль с таким именем уже в проекте"

#: lazarusidestrconsts:lisunitsnotfound2
msgid "Units not found"
msgstr ""

#: lazarusidestrconsts:lismenuviewunits
msgid "Units..."
msgstr "Модули..."

#: lazarusidestrconsts:srvk_unknown
msgid "Unknown"
msgstr "Неизвестный"

#: lazarusidestrconsts:lisunknownerrorpleasereportthisbug
msgid "Unknown Error, please report this bug"
msgstr "Неизвестная ошибка, сообщите о ней"

#: lazarusidestrconsts:lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Несохранённый пакет"

#: lazarusidestrconsts:dlgupword
msgid "Up"
msgstr "Вверх"

#: lazarusidestrconsts:lisceoupdate
msgid "Update"
msgstr ""

#: lazarusidestrconsts:lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Обновить/перебрать"

#: lazarusidestrconsts:lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Верхний регистр выделения"

#: lazarusidestrconsts:lispckoptsusage
msgid "Usage"
msgstr "Использование"

#: lazarusidestrconsts:dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Использовать строки Ansi"

#: lazarusidestrconsts:lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr ""

#: lazarusidestrconsts:dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Использовать модуль Heaprc"

#: lazarusidestrconsts:lisuseincludefilter
msgid "Use Include Filter"
msgstr ""

#: lazarusidestrconsts:dlgusecustomconfig
msgid "Use addional Compiler Config File"
msgstr "Использовать дополнительный файл настроек компилятора"

#: lazarusidestrconsts:dlgedusedefcolor
msgid "Use default color"
msgstr "Цвет по умолчанию"

#: lazarusidestrconsts:dlgrunousedisplay
msgid "Use display"
msgstr "Использовать дисплей"

#: lazarusidestrconsts:dlguselaunchingapp
msgid "Use launching application"
msgstr "Использовать приложение для запуска"

#: lazarusidestrconsts:dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Использовать стандартный файл настроек (fpc.cfg)"

#: lazarusidestrconsts:dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Подсветка синтаксиса"

#: lazarusidestrconsts:lispkgmanguseunit
msgid "Use unit"
msgstr ""

#: lazarusidestrconsts:rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Взять настройки дисп. окон"

#: lazarusidestrconsts:srkmecuserfirst
msgid "User First"
msgstr ""

#: lazarusidestrconsts:dlgedcustomext
msgid "User defined extension"
msgstr "Пользовательское расширение"

#: lazarusidestrconsts:dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Расширение пользователя (.pp.xxx)"

#: lazarusidestrconsts:dlgrunouseroverrides
msgid "User overrides"
msgstr "Пользовательские замены"

#: lazarusidestrconsts:dlgvaluecolor
msgid "Value"
msgstr "Значение"

#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Значение как путь к файлу"

#: lazarusidestrconsts:liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Значение как текст"

#: lazarusidestrconsts:dlgrunovariable
msgid "Variable"
msgstr "Переменная"

#: lazarusidestrconsts:lisctdefvariablename
msgid "Variable Name"
msgstr "Имя переменной"

#: lazarusidestrconsts:dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Префикс переменной"

#: lazarusidestrconsts:liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Переменная:"

#: lazarusidestrconsts:lisctdefvariable
msgid "Variable: %s"
msgstr "Переменная: %s"

#: lazarusidestrconsts:dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Подробность при компиляции:"

#: lazarusidestrconsts:lisversion
msgid "Version"
msgstr "Версия"

#: lazarusidestrconsts:lisvertical
msgid "Vertical"
msgstr "Вертикально"

#: lazarusidestrconsts:dlggridyhint
msgid "Vertical grid step size"
msgstr "Вертикальный шаг сетки"

#: lazarusidestrconsts:lismenuviewanchoreditor
msgid "View Anchor Editor"
msgstr "Показать редактор привязок"

#: lazarusidestrconsts:uemviewcallstack
msgid "View Call Stack"
msgstr "Показать стек вызовов"

#: lazarusidestrconsts:srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Показать обозреватель кода"

#: lazarusidestrconsts:lishintviewforms
msgid "View Forms"
msgstr "Показать формы"

#: lazarusidestrconsts:lismenuviewjumphistory
msgid "View Jump-History"
msgstr "Просмотр истории переходов"

#: lazarusidestrconsts:srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Показать Инспектор Объектов"

#: lazarusidestrconsts:lispckeditviewpackgesource
msgid "View Package Source"
msgstr "Посмотреть исходник пакета"

#: lazarusidestrconsts:lisviewprojectunits
msgid "View Project Units"
msgstr "Показать модули проекта"

#: lazarusidestrconsts:srkmectogglesearchresults
msgid "View Search Results"
msgstr "Показать результаты поиска"

#: lazarusidestrconsts:lismenuviewsource
msgid "View Source"
msgstr "Просмотр исходника"

#: lazarusidestrconsts:lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr ""

#: lazarusidestrconsts:srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Показать редактор исходников"

#: lazarusidestrconsts:lismenuviewprojecttodos
msgid "View ToDo List"
msgstr "Показать список ToDo"

#: lazarusidestrconsts:lismenuviewunitdependencies
msgid "View Unit Dependencies"
msgstr "Показать зависимости модулей"

#: lazarusidestrconsts:lismenuviewunitinfo
msgid "View Unit Information"
msgstr "Посмотреть сведения о модуле"

#: lazarusidestrconsts:lishintviewunits
msgid "View Units"
msgstr "Показать модули"

#: lazarusidestrconsts:srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Показать редактор привязок"

#: lazarusidestrconsts:srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Просмотр точек останова"

#: lazarusidestrconsts:srkmectogglecallstack
msgid "View call stack"
msgstr "Просмотр стека вызовов"

#: lazarusidestrconsts:srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Просмотр вывода отладчика"

#: lazarusidestrconsts:srkmecviewforms
msgid "View forms"
msgstr "Показать формы"

#: lazarusidestrconsts:srkmectogglelocals
msgid "View local variables"
msgstr "Просмотр локальных переменных"

#: lazarusidestrconsts:srkmcatviewmenu
msgid "View menu commands"
msgstr "Команды меню Просмотр"

#: lazarusidestrconsts:srkmectogglemessages
msgid "View messages"
msgstr "Просмотр сообщений"

#: lazarusidestrconsts:dlgmainviewforms
msgid "View project forms"
msgstr "Показать формы проекта"

#: lazarusidestrconsts:dlgmainviewunits
msgid "View project units"
msgstr "Показать модули проекта"

#: lazarusidestrconsts:srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Показать зависимости модулей"

#: lazarusidestrconsts:srkmecviewunitinfo
msgid "View unit information"
msgstr "Показать сведения о модуле"

#: lazarusidestrconsts:srkmecviewunits
msgid "View units"
msgstr "Показать модули"

#: lazarusidestrconsts:srkmectogglewatches
msgid "View watches"
msgstr "Показать наблюдения"

#: lazarusidestrconsts:lishlpoptsviewers
msgid "Viewers"
msgstr "Просмотрщики"

#: lazarusidestrconsts:lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Виртуальный модуль"

#: lazarusidestrconsts:lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Виртуальный модуль (исходник не в пакете)"

#: lazarusidestrconsts:dlgvisiblegutter
msgid "Visible gutter"
msgstr "Видимое поле (лев)"

#: lazarusidestrconsts:dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Правая видимая граница"

#: lazarusidestrconsts:dlgambigwarn
msgid "Warn on compile"
msgstr "Предупр. при компиляции"

#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Внимание: дополнительный файл настроек компилятора имеет такое же имя, как может называться один из стандартных файлов настроек компилятора FreePascal. Это приведёт к использованию дополнительного файла и пропуску стандартного."

#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Внимание: Файл %s%s%s%sпринадлежит текущему проекту."

#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Предупреждение: найден двусмысленный файл %s%s%s. Исходник: %s%s%s"

#: lazarusidestrconsts:lismenuviewwatches
msgid "Watches"
msgstr "Окно наблюдений"

#: lazarusidestrconsts:dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "При создании новых форм добавить их к автосоздаваемым"

#: lazarusidestrconsts:lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr ""

#: lazarusidestrconsts:lisfindfilewhere
msgid "Where"
msgstr "Где"

#: lazarusidestrconsts:dlgwholewordsonly
msgid "Whole Words Only"
msgstr "Только целые слова"

#: lazarusidestrconsts:lisfindfilewholewordsonly
msgid "Whole words only"
msgstr "Только целые слова"

#: lazarusidestrconsts:dlgwidthpos
msgid "Width:"
msgstr "Ширина:"

#: lazarusidestrconsts:dlgwinpos
msgid "Window Positions"
msgstr "Позиции окна"

#: lazarusidestrconsts:dlgwindows
msgid "Windows"
msgstr "Окна"

#: lazarusidestrconsts:lislazbuildwithstaticpackages
msgid "With Packages"
msgstr "С пакетами"

#: lazarusidestrconsts:liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Слово под курсором в этом редакторе"

#: lazarusidestrconsts:srkmecwordcompletion
msgid "Word completion"
msgstr "Завершение слов"

#: lazarusidestrconsts:dlgwordspolicies
msgid "Words"
msgstr "Слова"

#: lazarusidestrconsts:lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Рабочий каталог:"

#: lazarusidestrconsts:dlgroworkingdirectory
msgid "Working directory"
msgstr "Рабочий каталог"

#: lazarusidestrconsts:liswriteerror
msgid "Write Error"
msgstr "Ошибка записи"

#: lazarusidestrconsts:dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Вывести логотип FPC"

#: lazarusidestrconsts:liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Ошибка записи"

#: lazarusidestrconsts:dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Префикс WRITE"

#: lazarusidestrconsts:lisxmlfiles
msgid "XML files"
msgstr ""

#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Вы не можете перебрать lazarus при отладке или компиляции."

#: lazarusidestrconsts:dlgdoesnotexist
msgid "\" does not exist."
msgstr "\" не существует."

#: lazarusidestrconsts:uefilerotext2
msgid "\" is not writable."
msgstr "\" не для записи."

#: lazarusidestrconsts:srkmecabortbuild
msgid "abort build"
msgstr "прервать сборку"

#: lazarusidestrconsts:srkmecaddbreakpoint
msgid "add break point"
msgstr "добавить точку останова"

#: lazarusidestrconsts:srkmecaddwatch
msgid "add watch"
msgstr "добавить наблюдение"

#: lazarusidestrconsts:srvk_apps
msgid "application key"
msgstr "клавиша приложения"

#: lazarusidestrconsts:lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "автоустановить динамически"

#: lazarusidestrconsts:lisoipautoinstallstatic
msgid "auto install static"
msgstr "автоустановить статически"

#: lazarusidestrconsts:srkmecbuildall
msgid "build all files of program/project"
msgstr "собрать все файлы программы/проекта"

#: lazarusidestrconsts:srkmecbuildfile
msgid "build file"
msgstr "собрать файл"

#: lazarusidestrconsts:srkmecbuild
msgid "build program/project"
msgstr "собрать программу/проект"

#: lazarusidestrconsts:dlglefttopclr
msgid "color for left, top"
msgstr "цвет слева сверху"

#: lazarusidestrconsts:dlgrightbottomclr
msgid "color for right, bottom"
msgstr "цвет справа снизу"

#: lazarusidestrconsts:srkmeccompileroptions
msgid "compiler options"
msgstr "параметры компилятора"

#: lazarusidestrconsts:liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "путь к компилятору"

#: lazarusidestrconsts:srkmecconfigbuildfile
msgid "config build file"
msgstr "файл настроек сборки"

#: lazarusidestrconsts:liscustomoptions
msgid "custom options"
msgstr "опции пользователя"

#: lazarusidestrconsts:liscodefault
msgid "default (%s)"
msgstr "по умолчанию (%s)"

#: lazarusidestrconsts:srkmecevaluate
msgid "evaluate/modify"
msgstr "рассчитать/изменить"

#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr ""

#: lazarusidestrconsts:lisuidinproject
msgid "in Project:"
msgstr "в проекте:"

#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "во всех открытых пакетах и проектах"

#: lazarusidestrconsts:lisfriincurrentunit
msgid "in current unit"
msgstr "в текущем модуле"

#: lazarusidestrconsts:lisfriinmainproject
msgid "in main project"
msgstr "в главном проекте"

#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "в проекте/пакете, содержащем этот модуль"

#: lazarusidestrconsts:lisincludepath
msgid "include path"
msgstr "путь включаемых"

#: lazarusidestrconsts:srkmecinspect
msgid "inspect"
msgstr "проверить"

#: lazarusidestrconsts:lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "установлен динамически"

#: lazarusidestrconsts:lisoipinstalledstatic
msgid "installed static"
msgstr "установлен статически"

#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "неправильное имя Компилятора"

#: lazarusidestrconsts:lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [опции] <имя файла проекта>"

#: lazarusidestrconsts:srvk_lwin
msgid "left windows key"
msgstr "Левая клавиша Windows"

#: lazarusidestrconsts:lislibrarypath
msgid "library path"
msgstr "путь к библиотекам"

#: lazarusidestrconsts:lislinkeroptions
msgid "linker options"
msgstr "параметры линкера"

#: lazarusidestrconsts:dlgcdtlower
msgid "lowercase"
msgstr "нижний регистр"

#: lazarusidestrconsts:lisoipmissing
msgid "missing"
msgstr "отсутствует"

#: lazarusidestrconsts:lisoipmodified
msgid "modified"
msgstr "изменён"

#: lazarusidestrconsts:lisuidno
msgid "no"
msgstr "нет"

#: lazarusidestrconsts:dlgnoautomaticrenaming
msgid "no automatic renaming"
msgstr "без автопереименования"

#: lazarusidestrconsts:lisnoname
msgid "noname"
msgstr "без имени"

#: lazarusidestrconsts:liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Ничего не выбрано"

#: lazarusidestrconsts:lisobjectpath
msgid "object path"
msgstr "путь объекта"

#: lazarusidestrconsts:lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "пакет %s не сохранён"

#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "главный файл-исходник пакета"

#: lazarusidestrconsts:srkmecpause
msgid "pause program"
msgstr "приостановить программу"

#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr ""

#: lazarusidestrconsts:lisoipreadonly
msgid "readonly"
msgstr "только чтение"

#: lazarusidestrconsts:srkmecremovebreakpoint
msgid "remove break point"
msgstr "удалить точку останова"

#: lazarusidestrconsts:srkmecresetdebugger
msgid "reset debugger"
msgstr "сброс отладчика"

#: lazarusidestrconsts:srvk_rwin
msgid "right windows key"
msgstr "правая клавиша Windows"

#: lazarusidestrconsts:srkmecrunfile
msgid "run file"
msgstr "запуск файла"

#: lazarusidestrconsts:srkmecrunparameters
msgid "run parameters"
msgstr "параметры запуска"

#: lazarusidestrconsts:srkmecrun
msgid "run program"
msgstr "запустить программу"

#: lazarusidestrconsts:lissaveallmodified
msgid "save all modified files"
msgstr "Сохранить все измененные файлы"

#: lazarusidestrconsts:lissavecurrenteditorfile
msgid "save current editor file"
msgstr "Сохранить текущий файл редактора"

#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
msgid "search all files in project"
msgstr "поиск во всех файлах проекта"

#: lazarusidestrconsts:lisfindfilesearchallopenfiles
msgid "search all open files"
msgstr "поиск во всех открытых файлах"

#: lazarusidestrconsts:lisfindfilesearchindirectories
msgid "search in directories"
msgstr "поиск в каталогах"

#: lazarusidestrconsts:dlgtimesecondunit
msgid "sec"
msgstr "сек"

#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr ""

#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "установить режим FPC в DELPHI"

#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "установить режим FPC в GPC"

#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "установить режим FPC в TP"

#: lazarusidestrconsts:lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "Включить IOCHECKS"

#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "Включить OVERFLOWCHECKS"

#: lazarusidestrconsts:lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "Включить RANGECHECKS"

#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "статический файл настроек пакета"

#: lazarusidestrconsts:srkmecstopprogram
msgid "stop program"
msgstr "остановить программу"

#: lazarusidestrconsts:listhishelpmessage
msgid "this help message"
msgstr "это справочное сообщение"

#: lazarusidestrconsts:lisunitpath
msgid "unit path"
msgstr "путь модуля"

#: lazarusidestrconsts:srkmecunknown
msgid "unknown editor command"
msgstr "Неизвестная команда редактора"

#: lazarusidestrconsts:lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "использовать модуль HeapTrc"

#: lazarusidestrconsts:lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "использовать LineInfo"

#: lazarusidestrconsts:lisuidyes
msgid "yes"
msgstr "да"