mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-12-05 20:37:19 +01:00
11069 lines
344 KiB
Plaintext
11069 lines
344 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"Mime-Version: 1.0Last-Translator: Valdas Jankūnas <skroblas@erdves.lt>\n"
|
|
"PO-Revision-Date: 2008-04-09 23:57+0300\n"
|
|
"Project-Id-Version: lazaruside\n"
|
|
"Language-Team: Lithuanian\n"
|
|
"X-Generator: KBabel 1.11.4\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Last-Translator: Valdas Jankunas <skroblas@erdves.lt>\n"
|
|
|
|
#: lazarusidestrconsts:srkmcommand1
|
|
msgid " command1 \""
|
|
msgstr " komanda 1 \""
|
|
|
|
#: lazarusidestrconsts:srkmcommand2
|
|
msgid " command2 \""
|
|
msgstr " komanda 2 \""
|
|
|
|
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
|
|
msgid " A token %s%s%s already exists! "
|
|
msgstr "Leksema %s%s%s jau egzistuoja! "
|
|
|
|
#: lazarusidestrconsts:srkmalreadyconnected
|
|
msgid " The key \"%s\" is already connected to \"%s\"."
|
|
msgstr "Klavišas \"%s\" jau yra surištas su \"%s\"."
|
|
|
|
#: lazarusidestrconsts:srkmconflicw
|
|
msgid " conflicts with "
|
|
msgstr " konfliktuoja su "
|
|
|
|
#: lazarusidestrconsts:liscompiling
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (kompiliuojama...)"
|
|
|
|
#: lazarusidestrconsts:lisdebugging
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (derinama...)"
|
|
|
|
#: lazarusidestrconsts:liscovarious
|
|
msgid "%s (various)"
|
|
msgstr "%s (įvairūs)"
|
|
|
|
#: lazarusidestrconsts:lisnewproject
|
|
msgid "%s - (new project)"
|
|
msgstr "%s - (naujas projektas)"
|
|
|
|
#: lazarusidestrconsts:lislazarusversionstring
|
|
msgid "%s beta"
|
|
msgstr "%s beta"
|
|
|
|
#: lazarusidestrconsts:lisuidbytes
|
|
msgid "%s bytes"
|
|
msgstr "%s baitų"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdirectory
|
|
msgid "%s directory"
|
|
msgstr "%s katalogas"
|
|
|
|
#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
|
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr "%s nenurodytas tinkamas LazDoc kelias.%sNeina sukurti FPDoc failo, skirto %s"
|
|
|
|
#: lazarusidestrconsts:lisisalreadypartoftheproject
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s jau yra projekte."
|
|
|
|
#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr "%s yra abstrakti klasė, ji turi %s abstrakčių metodų."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
|
|
msgid "%s project directory"
|
|
msgstr "%s projekto katalogas"
|
|
|
|
#: lazarusidestrconsts:lisunitinpackage
|
|
msgid "%s unit %s in package %s%s"
|
|
msgstr "%s modulis %s pakete %s%s"
|
|
|
|
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "Projekto vardas %s%s%s yra klaidingas.%sNurodykite kitokį vardą (pvz.: projektas1.lpi)"
|
|
|
|
#: lazarusidestrconsts:lissvuoisnotavalididentifier
|
|
msgid "%s%s%s is not a valid identifier."
|
|
msgstr "Identifikatorius %s%s%s klaidingas."
|
|
|
|
#: lazarusidestrconsts:lisa2pisnotavalidunitname
|
|
msgid "%s%s%s is not a valid unit name."
|
|
msgstr "%s%s%s yra klaidingas modulio vardas."
|
|
|
|
#: lazarusidestrconsts:liscoclickokifaresuretodothat
|
|
msgid "%s%sClick OK if you are sure to do that."
|
|
msgstr "%s%sJei esate tikras kad to reikia, spustelkit \"Tinka\"."
|
|
|
|
#: lazarusidestrconsts:lispkgsysfilename
|
|
msgid "%s%sFile Name: %s%s%s"
|
|
msgstr "%s%sFailo vardas: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletochangeclassofto
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr "%s%sNepavyko %s klasę pakeisti į %s"
|
|
|
|
#: lazarusidestrconsts:lispkgsysunitname
|
|
msgid "%s%sUnit Name: %s%s%s"
|
|
msgstr "%s%sModulio vardas: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispckeditpage
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s, lapas: %s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, sukurtas automatiškai"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
|
|
msgid "%s, project specific"
|
|
msgstr "%s, priklauso nuo projekto"
|
|
|
|
#: lazarusidestrconsts:lisuereadonly
|
|
msgid "%s/ReadOnly"
|
|
msgstr "%s/Tik skaitymui"
|
|
|
|
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
|
|
msgid "%sAdding new Dependency for package %s: package %s%s"
|
|
msgstr "%sPaketui %s priskiriamas naujas priklausinys: paketas %s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
|
|
msgid "%sAdding new Dependency for project %s: package %s%s"
|
|
msgstr "%sProjektui %s priskiriamas naujas priklausinys: paketas %s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sAbu paketai yra susiję. Tai reiškia, kad kažkuris iš paketų naudoja kitą, arba juos abu naudoja kažkuris kitas paketas."
|
|
|
|
#: lazarusidestrconsts:lisoipdescriptiondescription
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sAprašymas: %s"
|
|
|
|
#: lazarusidestrconsts:lisa2pexistingfile
|
|
msgid "%sExisting file: %s%s%s"
|
|
msgstr "%sEgzistuojantis failas: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisseeprojectprojectinspector
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr "%sŽiūrėkit \"Projektas -> Projekto inspektorius\""
|
|
|
|
#: lazarusidestrconsts:lispckexplstate
|
|
msgid "%sState: "
|
|
msgstr "%sBūsena: "
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
|
msgstr "%sŠie moduliai bus įtraukti į naudojamųjų modulių sąrašą%s%s:%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "%sThis package is installed, but the lpk file was not found"
|
|
msgstr "%sŠis paketas įdiegtas, tačiau nerastas lpk failas"
|
|
|
|
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
|
|
msgid "%sThis package was automatically created"
|
|
msgstr "%sŠis paketas sukurtas automatiškai"
|
|
|
|
#: lazarusidestrconsts:lisnone
|
|
msgid "%snone"
|
|
msgstr "%snieks"
|
|
|
|
#: lazarusidestrconsts:liswladd
|
|
msgid "&Add"
|
|
msgstr "Pri&dėti"
|
|
|
|
#: lazarusidestrconsts:uemaddbreakpoint
|
|
msgid "&Add Breakpoint"
|
|
msgstr "Padėti st&abdos tašką"
|
|
|
|
#: lazarusidestrconsts:lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr "Ieškoti a&tgal"
|
|
|
|
#: lazarusidestrconsts:dlgcasesensitive
|
|
msgid "&Case Sensitive"
|
|
msgstr "Skirti raidžių &dydį"
|
|
|
|
#: lazarusidestrconsts:lisfindfilecasesensitive
|
|
msgid "&Case sensitive"
|
|
msgstr "Skirti raidžių &dydį"
|
|
|
|
#: lazarusidestrconsts:lisclose
|
|
msgid "&Close"
|
|
msgstr "&Užverti"
|
|
|
|
#: lazarusidestrconsts:uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "&Užverti lapą"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "K&omponentai"
|
|
|
|
#: lazarusidestrconsts:liswldelete
|
|
msgid "&Delete"
|
|
msgstr "&Pašalinti"
|
|
|
|
#: lazarusidestrconsts:lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr "&Pašalinti visus"
|
|
|
|
#: lazarusidestrconsts:lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Taisa"
|
|
|
|
#: lazarusidestrconsts:lisenableall
|
|
msgid "&Enable All"
|
|
msgstr "Įgalinti &visus"
|
|
|
|
#: lazarusidestrconsts:liswlenabled
|
|
msgid "&Enabled"
|
|
msgstr "Į&galintas"
|
|
|
|
#: lazarusidestrconsts:dlgentirescope
|
|
msgid "&Entire Scope"
|
|
msgstr "Ieškoti &visame"
|
|
|
|
#: lazarusidestrconsts:lismenufile
|
|
msgid "&File"
|
|
msgstr "&Failas"
|
|
|
|
#: lazarusidestrconsts:lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr "&Ieškoti..."
|
|
|
|
#: lazarusidestrconsts:uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "Ieškoti kur &paskelbta"
|
|
|
|
#: lazarusidestrconsts:dlgfromcursor
|
|
msgid "&From Cursor"
|
|
msgstr "Nuo žy&meklio"
|
|
|
|
#: lazarusidestrconsts:dlgglobal
|
|
msgid "&Global"
|
|
msgstr "&Globaliai"
|
|
|
|
#: lazarusidestrconsts:uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Rodyti žymę"
|
|
|
|
#: lazarusidestrconsts:lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "Žin&ynas"
|
|
|
|
#: lazarusidestrconsts:lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr "&Keletos eilučių šablonas"
|
|
|
|
#: lazarusidestrconsts:lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Objektai"
|
|
|
|
#: lazarusidestrconsts:lisok
|
|
msgid "&Ok"
|
|
msgstr "&Tinka"
|
|
|
|
#: lazarusidestrconsts:uemopenfileatcursor
|
|
msgid "&Open file at cursor"
|
|
msgstr "Atverti ties žymekliu nurodytą &failą"
|
|
|
|
#: lazarusidestrconsts:lismenupackage
|
|
msgid "&Package"
|
|
msgstr "&Paketas"
|
|
|
|
#: lazarusidestrconsts:lismenuproject
|
|
msgid "&Project"
|
|
msgstr "Pr&ojektas"
|
|
|
|
#: lazarusidestrconsts:dlgpromptonreplace
|
|
msgid "&Prompt On Replace"
|
|
msgstr "Keičiant k&lausti patvirtinimo"
|
|
|
|
#: lazarusidestrconsts:liswlproperties
|
|
msgid "&Properties"
|
|
msgstr "&Savybės"
|
|
|
|
#: lazarusidestrconsts:dlgregularexpressions
|
|
msgid "&Regular Expressions"
|
|
msgstr "&Reguliarusis reiškinys"
|
|
|
|
#: lazarusidestrconsts:lisfindfileregularexpressions
|
|
msgid "&Regular expressions"
|
|
msgstr "&Reguliarusis reiškinys"
|
|
|
|
#: lazarusidestrconsts:rsremove
|
|
msgid "&Remove"
|
|
msgstr "&Pašalinti"
|
|
|
|
#: lazarusidestrconsts:lismenureplace2
|
|
msgid "&Replace ..."
|
|
msgstr "&Pakeisti..."
|
|
|
|
#: lazarusidestrconsts:dlgreplacewith
|
|
msgid "&Replace With"
|
|
msgstr "&Pakeisti šiuo"
|
|
|
|
#: lazarusidestrconsts:lismenurun
|
|
msgid "&Run"
|
|
msgstr "&Startuoti"
|
|
|
|
#: lazarusidestrconsts:uemruntocursor
|
|
msgid "&Run to Cursor"
|
|
msgstr "S&tartuoti iki žymeklio"
|
|
|
|
#: lazarusidestrconsts:lismenusearch
|
|
msgid "&Search"
|
|
msgstr "Pa&ieška"
|
|
|
|
#: lazarusidestrconsts:dlgselectedtext
|
|
msgid "&Selected Text"
|
|
msgstr "Paž&ymėtame tekste"
|
|
|
|
#: lazarusidestrconsts:uemsetbookmark
|
|
msgid "&Set Bookmark"
|
|
msgstr "Pa&dėti žymę"
|
|
|
|
#: lazarusidestrconsts:lissourcebreakpoint
|
|
msgid "&Source breakpoint"
|
|
msgstr "&Stabdos taškas pirminiame kode"
|
|
|
|
#: lazarusidestrconsts:dlgtexttofing
|
|
msgid "&Text to Find"
|
|
msgstr "Ieškomasis t&ekstas"
|
|
|
|
#: lazarusidestrconsts:lismenutools
|
|
msgid "&Tools"
|
|
msgstr "Įra&nkiai"
|
|
|
|
#: lazarusidestrconsts:lismenuview
|
|
msgid "&View"
|
|
msgstr "&Rodymas"
|
|
|
|
#: lazarusidestrconsts:lismenuviewsource
|
|
msgid "&View Source"
|
|
msgstr "&Rodyti pirminį kodą"
|
|
|
|
#: lazarusidestrconsts:dlgwholewordsonly
|
|
msgid "&Whole Words Only"
|
|
msgstr "Tik vie&ntisi žodžiai"
|
|
|
|
#: lazarusidestrconsts:lisfindfilewholewordsonly
|
|
msgid "&Whole words only"
|
|
msgstr "Tik vie&ntisi žodžiai"
|
|
|
|
#: lazarusidestrconsts:lismenuwindow
|
|
msgid "&Window"
|
|
msgstr "&Langai"
|
|
|
|
#: lazarusidestrconsts:liscefilter
|
|
msgid "(Filter)"
|
|
msgstr "(Filtras)"
|
|
|
|
#: lazarusidestrconsts:dlgbaknosubdirectory
|
|
msgid "(no subdirectory)"
|
|
msgstr "(pakatalogio nėra)"
|
|
|
|
#: lazarusidestrconsts:listmunknownmacro
|
|
msgid "(unknown macro: %s)"
|
|
msgstr "(nežinoma makrokomanda: %s)"
|
|
|
|
#: lazarusidestrconsts:lisplistall
|
|
msgid "<All>"
|
|
msgstr "<Visi>"
|
|
|
|
#: lazarusidestrconsts:liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<JOKS>"
|
|
|
|
#: lazarusidestrconsts:lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<Joks>"
|
|
|
|
#: lazarusidestrconsts:lisa2pchooseanexistingfile
|
|
msgid "<choose an existing file>"
|
|
msgstr "<nurodykite egzistuojantį failą>"
|
|
|
|
#: lazarusidestrconsts:lismodifiedlgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr "<aprašymas>%sCopyright (C) <metai> <autoriaus vardas> <kontaktai>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts:lislgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr "<aprašymas>%sCopyright (C) <metai> <autoriaus vardas> <kontaktai>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts:lisgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr "<aprašymas>%sCopyright (C) <metai> <autoriaus vardas> <kontaktai>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
|
|
#: lazarusidestrconsts:lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<kintamasis nepažymėtas>"
|
|
|
|
#: lazarusidestrconsts:lisoff
|
|
msgid "? (Off)"
|
|
msgstr "? (Pasyvus)"
|
|
|
|
#: lazarusidestrconsts:lison
|
|
msgid "? (On)"
|
|
msgstr "? (Aktyvus)"
|
|
|
|
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
|
msgstr "%s negali turėti TControl klasių.%sĮ jį galima dėti tik nevizualines komponentes."
|
|
|
|
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
|
|
msgid "A file %s%s%s already exists.%sReplace it?"
|
|
msgstr "Failas %s%s%s jau egzistuoja.%sPerrašyti?"
|
|
|
|
#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
|
|
msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgstr "Paskalio modulio failo prievardis turi būti .pp arba .pas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
|
|
msgid "A required packages was not found. See package graph."
|
|
msgstr "Nerasti reikiami paketai. Žvilgterėkit į paketų grafą."
|
|
|
|
#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
|
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
|
msgstr "Įprastas Paskalio programos failas.%sŠitai galite naudoti greitam bei grubiam testui.%sGeriau kurkite naują projektą."
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Įrankiui mažų mažiausia reikia pavadinimo ir failo vardo."
|
|
|
|
#: lazarusidestrconsts:lispdabort
|
|
msgid "Abort"
|
|
msgstr "Nutraukti"
|
|
|
|
#: lazarusidestrconsts:lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Nutraukti darymą"
|
|
|
|
#: lazarusidestrconsts:lisabortall
|
|
msgid "Abort all"
|
|
msgstr "Nutraukti viską"
|
|
|
|
#: lazarusidestrconsts:lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr "Nutraukti visą įkėlimo procesą"
|
|
|
|
#: lazarusidestrconsts:liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr "Nutraukti darymą"
|
|
|
|
#: lazarusidestrconsts:lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Nutraukti projekto įkrovą"
|
|
|
|
#: lazarusidestrconsts:lisabortwholeloading
|
|
msgid "Abort whole loading"
|
|
msgstr "Nutraukti įkėlimą"
|
|
|
|
#: lazarusidestrconsts:lismenutemplateabout
|
|
msgid "About"
|
|
msgstr "Apie"
|
|
|
|
#: lazarusidestrconsts:lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "Apie Lazarus"
|
|
|
|
#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract methods - not yet overridden"
|
|
msgstr "Abstraktūs metodai - dar nėra įgyvendinti"
|
|
|
|
#: lazarusidestrconsts:lissamabstractmethodsof
|
|
msgid "Abstract methods of %s"
|
|
msgstr "%s abstraktūs metodai"
|
|
|
|
#: lazarusidestrconsts:srvk_accept
|
|
msgid "Accept"
|
|
msgstr "Accept"
|
|
|
|
#: lazarusidestrconsts:lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr "Padėkos"
|
|
|
|
#: lazarusidestrconsts:lislazbuildaboaction
|
|
msgid "Action"
|
|
msgstr "Veiksmas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsaction
|
|
msgid "Action: %s"
|
|
msgstr "Veiksmas: %s"
|
|
|
|
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr "Teksto paieškai ir pakeitimui galima naudoti reguliariojo reiškinio sintaksę (labai panašiai kaip ir Perl)"
|
|
|
|
#: lazarusidestrconsts:liscodetempladd
|
|
msgid "Add"
|
|
msgstr "Pridėti"
|
|
|
|
#: lazarusidestrconsts:lisaddtoproject
|
|
msgid "Add %s to project?"
|
|
msgstr "Įdėti %s į projektą?"
|
|
|
|
#: lazarusidestrconsts:uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "&Stebėti esantį ties žymekliu"
|
|
|
|
#: lazarusidestrconsts:lisa2paddfile
|
|
msgid "Add File"
|
|
msgstr "Pridėti failą"
|
|
|
|
#: lazarusidestrconsts:lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Pridėti failus"
|
|
|
|
#: lazarusidestrconsts:rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr "Pridėti atvirkščiai"
|
|
|
|
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
|
|
msgid "Add LFM, LRS files, if they exist"
|
|
msgstr "Pridėti esamus LFM bei LRS failus"
|
|
|
|
#: lazarusidestrconsts:lisa2paddunit
|
|
msgid "Add Unit"
|
|
msgstr "Pridėti modulį"
|
|
|
|
#: lazarusidestrconsts:lismenuaddcurunittopkg
|
|
msgid "Add active unit to a package"
|
|
msgstr "Įdėti aktyvųjį modulį į paketą"
|
|
|
|
#: lazarusidestrconsts:liskmaddactiveunittoproject
|
|
msgid "Add active unit to project"
|
|
msgstr "Įdėti į projektą aktyvųjį modulį"
|
|
|
|
#: lazarusidestrconsts:lispckeditaddanitem
|
|
msgid "Add an item"
|
|
msgstr "Pridėti elementą"
|
|
|
|
#: lazarusidestrconsts:dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr "Padėti priskyrimo operatorių :="
|
|
|
|
#: lazarusidestrconsts:liskmaddbreakpoint
|
|
msgid "Add break point"
|
|
msgstr "Padėti stabdos tašką"
|
|
|
|
#: lazarusidestrconsts:lismenuaddbreakpoint
|
|
msgid "Add breakpoint"
|
|
msgstr "Padėti stabdos tašką"
|
|
|
|
#: lazarusidestrconsts:liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Pridėti kodo šabloną"
|
|
|
|
#: lazarusidestrconsts:lismenuaddtoproject
|
|
msgid "Add editor file to Project"
|
|
msgstr "Redaktoriaus failą įdėti į projektą"
|
|
|
|
#: lazarusidestrconsts:lisprojaddeditorfile
|
|
msgid "Add editor files"
|
|
msgstr "Pridėti redaktoriaus failus"
|
|
|
|
#: lazarusidestrconsts:lisaf2paddfiletoapackage
|
|
msgid "Add file to a package"
|
|
msgstr "Įdėti į paketą"
|
|
|
|
#: lazarusidestrconsts:lisprojaddaddfiletoproject
|
|
msgid "Add file to project:"
|
|
msgstr "Įdėti failą į projektą:"
|
|
|
|
#: lazarusidestrconsts:lisprojaddfiles
|
|
msgid "Add files"
|
|
msgstr "Pridėti failus"
|
|
|
|
#: lazarusidestrconsts:lisa2paddfilestopackage
|
|
msgid "Add files to package"
|
|
msgstr "Įdėti failus į paketą"
|
|
|
|
#: lazarusidestrconsts:srkmecaddjumppoint
|
|
msgid "Add jump point"
|
|
msgstr "Pridėti peršokimo tašką"
|
|
|
|
#: lazarusidestrconsts:lismenuaddjumppointtohistory
|
|
msgid "Add jump point to history"
|
|
msgstr "Peršokimo tašką įdėti istorijon"
|
|
|
|
#: lazarusidestrconsts:liscodehelpaddlinkbutton
|
|
msgid "Add link"
|
|
msgstr "Pridėti nuorodą"
|
|
|
|
#: lazarusidestrconsts:lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr "Pridėti nuorodą į paveldą"
|
|
|
|
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "Įdėti parinktis į priklausomus paketus bei projektus"
|
|
|
|
#: lazarusidestrconsts:liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Pridėti kelią"
|
|
|
|
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Įdėti kelius į priklausomus paketus/projektus"
|
|
|
|
#: lazarusidestrconsts:dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr "Padėti kabliataškį"
|
|
|
|
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
|
|
msgid "Add to favourite properties"
|
|
msgstr "Pridėti prie mėgstamiausiųjų savybių"
|
|
|
|
#: lazarusidestrconsts:lisa2paddtopackage
|
|
msgid "Add to package"
|
|
msgstr "Įdėti į paketą"
|
|
|
|
#: lazarusidestrconsts:lisprojaddtoproject
|
|
msgid "Add to project"
|
|
msgstr "Įdėti į projektą"
|
|
|
|
#: lazarusidestrconsts:lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr "Įtraukti į modulių paieškos kelią?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
|
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
|
msgstr "Pridėti modulį prie paketo naudojamų modulių. Pasyvinkite tik tiems moduliams, kurių jokiu būdu nereikia kompiliuoti."
|
|
|
|
#: lazarusidestrconsts:liskmaddwatch
|
|
msgid "Add watch"
|
|
msgstr "Pridėti stebimąjį"
|
|
|
|
#: lazarusidestrconsts:lismenuaddwatch
|
|
msgid "Add watch ..."
|
|
msgstr "Pridėti stebimąjį..."
|
|
|
|
#: lazarusidestrconsts:dlgedadd
|
|
msgid "Add..."
|
|
msgstr "Pridėti..."
|
|
|
|
#: lazarusidestrconsts:dlgadditionalsrcpath
|
|
msgid "Additional Source search path for all projects (.pp;.pas)"
|
|
msgstr "Papildomi visų projektų keliai iki pirminio kodo"
|
|
|
|
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
|
|
msgid "Additional compiler options inherited from packages"
|
|
msgstr "Papildomi iš paketų paveldėtos kompiliatoriaus parinktys"
|
|
|
|
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr "Ieškoti ir kituose failuose (pvz.: /path/*.pas;/path2/*.pp)"
|
|
|
|
#: lazarusidestrconsts:rsadditionalinfo
|
|
msgid "Additional info"
|
|
msgstr "Papildoma informacija"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Papildomi paieškos keliai"
|
|
|
|
#: lazarusidestrconsts:dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Turi matytis ir komentaras"
|
|
|
|
#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
|
|
msgid "Advanced Build Options"
|
|
msgstr "Sudėtingesnės darymo parinktys"
|
|
|
|
#: lazarusidestrconsts:rslanguageafrikaans
|
|
msgid "Afrikaans"
|
|
msgstr "Afrikiečių"
|
|
|
|
#: lazarusidestrconsts:fdmalignword
|
|
msgid "Align"
|
|
msgstr "Lygiuotė"
|
|
|
|
#: lazarusidestrconsts:lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Lygiuotė"
|
|
|
|
#: lazarusidestrconsts:lisemdall
|
|
msgid "All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisallfiles
|
|
msgid "All Files"
|
|
msgstr "Visi failai"
|
|
|
|
#: lazarusidestrconsts:lisallblockslooksok
|
|
msgid "All blocks looks ok."
|
|
msgstr "Visi blokai geri."
|
|
|
|
#: lazarusidestrconsts:dlgallfiles
|
|
msgid "All files"
|
|
msgstr "Visi failai"
|
|
|
|
#: lazarusidestrconsts:lisedtdefallpackages
|
|
msgid "All packages"
|
|
msgstr "Visi paketai"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsallprojects
|
|
msgid "All projects"
|
|
msgstr "Visi projektai"
|
|
|
|
#: lazarusidestrconsts:lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr "Visi testai sėkmingai baigti."
|
|
|
|
#: lazarusidestrconsts:lisallowfunctio
|
|
msgid "Allow Function Calls"
|
|
msgstr "Leisti kreiptis į funkciją"
|
|
|
|
#: lazarusidestrconsts:dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "Galimi LABEL ir GOTO"
|
|
|
|
#: lazarusidestrconsts:lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr "Ar galima keletos eilučių paieška"
|
|
|
|
#: lazarusidestrconsts:dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "Pagal abėcėlę"
|
|
|
|
#: lazarusidestrconsts:srkm_alt
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts:dlgaltsetclmode
|
|
msgid "Alt-Key sets column mode"
|
|
msgstr "Nuspaudus Alt klavišą - žymimi stulpeliai"
|
|
|
|
#: lazarusidestrconsts:srkmalternkey
|
|
msgid "Alternative key (or 2 keys combination)"
|
|
msgstr "Alternatyvusis klavišas (arba dviejų kombinacija)"
|
|
|
|
#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
|
|
msgid "Always Build before Run"
|
|
msgstr "Prieš startuojant visada daryti"
|
|
|
|
#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Visada daryti (net jei nėra pakeitimų)"
|
|
|
|
#: lazarusidestrconsts:dlgalwaysvisiblecaret
|
|
msgid "Always visible caret"
|
|
msgstr "Žymeklis matomas nuolat"
|
|
|
|
#: lazarusidestrconsts:lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Neaiškus protėvio tipas"
|
|
|
|
#: lazarusidestrconsts:lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Neaiškus klasės vardas"
|
|
|
|
#: lazarusidestrconsts:lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Neaiškus modulio vardas"
|
|
|
|
#: lazarusidestrconsts:lisambiguousunitfound
|
|
msgid "Ambiguous Unit found"
|
|
msgstr "Rastas neaiškus modulis"
|
|
|
|
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr "Neaiškus papildomas kompiliatoriaus nustatymų failas"
|
|
|
|
#: lazarusidestrconsts:lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr "Neaiškus kompiliatorius"
|
|
|
|
#: lazarusidestrconsts:dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Esant neaiškiam failui:"
|
|
|
|
#: lazarusidestrconsts:lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "Rastas neaiškus failas"
|
|
|
|
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
|
msgstr "Rastas neaiškus failas: %s%s%s%sŠis failas gali būti supainiotas su %s%s%s%s%sIštrinti neaiškųjį failą?"
|
|
|
|
#: lazarusidestrconsts:lisambiguousfilesfound
|
|
msgid "Ambiguous files found"
|
|
msgstr "Rastas neaiškus failas"
|
|
|
|
#: lazarusidestrconsts:lisambiguousunitfound2
|
|
msgid "Ambiguous unit found"
|
|
msgstr "Rastas neaiškus modulis"
|
|
|
|
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Rasti neaiškūs moduliai"
|
|
|
|
#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
|
|
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
|
msgstr "Paskutinio starto metu įkeliant projektą %s įvyko klaida!%s%sVėl įkelti šį projektą?"
|
|
|
|
#: lazarusidestrconsts:lisa2pancestortype
|
|
msgid "Ancestor Type"
|
|
msgstr "Protėvio tipas"
|
|
|
|
#: lazarusidestrconsts:lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr "Prieraišų redaktorius - nėra pažymėtų komponenčių"
|
|
|
|
#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
|
|
msgid "Anchor to bottom side of sibling, keep border space"
|
|
msgstr "Kraštinės pločio atstumu pririšti prie kaimyno apatiniojo krašto"
|
|
|
|
#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
|
|
msgid "Anchor to left side of sibling, keep border space"
|
|
msgstr "Kraštinės pločio atstumu pririšti prie kaimyno kairiojo krašto"
|
|
|
|
#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
|
|
msgid "Anchor to right side of sibling, keep border space"
|
|
msgstr "Kraštinės pločio atstumu pririšti prie kaimyno dešiniojo krašto"
|
|
|
|
#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
|
|
msgid "Anchor to top side of sibling, keep border space"
|
|
msgstr "Kraštinės pločio atstumu pririšti prie kaimyno viršutiniojo krašto"
|
|
|
|
#: lazarusidestrconsts:lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr "Pažymėtos komponentės prieraišos"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "Tiesiog pridėti"
|
|
|
|
#: lazarusidestrconsts:dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Taikomoji programa"
|
|
|
|
#: lazarusidestrconsts:dlgapplicationsettings
|
|
msgid "Application Settings"
|
|
msgstr "Programos nuostatos"
|
|
|
|
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
|
|
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
|
msgstr "Taikomoji programa%sVizualinė LCL/FreePascal programa. Programos failu automatiškai rūpinsis Lazarus."
|
|
|
|
#: lazarusidestrconsts:dlgbutapply
|
|
msgid "Apply"
|
|
msgstr "Pritaikyti"
|
|
|
|
#: lazarusidestrconsts:lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Pritaikyti keitimus"
|
|
|
|
#: lazarusidestrconsts:rslanguagearabic
|
|
msgid "Arabic"
|
|
msgstr "Arabų"
|
|
|
|
#: lazarusidestrconsts:dlgcoasis
|
|
msgid "As-Is"
|
|
msgstr "Kaip yra"
|
|
|
|
#: lazarusidestrconsts:lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Didėjanti"
|
|
|
|
#: lazarusidestrconsts:dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Klausti"
|
|
|
|
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr "Klausti patvirtinimo kiekvienąkart prieš pakeičiant rastą tekstą"
|
|
|
|
#: lazarusidestrconsts:dlgcoasmstyle
|
|
msgid "Assembler style:"
|
|
msgstr "Asemblerio stilius:"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr "Simbolis eta"
|
|
|
|
#: lazarusidestrconsts:lispckoptsauthor
|
|
msgid "Author:"
|
|
msgstr "Autorius:"
|
|
|
|
#: lazarusidestrconsts:liscodetemplautocompleteon
|
|
msgid "Auto complete on ..."
|
|
msgstr "Automatiškai užbaigti kai..."
|
|
|
|
#: lazarusidestrconsts:dlgautoform
|
|
msgid "Auto create form when opening unit"
|
|
msgstr "Atveriant modulį formą sukurti automatiškai"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
|
|
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Negalima keisti automatiškai sukurtų mazgų,%stačiau jie gali turėti neautomatiškai sukurtų mazgų-sūnų."
|
|
|
|
#: lazarusidestrconsts:dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Failą ištrinti automatiškai"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
|
|
msgid "Auto generated nodes can not be edited."
|
|
msgstr "Negalima keisti automatiškai sukurtų mazgų."
|
|
|
|
#: lazarusidestrconsts:dlgautoident
|
|
msgid "Auto indent"
|
|
msgstr "Automatinė įtrauka"
|
|
|
|
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Daryti automatiškai kai daromi visi"
|
|
|
|
#: lazarusidestrconsts:dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Failą automatiškai pervardyti mažosiomis raidėmis"
|
|
|
|
#: lazarusidestrconsts:dlgautosave
|
|
msgid "Auto save"
|
|
msgstr "Automatinis išsaugojimas"
|
|
|
|
#: lazarusidestrconsts:dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Automatiškai kuriamos formos:"
|
|
|
|
#: lazarusidestrconsts:lispckexplautocreated
|
|
msgid "AutoCreated"
|
|
msgstr "sukurtas automatiškai"
|
|
|
|
#: lazarusidestrconsts:rslanguageautomatic
|
|
msgid "Automatic (or english)"
|
|
msgstr "Automatiškai (arba anglų)"
|
|
|
|
#: lazarusidestrconsts:lisautomaticfeatures
|
|
msgid "Automatic features"
|
|
msgstr "Automatinės ypatybės"
|
|
|
|
#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr "Automatiškai didinti darymo numerį"
|
|
|
|
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
|
|
msgid "Automatically increment version on build"
|
|
msgstr "Padarius, automatiškai didinti versijos numerį"
|
|
|
|
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Automatiškai įdiegti paketai"
|
|
|
|
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Automatiškai daryti kai reikia"
|
|
|
|
#: lazarusidestrconsts:dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Esamos formos:"
|
|
|
|
#: lazarusidestrconsts:lisavailablepackages
|
|
msgid "Available packages"
|
|
msgstr "Galimi paketai"
|
|
|
|
#: lazarusidestrconsts:dlgedback
|
|
msgid "Back"
|
|
msgstr "Atgal"
|
|
|
|
#: lazarusidestrconsts:fdmorderbackone
|
|
msgid "Back one"
|
|
msgstr "Vienu atgal"
|
|
|
|
#: lazarusidestrconsts:dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Fonas"
|
|
|
|
#: lazarusidestrconsts:srvk_back
|
|
msgid "Backspace"
|
|
msgstr "Backspace"
|
|
|
|
#: lazarusidestrconsts:dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Atsarginė kopija"
|
|
|
|
#: lazarusidestrconsts:lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Nepavyko padaryti failo atsarginę kopiją"
|
|
|
|
#: lazarusidestrconsts:dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Po metodų"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypebinary
|
|
msgid "Binary"
|
|
msgstr "Dvejetainis"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Blokas"
|
|
|
|
#: lazarusidestrconsts:dlgblockindent
|
|
msgid "Block indent"
|
|
msgstr "Blokų įtrauka"
|
|
|
|
#: lazarusidestrconsts:dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Pusjuodis"
|
|
|
|
#: lazarusidestrconsts:uembookmarkn
|
|
msgid "Bookmark"
|
|
msgstr "Žymė"
|
|
|
|
#: lazarusidestrconsts:lisborderspace
|
|
msgid "BorderSpace"
|
|
msgstr "Kraštinės plotis"
|
|
|
|
#: lazarusidestrconsts:lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr ""
|
|
"Pagrindinis kraštinės plotis apie komponentę.\n"
|
|
"Ši vertės bus pridedama prie kitų kraštinių pločių."
|
|
|
|
#: lazarusidestrconsts:lisbottom
|
|
msgid "Bottom"
|
|
msgstr "Apačion"
|
|
|
|
#: lazarusidestrconsts:lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Apačios prieraiša"
|
|
|
|
#: lazarusidestrconsts:lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr ""
|
|
"Apatinės kraštinės plotis.\n"
|
|
"Ši vertė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą apatinės kraštinės plotį."
|
|
|
|
#: lazarusidestrconsts:lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr "Tolygiai rikiuoti pagal apatinius kraštus"
|
|
|
|
#: lazarusidestrconsts:lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr "Sutapdinti apatinius kraštus"
|
|
|
|
#: lazarusidestrconsts:dlgbrachighlight
|
|
msgid "Bracket highlighting"
|
|
msgstr "Paryškinti porinius skliaustus"
|
|
|
|
#: lazarusidestrconsts:lisbreak
|
|
msgid "Break"
|
|
msgstr "Stabdyti"
|
|
|
|
#: lazarusidestrconsts:lismenubeaklinesinselection
|
|
msgid "Break Lines in selection"
|
|
msgstr "Laužyti eilutes pažymėtoje srityje"
|
|
|
|
#: lazarusidestrconsts:srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Laužti eilutę bei perkelti žymeklį"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Laužti eilutę, neperkeliant žymeklio"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
|
|
msgid "Break on Lazarus Exceptions"
|
|
msgstr "Stabdyti esant Lazarus išimtinei situacijai"
|
|
|
|
#: lazarusidestrconsts:lismenuviewbreakpoints
|
|
msgid "BreakPoints"
|
|
msgstr "Stabdos taškai"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Stabdos taškas"
|
|
|
|
#: lazarusidestrconsts:lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Sugadintos priklausomybės"
|
|
|
|
#: lazarusidestrconsts:lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Sugadinta priklausomybė"
|
|
|
|
#: lazarusidestrconsts:lispatheditbrowse
|
|
msgid "Browse"
|
|
msgstr "Naršyti"
|
|
|
|
#: lazarusidestrconsts:lisbrowseforcompiler
|
|
msgid "Browse for Compiler (%s)"
|
|
msgstr "Nurodyti kompiliatorių (%s)"
|
|
|
|
#: lazarusidestrconsts:lismenubuild
|
|
msgid "Build"
|
|
msgstr "Daryti"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbobuildall
|
|
msgid "Build All"
|
|
msgstr "Daryti viską"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildcodetools
|
|
msgid "Build CodeTools"
|
|
msgstr "Daryti CodeTools"
|
|
|
|
#: lazarusidestrconsts:lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr "Darymo komanda"
|
|
|
|
#: lazarusidestrconsts:lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Daryti failą"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildide
|
|
msgid "Build IDE"
|
|
msgstr "Daryti IKA"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
|
|
msgid "Build IDE with Packages"
|
|
msgstr "Daryti IKA kartu su paketais"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
|
|
msgid "Build IDE without Packages"
|
|
msgstr "Daryti IKA be paketų"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildjitform
|
|
msgid "Build JITForm"
|
|
msgstr "Daryti JITForm"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbobuildlcl
|
|
msgid "Build LCL"
|
|
msgstr "Daryti LCL"
|
|
|
|
#: lazarusidestrconsts:lismenubuildlazarus
|
|
msgid "Build Lazarus"
|
|
msgstr "Daryti Lazarus"
|
|
|
|
#: lazarusidestrconsts:lisbuildnumber
|
|
msgid "Build Number"
|
|
msgstr "Darymo numeris"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildoptions
|
|
msgid "Build Options"
|
|
msgstr "Darymo parinktys"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildsynedit
|
|
msgid "Build SynEdit"
|
|
msgstr "Daryti SynEdit"
|
|
|
|
#: lazarusidestrconsts:lismenubuildall
|
|
msgid "Build all"
|
|
msgstr "Daryti visus"
|
|
|
|
#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
|
|
msgid "Build all files of project/program"
|
|
msgstr "Daryti visus projekto/programos failus"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
|
|
msgid "Build components (SynEdit, CodeTools)"
|
|
msgstr "Daryti komponentus (SynEdit, CodeTools)"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildexamples
|
|
msgid "Build examples"
|
|
msgstr "Daryti pavyzdžius"
|
|
|
|
#: lazarusidestrconsts:srkmecbuildlazarus
|
|
msgid "Build lazarus"
|
|
msgstr "Daryti Lazarus"
|
|
|
|
#: lazarusidestrconsts:lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Daryti naująjį projektą"
|
|
|
|
#: lazarusidestrconsts:liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr "Daryti projektą/programą"
|
|
|
|
#: lazarusidestrconsts:rsbuild
|
|
msgid "Build:"
|
|
msgstr "Darymas:"
|
|
|
|
#: lazarusidestrconsts:dlgcmacro
|
|
msgid "C Style Macros (global)"
|
|
msgstr "C stiliaus makrokomandos (globaliai)"
|
|
|
|
#: lazarusidestrconsts:dlgcocops
|
|
msgid "C Style Operators (*=, +=, /= and -=)"
|
|
msgstr "C stiliaus operatoriai (*=, +=, /= bei -=)"
|
|
|
|
#: lazarusidestrconsts:dlgcppinline
|
|
msgid "C++ Styled INLINE"
|
|
msgstr "C stiliaus INLINE"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertcvskeyword
|
|
msgid "CVS keyword"
|
|
msgstr "CVS raktažodis"
|
|
|
|
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "Iškviesti pažymėto modulio %sRegister%s procedūrą"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcallstack
|
|
msgid "Call Stack"
|
|
msgstr "Kreipčių dėklas"
|
|
|
|
#: lazarusidestrconsts:liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Iššaukti kai:"
|
|
|
|
#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
|
|
msgid "Calling %s to create Makefile from %s failed."
|
|
msgstr "Besikreipiant į %s, kad pagal %s būtų sukurtas Makefile, įvyko klaida."
|
|
|
|
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
|
|
msgid "Can not copy top level component."
|
|
msgstr "Aukščiausiame lygyje esančių komponenčių kopijuoti negalima."
|
|
|
|
#: lazarusidestrconsts:liscannotcreatefile
|
|
msgid "Can not create file %s%s%s"
|
|
msgstr "Nepavyksta sukurti failą %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
|
|
msgid "Can not register components without unit"
|
|
msgstr "Negalima registruoti komponenčių be modulio"
|
|
|
|
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr "Galima keisti tik TComponen'ų klasę."
|
|
|
|
#: lazarusidestrconsts:dlgcancel
|
|
msgid "Cancel"
|
|
msgstr "Atsisakyti"
|
|
|
|
#: lazarusidestrconsts:liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr "Neįkelti šio komponento"
|
|
|
|
#: lazarusidestrconsts:liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Atsisakyti modulio įkėlimo"
|
|
|
|
#: lazarusidestrconsts:liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr "Atsisakyti pervardyjimo"
|
|
|
|
#: lazarusidestrconsts:lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Nepavyko rasti talkininkų sąrašo."
|
|
|
|
#: lazarusidestrconsts:liscannotfindlazarusstarter
|
|
msgid "Cannot find lazarus starter:%s%s"
|
|
msgstr "Nepavyko rasti Lazarus startuotoją:%s%s"
|
|
|
|
#: lazarusidestrconsts:srvk_capital
|
|
msgid "Capital"
|
|
msgstr "Caps Lock"
|
|
|
|
#: lazarusidestrconsts:dlgcaretskipsselection
|
|
msgid "Caret skips selection"
|
|
msgstr "Nuo žymėjimo atitrūkstantis žymeklis"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Skirti didžiąsias ir mažąsias raides"
|
|
|
|
#: lazarusidestrconsts:rslanguagecatalan
|
|
msgid "Catalan"
|
|
msgstr "Katalanų"
|
|
|
|
#: lazarusidestrconsts:liscecategories
|
|
msgid "Categories"
|
|
msgstr "Kategorijos"
|
|
|
|
#: lazarusidestrconsts:listtodolcategory
|
|
msgid "Category"
|
|
msgstr "Kategorija"
|
|
|
|
#: lazarusidestrconsts:dlgcentercursorline
|
|
msgid "Center Cursor Line"
|
|
msgstr "Žymeklis ekrano centre"
|
|
|
|
#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
|
|
msgid "Center control horizontally relative to the given sibling"
|
|
msgstr "Komponentę centruoti horizontaliai pagal nurodytą kaimyną"
|
|
|
|
#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
|
|
msgid "Center control vertically relative to the given sibling"
|
|
msgstr "Komponentę centruoti vertikaliai pagal nurodytą kaimyną"
|
|
|
|
#: lazarusidestrconsts:liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Centruoti lange"
|
|
|
|
#: lazarusidestrconsts:liscenters
|
|
msgid "Centers"
|
|
msgstr "Sutapdinti centrus"
|
|
|
|
#: lazarusidestrconsts:liscodetemplchange
|
|
msgid "Change"
|
|
msgstr "Pakeisti"
|
|
|
|
#: lazarusidestrconsts:lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Pakeisti klasę"
|
|
|
|
#: lazarusidestrconsts:lisccdchangeclassof
|
|
msgid "Change Class of %s"
|
|
msgstr "Pakeisti %s klasę"
|
|
|
|
#: lazarusidestrconsts:lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr "Keisti šriftą"
|
|
|
|
#: lazarusidestrconsts:lischangeparent
|
|
msgid "Change parent ..."
|
|
msgstr "Pakeisti tėvą..."
|
|
|
|
#: lazarusidestrconsts:lismenuinsertchangelogentry
|
|
msgid "ChangeLog entry"
|
|
msgstr "Pakeitimų žurnalo įrašas"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffchangedfiles
|
|
msgid "Changed files:"
|
|
msgstr "Pakeisti failai:"
|
|
|
|
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Keičiant paketo vardą ar versiją bus sugadintos priklausomybės. Keisti šias priklausomybes kaip priklauso?%sPaspaudus \"Taip\" bus pakeistos visos pateiktos priklausomybės.%sPaspaudus \"Ignoruoti\" priklausomybės bus sugadintos."
|
|
|
|
#: lazarusidestrconsts:srkmecchar
|
|
msgid "Char"
|
|
msgstr "Simbolis"
|
|
|
|
#: lazarusidestrconsts:lischaracter
|
|
msgid "Character"
|
|
msgstr "Simbolis"
|
|
|
|
#: lazarusidestrconsts:lischaractermap
|
|
msgid "Character Map"
|
|
msgstr "Simbolių lentelė"
|
|
|
|
#: lazarusidestrconsts:rscharacterset
|
|
msgid "Character set:"
|
|
msgstr "Koduotė:"
|
|
|
|
#: lazarusidestrconsts:lismenuchecklfm
|
|
msgid "Check LFM file in editor"
|
|
msgstr "Tikrinti LFM failą redaktoriuje"
|
|
|
|
#: lazarusidestrconsts:lischeckchangesondiskwithloading
|
|
msgid "Check changes on disk with loading"
|
|
msgstr "Įkeliant ieškoti pasikeitimų diske"
|
|
|
|
#: lazarusidestrconsts:dlgcheckconsistency
|
|
msgid "Check consistency"
|
|
msgstr "Tikrinti darną"
|
|
|
|
#: lazarusidestrconsts:dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr "Tikrinamos kompiliatoriaus parinktys"
|
|
|
|
#: lazarusidestrconsts:dlgcochecks
|
|
msgid "Checks:"
|
|
msgstr "Tikrinti:"
|
|
|
|
#: lazarusidestrconsts:rslanguagechinese
|
|
msgid "Chinese"
|
|
msgstr "Kiniečių"
|
|
|
|
#: lazarusidestrconsts:lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr "Nurodykit .po failo katalogą"
|
|
|
|
#: lazarusidestrconsts:lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr "Nurodykit Delphi paketą (*.dpk)"
|
|
|
|
#: lazarusidestrconsts:lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr "Nurodykit Delphi projektą (*.dpr)"
|
|
|
|
#: lazarusidestrconsts:lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Nurodykit Delphi modulį (*.pas)"
|
|
|
|
#: lazarusidestrconsts:lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Parinkite katalogą"
|
|
|
|
#: lazarusidestrconsts:lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "Nurodykite FPC pirminio kodo katalogą"
|
|
|
|
#: lazarusidestrconsts:liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr "Rinkitės klavišų priskyrimo schemą"
|
|
|
|
#: lazarusidestrconsts:lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Nurodykite Lazarus katalogą"
|
|
|
|
#: lazarusidestrconsts:lisedoptschoosescheme
|
|
msgid "Choose Scheme"
|
|
msgstr "Rinkitės derinį"
|
|
|
|
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
|
|
msgid "Choose a base class for the favourite property %s%s%s."
|
|
msgstr "Mėgstamiausiąjai savybei %s%s%s parinkite bazinę klasę."
|
|
|
|
#: lazarusidestrconsts:lischooseadifferentname
|
|
msgid "Choose a different name"
|
|
msgstr "Nurodykite kitokį vardą"
|
|
|
|
#: lazarusidestrconsts:dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Rinkitės kodo šablono failą (*.dci)"
|
|
|
|
#: lazarusidestrconsts:lischoosecompilerpath
|
|
msgid "Choose compiler filename (%s)"
|
|
msgstr "Nurorodykite kompiliatoriaus dailo vardą (%s)"
|
|
|
|
#: lazarusidestrconsts:lischoosedebuggerpath
|
|
msgid "Choose debugger filename"
|
|
msgstr "Nurodykite derintuvės failo vardą"
|
|
|
|
#: lazarusidestrconsts:lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Nurodykite katalogą"
|
|
|
|
#: lazarusidestrconsts:lischoosemakepath
|
|
msgid "Choose make path"
|
|
msgstr "Nurodykite make kelią"
|
|
|
|
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują failą"
|
|
|
|
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują paketą"
|
|
|
|
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr "Pasirinkę kurį nors iš žemiau pateiktų elementų sukursite naują projektą"
|
|
|
|
#: lazarusidestrconsts:lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr "Nurodykite kuriame kataloge dėti IKA vykdomąjį failą "
|
|
|
|
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Nurodykit programos pirminį kodą (*.pp, *.pas, *.lpr)"
|
|
|
|
#: lazarusidestrconsts:lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Nurodykite kokią struktūrą apgaubti pažymėtąjį kodą"
|
|
|
|
#: lazarusidestrconsts:lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr "Nurodykite katalogą testams"
|
|
|
|
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
|
|
msgid "Circle in package dependencies"
|
|
msgstr "Ratas paketo priklausiniuose"
|
|
|
|
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
|
|
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
|
msgstr "Klasė %s%s%s nėra registruoto komponento klasė.%sĮdėti nepavyks."
|
|
|
|
#: lazarusidestrconsts:lisoifclassnotfound
|
|
msgid "Class %s%s%s not found."
|
|
msgstr "Klasė %s%s%s nerasta."
|
|
|
|
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Dubliuojasi klasės vardas "
|
|
|
|
#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic
|
|
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
|
msgstr "Klasė konfliktuoja su .lfm failu:%smodulis %s%s naudoja modulį %s,%skuriame yra klasė %s, %stačiau ,lfm faile įrašyta visai kita klasė.%sModulyje gali būti tik viena vizualinė klasė.%s%sPekelkit į kitą modulį."
|
|
|
|
#: lazarusidestrconsts:lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Klasė nerasta"
|
|
|
|
#: lazarusidestrconsts:dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "Klasės eilė"
|
|
|
|
#: lazarusidestrconsts:dlgclassinsertpolicy
|
|
msgid "Class part insert policy"
|
|
msgstr "Klasės dalies įterpimo politika"
|
|
|
|
#: lazarusidestrconsts:liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Klasikinis"
|
|
|
|
#: lazarusidestrconsts:liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr "Valyti katalogą"
|
|
|
|
#: lazarusidestrconsts:liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Apvalyti Lazarus katalogus"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
|
|
msgid "Clean Up + Build all"
|
|
msgstr "Išvalyti + Daryti viską"
|
|
|
|
#: lazarusidestrconsts:lislazbuildcleanall
|
|
msgid "Clean all"
|
|
msgstr "Visiškas apvalymas"
|
|
|
|
#: lazarusidestrconsts:lismenucleandirectory
|
|
msgid "Clean directory ..."
|
|
msgstr "Apvalyti katalogą..."
|
|
|
|
#: lazarusidestrconsts:liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Valyti pakatalogius"
|
|
|
|
#: lazarusidestrconsts:liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr "Apvalyti modulių kelią?"
|
|
|
|
#: lazarusidestrconsts:lislazbuildcleanbuild
|
|
msgid "Clean+Build"
|
|
msgstr "Apvalyti ir daryti"
|
|
|
|
#: lazarusidestrconsts:srvk_clear
|
|
msgid "Clear"
|
|
msgstr "Clear"
|
|
|
|
#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
|
|
msgid "Clear dependency filename"
|
|
msgstr "Išvalyti priklausomo failo vardą"
|
|
|
|
#: lazarusidestrconsts:lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr "Išvalyti įtraukiamų failų podėlį"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "Išvalyti žurnalą paleidžiant"
|
|
|
|
#: lazarusidestrconsts:lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr "Čia paspaudę, galėsite naršyti failo"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Spustelėjus ant elemento bus parodytas jo diff"
|
|
|
|
#: lazarusidestrconsts:lismenuclose
|
|
msgid "Close"
|
|
msgstr "Užverti"
|
|
|
|
#: lazarusidestrconsts:liskmcloseall
|
|
msgid "Close All"
|
|
msgstr "Užverti visus"
|
|
|
|
#: lazarusidestrconsts:lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Užverti projektą"
|
|
|
|
#: lazarusidestrconsts:lismenucloseall
|
|
msgid "Close all editor files"
|
|
msgstr "Užverti visus redaktoriaus failus"
|
|
|
|
#: lazarusidestrconsts:lissrclosepage
|
|
msgid "Close page"
|
|
msgstr "Užverti lapą"
|
|
|
|
#: lazarusidestrconsts:liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Užverti projektą"
|
|
|
|
#: lazarusidestrconsts:dlgcodegeneration
|
|
msgid "Code"
|
|
msgstr "Kodas"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcodebrowser
|
|
msgid "Code Browser"
|
|
msgstr "Kodo naršyklė"
|
|
|
|
#: lazarusidestrconsts:dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Kodo kūrimas"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcodeexplorer
|
|
msgid "Code Explorer"
|
|
msgstr "Kodo tyrinėtojas"
|
|
|
|
#: lazarusidestrconsts:lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Kodo šablonai..."
|
|
|
|
#: lazarusidestrconsts:dlgcodetoolstab
|
|
msgid "Code Tools"
|
|
msgstr "Kodo pagalbininkai"
|
|
|
|
#: lazarusidestrconsts:liscodebrowser
|
|
msgid "Code browser"
|
|
msgstr "Kodo naršyklė"
|
|
|
|
#: lazarusidestrconsts:dlgusecodefolding
|
|
msgid "Code folding"
|
|
msgstr "Kodo suvėrimas"
|
|
|
|
#: lazarusidestrconsts:dlgedcodeparams
|
|
msgid "Code parameters"
|
|
msgstr "Kodo parametrai"
|
|
|
|
#: lazarusidestrconsts:srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Kodo šablono užbaigimas"
|
|
|
|
#: lazarusidestrconsts:dlgedcodetempl
|
|
msgid "Code templates"
|
|
msgstr "Kodo šablonai"
|
|
|
|
#: lazarusidestrconsts:lisceocodeexplorer
|
|
msgid "CodeExplorer Options"
|
|
msgstr "Kodo tyrinėtojo parinktys"
|
|
|
|
#: lazarusidestrconsts:liscodetools
|
|
msgid "CodeTools"
|
|
msgstr "CodeTools"
|
|
|
|
#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
|
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
|
msgstr "CodeTools - funkcijos ir įrankiai, skirti analizuoti, naršyti ir keisti paskalio pirminį tekstą"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "CodeTools apibrėžčių redaktorius"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
|
|
msgid "CodeTools Defines Preview"
|
|
msgstr "CodeTools apibrėžčių peržiūra"
|
|
|
|
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "CodeTools katalogo vertės"
|
|
|
|
#: lazarusidestrconsts:dlgcodetoolsopts
|
|
msgid "CodeTools Options"
|
|
msgstr "CodeTools parinktys"
|
|
|
|
#: lazarusidestrconsts:lismenucodetoolsoptions
|
|
msgid "CodeTools Options ..."
|
|
msgstr "CodeTools parinktys..."
|
|
|
|
#: lazarusidestrconsts:srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "CodeTools komandos"
|
|
|
|
#: lazarusidestrconsts:liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr "CodeTools apibrėžčių redaktorius"
|
|
|
|
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
|
|
msgid "CodeTools defines editor ..."
|
|
msgstr "CodeTools apibrėžčių redaktorius..."
|
|
|
|
#: lazarusidestrconsts:liskmcodetoolsoptions
|
|
msgid "CodeTools options"
|
|
msgstr "CodeTools parinktys"
|
|
|
|
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
|
|
msgid "Codetools defines editor"
|
|
msgstr "CodeTools apibrėžčių redaktorius"
|
|
|
|
#: lazarusidestrconsts:srkmeccodetoolsoptions
|
|
msgid "Codetools options"
|
|
msgstr "CodeTools parinktys"
|
|
|
|
#: lazarusidestrconsts:liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr "Suskleisti visas klases"
|
|
|
|
#: lazarusidestrconsts:liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr "Suskleisti visus paketus"
|
|
|
|
#: lazarusidestrconsts:liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr "Suskleisti visus modulius"
|
|
|
|
#: lazarusidestrconsts:lismenucollectpofil
|
|
msgid "Collect .po files"
|
|
msgstr "Surinkti .po failus"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Dvitaškis"
|
|
|
|
#: lazarusidestrconsts:dlgedcolor
|
|
msgid "Color"
|
|
msgstr "Spalva"
|
|
|
|
#: lazarusidestrconsts:dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Spalvų derinys"
|
|
|
|
#: lazarusidestrconsts:dlgenvcolors
|
|
msgid "Colors"
|
|
msgstr "Spalvos"
|
|
|
|
#: lazarusidestrconsts:srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Stulpelių žymėjimo veiksena"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Kablelis"
|
|
|
|
#: lazarusidestrconsts:liscommandafter
|
|
msgid "Command after"
|
|
msgstr "Komanda po"
|
|
|
|
#: lazarusidestrconsts:liscommandafterinvalid
|
|
msgid "Command after invalid"
|
|
msgstr "Klaidinga komanda esanti po"
|
|
|
|
#: lazarusidestrconsts:liscommandafterpublishingmodule
|
|
msgid "Command after publishing module"
|
|
msgstr "Komanda po modulio paskelbimo"
|
|
|
|
#: lazarusidestrconsts:srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Menių \"Komandos\" komandos"
|
|
|
|
#: lazarusidestrconsts:dlgcommandlineparameters
|
|
msgid "Command line parameters"
|
|
msgstr "Komandinės eilutės parametrai"
|
|
|
|
#: lazarusidestrconsts:dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Komandinės eilutės parametrai (be programos vardo)"
|
|
|
|
#: lazarusidestrconsts:liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Programos komandinės eilutės parametrai"
|
|
|
|
#: lazarusidestrconsts:liscocommand
|
|
msgid "Command:"
|
|
msgstr "Komanda:"
|
|
|
|
#: lazarusidestrconsts:lismenucommentselection
|
|
msgid "Comment selection"
|
|
msgstr "Uždėti komentarą pažymėtajam"
|
|
|
|
#: lazarusidestrconsts:liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Komentaras:"
|
|
|
|
#: lazarusidestrconsts:dlgcocompilation
|
|
msgid "Compilation"
|
|
msgstr "Kompiliacija"
|
|
|
|
#: lazarusidestrconsts:liscocalloncompile
|
|
msgid "Compile"
|
|
msgstr "Kompiliuojama"
|
|
|
|
#: lazarusidestrconsts:liscompileidewithoutlinking
|
|
msgid "Compile IDE (without linking)"
|
|
msgstr "Kompiliuoti IKA (nesaistant)"
|
|
|
|
#: lazarusidestrconsts:lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Kompiliuoti viską?"
|
|
|
|
#: lazarusidestrconsts:lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Kompiliuoti paketą"
|
|
|
|
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
|
|
msgid "CompiledSrcPath addition"
|
|
msgstr "Priedas prie CompiledSrcPath"
|
|
|
|
#: lazarusidestrconsts:liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Kompiliatorius"
|
|
|
|
#: lazarusidestrconsts:dlgcompileroptions
|
|
msgid "Compiler Options"
|
|
msgstr "Kompiliatoriaus parinktys"
|
|
|
|
#: lazarusidestrconsts:lismenucompileroptions
|
|
msgid "Compiler Options ..."
|
|
msgstr "Kompiliatoriaus parinktys..."
|
|
|
|
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
|
|
msgid "Compiler Options for Package %s"
|
|
msgstr "Paketo %s kompiliavimo parinktys"
|
|
|
|
#: lazarusidestrconsts:liscompileroptionsforproject
|
|
msgid "Compiler Options for Project: %s"
|
|
msgstr "Kompiliatoriaus parinktys projektui: %s"
|
|
|
|
#: lazarusidestrconsts:liscompilererror
|
|
msgid "Compiler error"
|
|
msgstr "Kompiliatoriaus klaida"
|
|
|
|
#: lazarusidestrconsts:liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Kompiliatoriaus failo vardas"
|
|
|
|
#: lazarusidestrconsts:liskmcompileroptions
|
|
msgid "Compiler options"
|
|
msgstr "Kompiliatoriaus parinktys"
|
|
|
|
#: lazarusidestrconsts:dlgfpcpath
|
|
msgid "Compiler path (e.g. %s)"
|
|
msgstr "Kompiliatoriaus failas (pvz.: %s)"
|
|
|
|
#: lazarusidestrconsts:lismenucompletecode
|
|
msgid "Complete Code"
|
|
msgstr "Užbaigti kodą"
|
|
|
|
#: lazarusidestrconsts:srkmeccompletecode
|
|
msgid "Complete code"
|
|
msgstr "Užbaigti kodą"
|
|
|
|
#: lazarusidestrconsts:dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Užbaigti savybes"
|
|
|
|
#: lazarusidestrconsts:liscomponent
|
|
msgid "Component"
|
|
msgstr "Komponentė"
|
|
|
|
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
|
|
msgid "Component Class %s%s%s already defined"
|
|
msgstr "Komponentės klasė %s%s%s jau paskelbta"
|
|
|
|
#: lazarusidestrconsts:liscomponentnameiskeyword
|
|
msgid "Component name %s%s%s is keyword"
|
|
msgstr "Komponentės vardas %s%s%s kaip ir raktažodžio"
|
|
|
|
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
|
|
msgid "Component name %s%s%s is not a valid identifier"
|
|
msgstr "Komponento vardas %s%s%s nėra identifikatorius"
|
|
|
|
#: lazarusidestrconsts:lisfpcomponents
|
|
msgid "Components"
|
|
msgstr "Komponentės"
|
|
|
|
#: lazarusidestrconsts:liscondition
|
|
msgid "Condition"
|
|
msgstr "Sąlyga"
|
|
|
|
#: lazarusidestrconsts:rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr "Sąlyginės apibrėžtys"
|
|
|
|
#: lazarusidestrconsts:liskmconfigbuildfile
|
|
msgid "Config %sBuild File%s"
|
|
msgstr "Derinti %sDaryti failą%s"
|
|
|
|
#: lazarusidestrconsts:dlgconfigfiles
|
|
msgid "Config Files:"
|
|
msgstr "Nustatymų failai:"
|
|
|
|
#: lazarusidestrconsts:lisconfigurebuildlazarus
|
|
msgid "Configure %sBuild Lazarus%s"
|
|
msgstr "Derinti %sDaryti Lazarus%s"
|
|
|
|
#: lazarusidestrconsts:lisconfigurebuild
|
|
msgid "Configure Build %s"
|
|
msgstr "Derinti %s daryklę"
|
|
|
|
#: lazarusidestrconsts:lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Derinti \"Daryti ir startuoti failą\"..."
|
|
|
|
#: lazarusidestrconsts:liskmconfigurehelp
|
|
msgid "Configure Help"
|
|
msgstr "Derinti žinyną"
|
|
|
|
#: lazarusidestrconsts:lismenuconfigurehelp
|
|
msgid "Configure Help ..."
|
|
msgstr "Derinti žinyną..."
|
|
|
|
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "Derinti \"Daryti Lazarus\"..."
|
|
|
|
#: lazarusidestrconsts:liskmconfigurecustomcomponents
|
|
msgid "Configure custom components"
|
|
msgstr "Derinti naudotojo komponentes"
|
|
|
|
#: lazarusidestrconsts:lismenuconfigcustomcomps
|
|
msgid "Configure custom components ..."
|
|
msgstr "Derinti naudotojo komponentes..."
|
|
|
|
#: lazarusidestrconsts:lismenusettings
|
|
msgid "Configure custom tools ..."
|
|
msgstr "Derinti naudotojo įrankius..."
|
|
|
|
#: lazarusidestrconsts:liskmconfigureinstalledpackages
|
|
msgid "Configure installed packages"
|
|
msgstr "Derinti įdiegtus paketus"
|
|
|
|
#: lazarusidestrconsts:lismenueditinstallpkgs
|
|
msgid "Configure installed packages ..."
|
|
msgstr "Derinti įdiegtus paketus..."
|
|
|
|
#: lazarusidestrconsts:lislazbuildconfirmbuild
|
|
msgid "Confirm before rebuilding Lazarus"
|
|
msgstr "Prieš darant Lazarus reikalauti patvirtinimo"
|
|
|
|
#: lazarusidestrconsts:lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr "Patvirtinkit pakeitimus"
|
|
|
|
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Patvirtinimas naikinat priklausomybę"
|
|
|
|
#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr "IKA paketų sąrašo patvirtinimas"
|
|
|
|
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr "Patvirtinimas šalinant failą"
|
|
|
|
#: lazarusidestrconsts:liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr "Patvirtinimas pakeičiant"
|
|
|
|
#: lazarusidestrconsts:srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Konfliktas"
|
|
|
|
#: lazarusidestrconsts:lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr "Aptiktas konfliktas"
|
|
|
|
#: lazarusidestrconsts:lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr "Konsolės programa"
|
|
|
|
#: lazarusidestrconsts:lisceconstants
|
|
msgid "Constants"
|
|
msgstr "Konstantos"
|
|
|
|
#: lazarusidestrconsts:dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Konstruktoriaus vardas turi būti \"init\" (destruktoriaus - \"done\")"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatecontents
|
|
msgid "Contents"
|
|
msgstr "Turinys"
|
|
|
|
#: lazarusidestrconsts:lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr "Kontekstinis žinynas"
|
|
|
|
#: lazarusidestrconsts:liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr "Kontekstinis žinynas"
|
|
|
|
#: lazarusidestrconsts:liscontinue
|
|
msgid "Continue"
|
|
msgstr "Tęsti"
|
|
|
|
#: lazarusidestrconsts:liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr "Tęsti neįkeliant formos"
|
|
|
|
#: lazarusidestrconsts:liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Talkininkai"
|
|
|
|
#: lazarusidestrconsts:srvk_control
|
|
msgid "Control"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts:liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr "Valdikliui reikia tėvo"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Konvertavimo parinktys"
|
|
|
|
#: lazarusidestrconsts:lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr "Klaida konvertuojant"
|
|
|
|
#: lazarusidestrconsts:srvk_convert
|
|
msgid "Convert"
|
|
msgstr "Convert"
|
|
|
|
#: lazarusidestrconsts:liskmconvertdfmfiletolfm
|
|
msgid "Convert DFM file to LFM"
|
|
msgstr "Konvertuoti DFM į LFM"
|
|
|
|
#: lazarusidestrconsts:lismenuconvertdfmtolfm
|
|
msgid "Convert DFM file to LFM ..."
|
|
msgstr "Konvertuoti DFM failą į LFM..."
|
|
|
|
#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Delphi paketą konvertuoti į Lazarus paketą"
|
|
|
|
#: lazarusidestrconsts:lismenuconvertdelphipackage
|
|
msgid "Convert Delphi package to Lazarus package ..."
|
|
msgstr "Konvertuoti Delphi paketą į Lazarus paketą..."
|
|
|
|
#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
|
|
msgid "Convert Delphi project to Lazarus project"
|
|
msgstr "Konvertuoti Delphi projektą į Lazarus projektą"
|
|
|
|
#: lazarusidestrconsts:lismenuconvertdelphiproject
|
|
msgid "Convert Delphi project to Lazarus project ..."
|
|
msgstr "Konvertuoti Delphi projektą į Lazarus projektą..."
|
|
|
|
#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
|
|
msgid "Convert Delphi unit to Lazarus unit"
|
|
msgstr "Konvertuoti Delphi modulį į Lazarus modulį"
|
|
|
|
#: lazarusidestrconsts:lismenuconvertdelphiunit
|
|
msgid "Convert Delphi unit to Lazarus unit ..."
|
|
msgstr "Konvertuoti Delphi modulį į Lazarus modulį..."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Konvertuoti mazgą"
|
|
|
|
#: lazarusidestrconsts:srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Pažymėjime tabuliatoriaus simbolius konvertuoti į tarpų simbolius"
|
|
|
|
#: lazarusidestrconsts:lismenucopy
|
|
msgid "Copy"
|
|
msgstr "Kopijuoti"
|
|
|
|
#: lazarusidestrconsts:liscopyall
|
|
msgid "Copy All"
|
|
msgstr "Kopijuoti viską"
|
|
|
|
#: lazarusidestrconsts:liscopyerror
|
|
msgid "Copy Error"
|
|
msgstr "Klaida kopijuojant"
|
|
|
|
#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
|
|
msgid "Copy all and hidden messages to clipboard"
|
|
msgstr "Kopijuoti visus (ir paslėptus) pranešimus į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:liscopyallmessagestoclipboard
|
|
msgid "Copy all messages to clipboard"
|
|
msgstr "Kopijuoti visus pranešimus į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Klaida kopijuojant"
|
|
|
|
#: lazarusidestrconsts:uemcopyfilename
|
|
msgid "Copy filename"
|
|
msgstr "Kopijuoti failo vardą"
|
|
|
|
#: lazarusidestrconsts:lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr "Kopijuoti iš paveldo"
|
|
|
|
#: lazarusidestrconsts:lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr "Metodo vardą kopijuoti į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr "Kopijuoti išvestį į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
|
|
msgid "Copy selected Components to clipboard"
|
|
msgstr "Kopijuoti pažymėtas komponentes į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Kopijuoti pažymėtas komponentes į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
|
|
msgid "Copy selected messages to clipboard"
|
|
msgstr "Kopijuoti pažymėtus pranešimus į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:srkmeccopy
|
|
msgid "Copy selection to clipboard"
|
|
msgstr "Pažymėtą kopijuoti į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr "Kopijuoti versijos informaciją iškarpinėn"
|
|
|
|
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
|
|
msgid "Copy word on copy none"
|
|
msgstr "Kai kopijuojant nieks nepažymėta- kopijuoti žodį"
|
|
|
|
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr "Visos formos kopijavimas dar nėra įgyvendintas."
|
|
|
|
#: lazarusidestrconsts:rscopyright
|
|
msgid "Copyright:"
|
|
msgstr "Autorinė teisė:"
|
|
|
|
#: lazarusidestrconsts:dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Skaitliukas (.pp.1)"
|
|
|
|
#: lazarusidestrconsts:lisnpcreate
|
|
msgid "Create"
|
|
msgstr "Sukurti"
|
|
|
|
#: lazarusidestrconsts:lismenucreatepofile
|
|
msgid "Create .po files"
|
|
msgstr "Kurti .po failus"
|
|
|
|
#: lazarusidestrconsts:dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr "Sukurti programą-rišulį"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Sukurti apibrėžtis %s katalogui"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Sukurti apibrėžtis projektui %s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Sukurti apibrėžtis FreePascal kompiliatoriui"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgstr "Sukurti apibrėžtis FreePascal SVN pirminiam kodui"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
|
|
msgid "Create Defines for Lazarus Directory"
|
|
msgstr "Sukurti apibrėžtis Lazarus katalogui"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "Sukurti FPC makrokomandas ir kelius FPC projekto katalogui"
|
|
|
|
#: lazarusidestrconsts:lismenucreatefpdocfiles
|
|
msgid "Create FPDoc files"
|
|
msgstr "Sukurti FPDoc failus"
|
|
|
|
#: lazarusidestrconsts:dlgcocreatemakefile
|
|
msgid "Create Makefile"
|
|
msgstr "Sukurti Makefile"
|
|
|
|
#: lazarusidestrconsts:lismenueditorcreatesubmenu
|
|
msgid "Create Submenu"
|
|
msgstr "Sukurti pomenių"
|
|
|
|
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
|
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
|
msgstr "Kurti naują cgi programą.%sProgramos failu rūpinsis Lazarus."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Kurti naują redaktoriaus failą.%sNurodykite jo tipą."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Kurti naują tuščią teksto failą."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
|
|
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
|
msgstr "Kurti naują grafinę programą.%sProgramos failu rūpinsis Lazarus."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
|
|
msgid "Create a new pascal unit."
|
|
msgstr "Kurti naują paskalio modulį."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
|
|
msgid "Create a new program."
|
|
msgstr "Kurti naują programą."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
|
|
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
|
msgstr "Kurti naują programą.%sProgramos failu rūpinsis Lazarus."
|
|
|
|
#: lazarusidestrconsts:lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr "Kurti naują projektą"
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Kurti naują projektą.%sNurodykite jo tipą."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Kurti naują standartinį paketą.%sPaketas- tai modulių bei komponentų rinkinys."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Kurti naują modulį su LCL forma."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Kurti naują modulį su duomenų moduliu."
|
|
|
|
#: lazarusidestrconsts:liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Pirma sukurkite projektą!"
|
|
|
|
#: lazarusidestrconsts:liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr "Kurti žinyno elementą"
|
|
|
|
#: lazarusidestrconsts:rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr "Sukurti naują apibrėžtį"
|
|
|
|
#: lazarusidestrconsts:lisa2pcreatenewfile
|
|
msgid "Create new file"
|
|
msgstr "Kurti naują failą"
|
|
|
|
#: lazarusidestrconsts:liscreatenewproject
|
|
msgid "Create new project"
|
|
msgstr "Kurti naują projektą"
|
|
|
|
#: lazarusidestrconsts:dlgruberbandcreationcolor
|
|
msgid "Creation"
|
|
msgstr "Kūrimas"
|
|
|
|
#: lazarusidestrconsts:srkm_ctrl
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts:liscurrent
|
|
msgid "Current"
|
|
msgstr "Vaikiamasis"
|
|
|
|
#: lazarusidestrconsts:lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Veikiamasis projektas"
|
|
|
|
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
|
|
msgid "Current Project Directory"
|
|
msgstr "Veikiamasis projekto katalogas"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertdatetime
|
|
msgid "Current date and time"
|
|
msgstr "Dabartinė data ir laikas"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertusername
|
|
msgid "Current username"
|
|
msgstr "Dabartinis naudotojo vardas"
|
|
|
|
#: lazarusidestrconsts:dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Žymeklis peržengia EOL"
|
|
|
|
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Žymeklio stulpelis veikiamąjame redaktoriuje"
|
|
|
|
#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr "Žymeklis ne klasės paskelbimo bloke"
|
|
|
|
#: lazarusidestrconsts:srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Žymeklio perkėlimo komandos"
|
|
|
|
#: lazarusidestrconsts:liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Žymeklio eilutė veikiamąjame redaktoriuje"
|
|
|
|
#: lazarusidestrconsts:lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Naudotojo"
|
|
|
|
#: lazarusidestrconsts:liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr "naudotojo programa"
|
|
|
|
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
|
|
msgid "Custom Program%sA freepascal program."
|
|
msgstr "Naudotojo programa%sFreePascal programa."
|
|
|
|
#: lazarusidestrconsts:liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Kitos komandos"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr "Naudotojo identifikatorius"
|
|
|
|
#: lazarusidestrconsts:liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Naudotojo parinktys"
|
|
|
|
#: lazarusidestrconsts:rsiwpcustomposition
|
|
msgid "Custom position"
|
|
msgstr "Nurodytas dydis"
|
|
|
|
#: lazarusidestrconsts:srkmeccustomtool
|
|
msgid "Custom tool %d"
|
|
msgstr "Naudotojo įrankis %d"
|
|
|
|
#: lazarusidestrconsts:lismenucut
|
|
msgid "Cut"
|
|
msgstr "Iškirpti"
|
|
|
|
#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
|
|
msgid "Cut selected Components to clipboard"
|
|
msgstr "Iškirpti pažymėtas komponentes į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Iškirpti pažymėtas komponentes į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:srkmeccut
|
|
msgid "Cut selection to clipboard"
|
|
msgstr "Pažymėtą iškirpti į iškarpinę"
|
|
|
|
#: lazarusidestrconsts:liswldisableall
|
|
msgid "D&isable All"
|
|
msgstr "Pasyv&inti visus"
|
|
|
|
#: lazarusidestrconsts:lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Duomenų bazės"
|
|
|
|
#: lazarusidestrconsts:lisdate
|
|
msgid "Date"
|
|
msgstr "Data"
|
|
|
|
#: lazarusidestrconsts:liswldeleteall
|
|
msgid "De&lete All"
|
|
msgstr "Paša&linti visus"
|
|
|
|
#: lazarusidestrconsts:uemdebugword
|
|
msgid "Debug"
|
|
msgstr "Derinimas"
|
|
|
|
#: lazarusidestrconsts:lismenuviewdebugoutput
|
|
msgid "Debug output"
|
|
msgstr "Derinimo išvestis"
|
|
|
|
#: lazarusidestrconsts:lismenudebugwindows
|
|
msgid "Debug windows"
|
|
msgstr "Derinimo langai"
|
|
|
|
#: lazarusidestrconsts:lismendebuggeroptions
|
|
msgid "Debugger Options ..."
|
|
msgstr "Derintuvės parinktys..."
|
|
|
|
#: lazarusidestrconsts:lisdebuggererror
|
|
msgid "Debugger error"
|
|
msgstr "Derintuvės klaida"
|
|
|
|
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgstr "Derintuvės klaida%sAmen! Derintuvė praranda stabilumą!%sNedelsdami išsaugokite darbo rezultatus!%sSpauskite \"Stabdyti\", ir tikėkitės kad viskas baigsis laimingai..."
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Derintuvės pagrindinės parinktys"
|
|
|
|
#: lazarusidestrconsts:lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Netinkama derintuvė"
|
|
|
|
#: lazarusidestrconsts:dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Papildomas kelias iki derintuvės (joks):"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Derintuvės specifinės parinktys (priklauso nuo derintuvės tipo)"
|
|
|
|
#: lazarusidestrconsts:dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Derintuvės tipas ir failas"
|
|
|
|
#: lazarusidestrconsts:dlgcodebugging
|
|
msgid "Debugging:"
|
|
msgstr "Derinimas:"
|
|
|
|
#: lazarusidestrconsts:lisdecimal
|
|
msgid "Decimal"
|
|
msgstr "Dešimtainis"
|
|
|
|
#: lazarusidestrconsts:dlgassemblerdefault
|
|
msgid "Default"
|
|
msgstr "Numatytas"
|
|
|
|
#: lazarusidestrconsts:dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Numatytas redaktoriaus šriftas"
|
|
|
|
#: lazarusidestrconsts:dlgpasext
|
|
msgid "Default pascal extension"
|
|
msgstr "Numatytas paskalio prievardis"
|
|
|
|
#: lazarusidestrconsts:dlgdefvaluecolor
|
|
msgid "Default value"
|
|
msgstr "Numatyta vertė"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Apibrėžti"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Rekursyviai apibrėžti"
|
|
|
|
#: lazarusidestrconsts:lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Apibrėžčių šablonai"
|
|
|
|
#: lazarusidestrconsts:dlgeddelay
|
|
msgid "Delay"
|
|
msgstr "Delsa"
|
|
|
|
#: lazarusidestrconsts:dlgeddelete
|
|
msgid "Delete"
|
|
msgstr "Pašalinti"
|
|
|
|
#: lazarusidestrconsts:lisdeleteallinsamesource
|
|
msgid "Delete All in same source"
|
|
msgstr "Pašalinti visus šiame pirminiame kode"
|
|
|
|
#: lazarusidestrconsts:lismenueditordeletefromtemplate
|
|
msgid "Delete From Template..."
|
|
msgstr "Pašalinti iš šablono..."
|
|
|
|
#: lazarusidestrconsts:lismenueditordeleteitem
|
|
msgid "Delete Item"
|
|
msgstr "Pašalinti elementą"
|
|
|
|
#: lazarusidestrconsts:srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Pašalinti paskutinį simbolį"
|
|
|
|
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Ištrinti seną paketo failą?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteallbreakpoints2
|
|
msgid "Delete all breakpoints in file %s%s%s?"
|
|
msgstr "Pašalinti visus stabdos taškus, esančius faile %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteallbreakpoints
|
|
msgid "Delete all breakpoints?"
|
|
msgstr "Pašalinti visus stabdos taškus?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
|
|
msgid "Delete all selected breakpoints?"
|
|
msgstr "Pašalinti visus pažymėtus stabdos taškus?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Pašalinti visus šiuos failus?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Ištrinti neaiškųjį failą?"
|
|
|
|
#: lazarusidestrconsts:lisdeletebreakpointatline
|
|
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
|
msgstr "Pašalinti stabdos tašką, esantį%s\"%s\" failo %d eilutėje?"
|
|
|
|
#: lazarusidestrconsts:srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Pašalinti simbolį ties žymekliu"
|
|
|
|
#: lazarusidestrconsts:srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Pašalinti šią veikiamąją eilutę"
|
|
|
|
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Naikinti %s priklausomybę?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangdeletefailed
|
|
msgid "Delete failed"
|
|
msgstr "Nepavyko ištrinti"
|
|
|
|
#: lazarusidestrconsts:lisdeletefilefailed
|
|
msgid "Delete file failed"
|
|
msgstr "Nepavyko ištrinti failą"
|
|
|
|
#: lazarusidestrconsts:liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Pašalinti paskutinį simbolį"
|
|
|
|
#: lazarusidestrconsts:liscodehelpdeletelinkbutton
|
|
msgid "Delete link"
|
|
msgstr "Pašalinti nuorodą"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Pašalinti mazgą"
|
|
|
|
#: lazarusidestrconsts:lisdeleteoldfile
|
|
msgid "Delete old file %s%s%s?"
|
|
msgstr "Ištrinti senąjį failą %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
|
|
msgid "Delete old package file %s%s%s?"
|
|
msgstr "Ištrinti seną paketo failą %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:fdmdeleteselection
|
|
msgid "Delete selection"
|
|
msgstr "Pašalinti pažymėtą"
|
|
|
|
#: lazarusidestrconsts:dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Pašalinti šabloną"
|
|
|
|
#: lazarusidestrconsts:srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Pašalinti iki eilutės pradžios"
|
|
|
|
#: lazarusidestrconsts:srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Pašalinti iki eilutės pabaigos"
|
|
|
|
#: lazarusidestrconsts:srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Pašalinti iki žodžio pabaigos"
|
|
|
|
#: lazarusidestrconsts:srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Pašalinti iki žodžio pradžios"
|
|
|
|
#: lazarusidestrconsts:srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Pašalinti visą tekstą"
|
|
|
|
#: lazarusidestrconsts:lisdeletingoffilefailed
|
|
msgid "Deleting of file %s%s%s failed."
|
|
msgstr "Nepavyko ištrinti failą %s%s%s."
|
|
|
|
#: lazarusidestrconsts:dlgdelphi2ext
|
|
msgid "Delphi 2 Extensions"
|
|
msgstr "Delphi 2 plėtiniai"
|
|
|
|
#: lazarusidestrconsts:dlgdeplhicomp
|
|
msgid "Delphi Compatible"
|
|
msgstr "Suderinamumas su Delphi"
|
|
|
|
#: lazarusidestrconsts:lisdelphiproject
|
|
msgid "Delphi project"
|
|
msgstr "Delphi projektas"
|
|
|
|
#: lazarusidestrconsts:lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Priklausomybės"
|
|
|
|
#: lazarusidestrconsts:lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr "Priklausomybių savybės"
|
|
|
|
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Priklausomybė jau yra"
|
|
|
|
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Priklausomybė neturi šeimininko: %s"
|
|
|
|
#: lazarusidestrconsts:lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Mažėjanti"
|
|
|
|
#: lazarusidestrconsts:listodoldescription
|
|
msgid "Description"
|
|
msgstr "Aprašymas"
|
|
|
|
#: lazarusidestrconsts:lispckoptsdescriptionabstract
|
|
msgid "Description/Abstract"
|
|
msgstr "Aprašymas/Santrauka"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Aprašymas:"
|
|
|
|
#: lazarusidestrconsts:lisoipdescription
|
|
msgid "Description: "
|
|
msgstr "Aprašymas: "
|
|
|
|
#: lazarusidestrconsts:liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Konstruktoriaus komandos"
|
|
|
|
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
|
|
msgid "Designtime and Runtime"
|
|
msgstr "Konstravimo bei vykdymo metu"
|
|
|
|
#: lazarusidestrconsts:lispckoptsdesigntimeonly
|
|
msgid "Designtime only"
|
|
msgstr "Tik konstravimo metu"
|
|
|
|
#: lazarusidestrconsts:dlgdesktop
|
|
msgid "Desktop"
|
|
msgstr "Darbastalis"
|
|
|
|
#: lazarusidestrconsts:dlgdesktopfiles
|
|
msgid "Desktop files"
|
|
msgstr "Darbastalio failai"
|
|
|
|
#: lazarusidestrconsts:lisaf2pdestinationpackage
|
|
msgid "Destination Package"
|
|
msgstr "Paskirties paketas"
|
|
|
|
#: lazarusidestrconsts:lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Paskirties katalogas"
|
|
|
|
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
|
|
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
|
msgstr "Tikslo katalogas %s%s%s yra klaidingas.%sNurodykite pilną kelią."
|
|
|
|
#: lazarusidestrconsts:lismenudiff
|
|
msgid "Diff"
|
|
msgstr "Diff"
|
|
|
|
#: lazarusidestrconsts:liskmdiffeditorfiles
|
|
msgid "Diff editor files"
|
|
msgstr "Redaktoriaus failus apdoroti komanda Diff"
|
|
|
|
#: lazarusidestrconsts:lisdigits
|
|
msgid "Digits:"
|
|
msgstr "Skaitmenų:"
|
|
|
|
#: lazarusidestrconsts:dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Kryptis"
|
|
|
|
#: lazarusidestrconsts:lisdirectives
|
|
msgid "Directives"
|
|
msgstr "Direktyvos"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Katalogas"
|
|
|
|
#: lazarusidestrconsts:dlgdirectorydoesnotexist
|
|
msgid "Directory does not exist"
|
|
msgstr "Katalogas nerastas"
|
|
|
|
#: lazarusidestrconsts:dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Katalogas testo projektų darymui"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
|
|
msgid "Directory not found"
|
|
msgstr "Katalogas nerastas"
|
|
|
|
#: lazarusidestrconsts:lisfindfiledirectoryoptions
|
|
msgid "Directory options"
|
|
msgstr "Katalogo parinktys"
|
|
|
|
#: lazarusidestrconsts:lisdisableallinsamesource
|
|
msgid "Disable All in same source"
|
|
msgstr "Pasyvinti visus šiame pirminiame kode"
|
|
|
|
#: lazarusidestrconsts:lisdisablegroup
|
|
msgid "Disable Group"
|
|
msgstr "Pasyvinti grupę"
|
|
|
|
#: lazarusidestrconsts:lisdisabled
|
|
msgid "Disabled"
|
|
msgstr "Pasyvus"
|
|
|
|
#: lazarusidestrconsts:lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Neįrašyti pakeitimų"
|
|
|
|
#: lazarusidestrconsts:dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Ekranas"
|
|
|
|
#: lazarusidestrconsts:dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Ekranas (neskirta win32; pvz.: 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
|
|
#: lazarusidestrconsts:dlglnumsbct
|
|
msgid "Display Line Numbers in Run-time Error Backtraces"
|
|
msgstr "Rodyti eilučių numerius veikos metu įvykusių klaidų pėdsako pranešimuose"
|
|
|
|
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr "Ieškant skirti didžiąsias ir mažąsias raides"
|
|
|
|
#: lazarusidestrconsts:dlgcfdividerdrawlevel
|
|
msgid "Divider Draw Level"
|
|
msgstr "Skirtuko rodymo lygis"
|
|
|
|
#: lazarusidestrconsts:lisdonotclosetheide
|
|
msgid "Do not close the IDE"
|
|
msgstr "Neužverti IKA"
|
|
|
|
#: lazarusidestrconsts:lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr "Neužverti projekto"
|
|
|
|
#: lazarusidestrconsts:lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Sesijos informacijos neįrašyti"
|
|
|
|
#: lazarusidestrconsts:lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen"
|
|
msgstr "Nerodyti prisistatymo langelio"
|
|
|
|
#: lazarusidestrconsts:lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Daugiau neberodyti šio pranešimo."
|
|
|
|
#: lazarusidestrconsts:dlgnotsplitlinefront
|
|
msgid "Do not split line In front of:"
|
|
msgstr "Nelaužti eilutės priešais:"
|
|
|
|
#: lazarusidestrconsts:dlgnotsplitlineafter
|
|
msgid "Do not split line after:"
|
|
msgstr "Nelaužti eilutės po:"
|
|
|
|
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Ar ištikro norite panaikinti visus keitimus pakete %s ir jį įkelti išnaujo?"
|
|
|
|
#: lazarusidestrconsts:lisconfirmlazarusrebuild
|
|
msgid "Do you want to rebuild Lazarus?"
|
|
msgstr "Daryti Lazarus išnaujo?"
|
|
|
|
#: lazarusidestrconsts:rsiwpdocked
|
|
msgid "Docked"
|
|
msgstr "Įstatytas"
|
|
|
|
#: lazarusidestrconsts:lismvdocking
|
|
msgid "Docking"
|
|
msgstr "Lango pritvirtinimas"
|
|
|
|
#: lazarusidestrconsts:lisdocumentationeditor
|
|
msgid "Documentation Editor"
|
|
msgstr "Dokumentacijos redaktorius"
|
|
|
|
#: lazarusidestrconsts:liscodehelpnodocumentation
|
|
msgid "Documentation entry does not exist"
|
|
msgstr "Dokumento įrašas neegzistuoja"
|
|
|
|
#: lazarusidestrconsts:lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Sritis"
|
|
|
|
#: lazarusidestrconsts:listodoldone
|
|
msgid "Done"
|
|
msgstr "Baigta"
|
|
|
|
#: lazarusidestrconsts:dlgdoubleclickline
|
|
msgid "Double click line"
|
|
msgstr "Spragtelėjus dukart pažymima visa eilutė"
|
|
|
|
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
|
msgid "Double click on messages jumps (otherwise: single click)"
|
|
msgstr "Spustelėjus dukart ant pranešimo peršoks į pranešamą vietą (kitaip - vienąkart)"
|
|
|
|
#: lazarusidestrconsts:dlgdownword
|
|
msgid "Down"
|
|
msgstr "Apačion"
|
|
|
|
#: lazarusidestrconsts:dlgdragdroped
|
|
msgid "Drag Drop editing"
|
|
msgstr "Redaguojant tekstą galima nuvilkti"
|
|
|
|
#: lazarusidestrconsts:dlgdropfiles
|
|
msgid "Drop files"
|
|
msgstr "Failus galima nuvilkti"
|
|
|
|
#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
|
msgstr "Vardai dubliuojasi: komponentas, vardu %s%s%s, jau yra paveldėtame komponente %s"
|
|
|
|
#: lazarusidestrconsts:rslanguagedutch
|
|
msgid "Dutch"
|
|
msgstr "Olandų"
|
|
|
|
#: lazarusidestrconsts:liswlenableall
|
|
msgid "E&nable All"
|
|
msgstr "Įgali&nti visus"
|
|
|
|
#: lazarusidestrconsts:lismenuenvironent
|
|
msgid "E&nvironment"
|
|
msgstr "&Aplinka"
|
|
|
|
#: lazarusidestrconsts:lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr "KLAIDA: "
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsedit
|
|
msgid "Edit"
|
|
msgstr "Keisti"
|
|
|
|
#: lazarusidestrconsts:liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr "Keisti kodo šablonus"
|
|
|
|
#: lazarusidestrconsts:lispckediteditgeneraloptions
|
|
msgid "Edit General Options"
|
|
msgstr "Keisti pagrindines parinktis"
|
|
|
|
#: lazarusidestrconsts:srkmeditkeys
|
|
msgid "Edit Keys"
|
|
msgstr "Keisti klavišus"
|
|
|
|
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
|
|
msgid "Edit Options to compile package"
|
|
msgstr "Keisti paketo kompiliavimo parinktis"
|
|
|
|
#: lazarusidestrconsts:lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Keisti įrankį"
|
|
|
|
#: lazarusidestrconsts:lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr "Keisti virtualų modulį"
|
|
|
|
#: lazarusidestrconsts:liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Keisti kodo šabloną"
|
|
|
|
#: lazarusidestrconsts:lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr "Redaktoriaus kontekstinis žinynas"
|
|
|
|
#: lazarusidestrconsts:liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr "Keisti kontekstinį žinyną"
|
|
|
|
#: lazarusidestrconsts:liseteditcustomscanners
|
|
msgid "Edit custom scanners (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmeditforcmd
|
|
msgid "Edit keys for command"
|
|
msgstr "Keisti klavišus komandai"
|
|
|
|
#: lazarusidestrconsts:lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr "Keisti virtualų modulį"
|
|
|
|
#: lazarusidestrconsts:dlgededit
|
|
msgid "Edit..."
|
|
msgstr "Keisti..."
|
|
|
|
#: lazarusidestrconsts:dlgedfiles
|
|
msgid "Editor files"
|
|
msgstr "Redaktoriaus failai"
|
|
|
|
#: lazarusidestrconsts:dlgeditorfont
|
|
msgid "Editor font"
|
|
msgstr "Redaktoriaus šriftas"
|
|
|
|
#: lazarusidestrconsts:dlgeditorfontheight
|
|
msgid "Editor font height"
|
|
msgstr "Redaktoriaus šrifto dydis"
|
|
|
|
#: lazarusidestrconsts:liskmeditoroptions
|
|
msgid "Editor options"
|
|
msgstr "Redaktoriaus parinktys"
|
|
|
|
#: lazarusidestrconsts:lismenueditoroptions
|
|
msgid "Editor options ..."
|
|
msgstr "Redaktoriaus parinktys..."
|
|
|
|
#: lazarusidestrconsts:uemeditorproperties
|
|
msgid "Editor properties"
|
|
msgstr "Redaktoriaus savybės"
|
|
|
|
#: lazarusidestrconsts:dlgedelement
|
|
msgid "Element"
|
|
msgstr "Elementas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr "Else"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr "ElseIf"
|
|
|
|
#: lazarusidestrconsts:lisemdemtpymethods
|
|
msgid "Emtpy Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisenableallinsamesource
|
|
msgid "Enable All in same source"
|
|
msgstr "Aktyvinti visus šiame pirminiame kode"
|
|
|
|
#: lazarusidestrconsts:lisenablegroup
|
|
msgid "Enable Group"
|
|
msgstr "Aktyvinti grupę"
|
|
|
|
#: lazarusidestrconsts:lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Įgalinti makrokomandas"
|
|
|
|
#: lazarusidestrconsts:rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr "Įgalinti internacionalizaciją"
|
|
|
|
#: lazarusidestrconsts:lisenabled
|
|
msgid "Enabled"
|
|
msgstr "Veiksnus"
|
|
|
|
#: lazarusidestrconsts:lisanchorenabledhint
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr "Veiksnus = %s įtraukti į prieraišų sąrašą"
|
|
|
|
#: lazarusidestrconsts:lisenclose
|
|
msgid "Enclose"
|
|
msgstr "Apgaubti"
|
|
|
|
#: lazarusidestrconsts:uemencloseselection
|
|
msgid "Enclose Selection"
|
|
msgstr "Apgaubti pažymėtąjį"
|
|
|
|
#: lazarusidestrconsts:liskmencloseselection
|
|
msgid "Enclose selection"
|
|
msgstr "Apgaubti pažymėtąjį"
|
|
|
|
#: lazarusidestrconsts:lismenuencloseselection
|
|
msgid "Enclose selection ..."
|
|
msgstr "Apgaubti pažymėtąjį..."
|
|
|
|
#: lazarusidestrconsts:srvk_end
|
|
msgid "End"
|
|
msgstr "End"
|
|
|
|
#: lazarusidestrconsts:rslanguageenglish
|
|
msgid "English"
|
|
msgstr "Anglų"
|
|
|
|
#: lazarusidestrconsts:lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Įveskite duomenis"
|
|
|
|
#: lazarusidestrconsts:lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "Įveskite starto parametrus"
|
|
|
|
#: lazarusidestrconsts:lisentertransla
|
|
msgid "Enter translation language"
|
|
msgstr "Įveskite vertimo kalbą"
|
|
|
|
#: lazarusidestrconsts:dlgrunoenvironment
|
|
msgid "Environment"
|
|
msgstr "Aplinka"
|
|
|
|
#: lazarusidestrconsts:srkmcatenvmenu
|
|
msgid "Environment menu commands"
|
|
msgstr "Meniu \"Aplinka\" komandos"
|
|
|
|
#: lazarusidestrconsts:lismenugeneraloptions
|
|
msgid "Environment options ..."
|
|
msgstr "Aplinkos parinktys..."
|
|
|
|
#: lazarusidestrconsts:lisccoerrorcaption
|
|
msgid "Error"
|
|
msgstr "Klaida"
|
|
|
|
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Klaida skaitant paketo failą"
|
|
|
|
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Klaida išsaugant paketą"
|
|
|
|
#: lazarusidestrconsts:lisiecoerroraccessingxml
|
|
msgid "Error accessing xml"
|
|
msgstr "Klaida kreipiantis į XML"
|
|
|
|
#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
|
|
msgid "Error accessing xml file %s%s%s:%s%s"
|
|
msgstr "Įvyko klaida kreipiantis į XML failą %s%s%s:%s%s"
|
|
|
|
#: lazarusidestrconsts:liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Klaida kuriant failą"
|
|
|
|
#: lazarusidestrconsts:liserrorcreatinglrs
|
|
msgid "Error creating lrs"
|
|
msgstr "Klaida kuriant LRS"
|
|
|
|
#: lazarusidestrconsts:liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Nepavyko ištrinti failą"
|
|
|
|
#: lazarusidestrconsts:liserrorin
|
|
msgid "Error in %s"
|
|
msgstr "%s yra klaida"
|
|
|
|
#: lazarusidestrconsts:lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Klaidingas reguliarusis reiškinys"
|
|
|
|
#: lazarusidestrconsts:liserrorinitializingprogramserrors
|
|
msgid "Error initializing program%s%s%s%s%sError: %s"
|
|
msgstr "Įvyko klaida inicializuojant programą%s%s%s%s%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:liserrorloadingfrom
|
|
msgid "Error loading %s from%s%s%s%s"
|
|
msgstr "Įvyko klaida %s įkeliant iš %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr "Klaida įkeliant failą"
|
|
|
|
#: lazarusidestrconsts:lisiecoerrorloadingxml
|
|
msgid "Error loading xml"
|
|
msgstr "Klaida įkeliant XML"
|
|
|
|
#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
|
|
msgid "Error loading xml file %s%s%s:%s%s"
|
|
msgstr "Įvyko klaida įkeliant XML failą %s%s%s:%s%s"
|
|
|
|
#: lazarusidestrconsts:liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr "Klaida perkeliant komponentę"
|
|
|
|
#: lazarusidestrconsts:liserrormovingcomponent2
|
|
msgid "Error moving component %s:%s"
|
|
msgstr "Įvyko klaida perkeliant komponentę %s:%s"
|
|
|
|
#: lazarusidestrconsts:lisabcreationfailed
|
|
msgid "Error occured during Application Bundle creation: "
|
|
msgstr "Kuriant programą-ryšulį įvyko klaida: "
|
|
|
|
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr "Įvyko klaida analizuojant lfm komponentės srautą."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefserrorreading
|
|
msgid "Error reading %s%s%s%s%s"
|
|
msgstr "Įvyko klaida įkeliant %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangerrorreadingfile
|
|
msgid "Error reading file"
|
|
msgstr "Klaida įkeliant failą"
|
|
|
|
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
|
|
msgid "Error reading file: %s"
|
|
msgstr "Klaida skaitant failą: %s"
|
|
|
|
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr "Įvyko klaida įkeliant paketų sąrašą iš failo%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
|
|
msgid "Error reading project info file %s%s%s%s%s"
|
|
msgstr "Įvyko klaida įkeliant informacijos apie projektą failą %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Nepavyko pervardyti failą"
|
|
|
|
#: lazarusidestrconsts:liserrorsavingto
|
|
msgid "Error saving %s to%s%s%s%s"
|
|
msgstr "Įvyko klaida %s rašant į%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
|
|
msgid "Error while writing %s%s%s%s%s"
|
|
msgstr "Įvyko klaida rašant %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
|
|
msgid "Error while writing project info file %s%s%s%s%s"
|
|
msgstr "Įvyko klaida rašant į informacijos apie projektą failą %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lislazbuilderrorwritingfile
|
|
msgid "Error writing file"
|
|
msgstr "Klaida rašant į failą"
|
|
|
|
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr "Įvyko klaida rašant paketo sąrašą į failą%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liserror
|
|
msgid "Error: "
|
|
msgstr "Klaida: "
|
|
|
|
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Klaida: klaidingas kompiliatorius: %s"
|
|
|
|
#: lazarusidestrconsts:liserrors
|
|
msgid "Errors"
|
|
msgstr "Klaidos"
|
|
|
|
#: lazarusidestrconsts:srvk_escape
|
|
msgid "Escape"
|
|
msgstr "Esc"
|
|
|
|
#: lazarusidestrconsts:liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr "Įvertinti/Modifikuoti"
|
|
|
|
#: lazarusidestrconsts:lismenuevaluate
|
|
msgid "Evaluate/Modify ..."
|
|
msgstr "Įvertinti/Modifikuoti..."
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
|
|
msgid "Event Log"
|
|
msgstr "Įvykių žurnalas"
|
|
|
|
#: lazarusidestrconsts:liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Pavyzdys"
|
|
|
|
#: lazarusidestrconsts:lisexamples
|
|
msgid "Examples"
|
|
msgstr "Pavyzdžiai"
|
|
|
|
#: lazarusidestrconsts:lisexcludefilter
|
|
msgid "Exclude Filter"
|
|
msgstr "Neįtraukimo filtras"
|
|
|
|
#: lazarusidestrconsts:srvk_execute
|
|
msgid "Execute"
|
|
msgstr "Vykdyti"
|
|
|
|
#: lazarusidestrconsts:liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Startuoti po"
|
|
|
|
#: lazarusidestrconsts:liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Startuoti prieš"
|
|
|
|
#: lazarusidestrconsts:lisexecutingcommandafter
|
|
msgid "Executing command after"
|
|
msgstr "Startuojama komanda po"
|
|
|
|
#: lazarusidestrconsts:lisexecutingcommandbefore
|
|
msgid "Executing command before"
|
|
msgstr "Startuojama komanda prieš"
|
|
|
|
#: lazarusidestrconsts:lisexecutionpaused
|
|
msgid "Execution paused"
|
|
msgstr "Veika pristabdyta"
|
|
|
|
#: lazarusidestrconsts:lisexecutionpausedadress
|
|
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
|
msgstr "Veika pristabdyta%s Adresas: $%s%s Procedūra: %s%s Failas: %s%s(Tarp kitko, kadanors čia turėtų pasirodyti asemblerio langas :)%s"
|
|
|
|
#: lazarusidestrconsts:lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Veika sustabdyta"
|
|
|
|
#: lazarusidestrconsts:lisexecutionstoppedon
|
|
msgid "Execution stopped%s"
|
|
msgstr "Veika sustabdyta%s"
|
|
|
|
#: lazarusidestrconsts:lispldexists
|
|
msgid "Exists"
|
|
msgstr "Egzistuoja"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsexit
|
|
msgid "Exit"
|
|
msgstr "Išeiti"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
|
|
msgid "Exit without Save"
|
|
msgstr "Išeiti neišsaugojus"
|
|
|
|
#: lazarusidestrconsts:lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr "Išskleisti visas klases"
|
|
|
|
#: lazarusidestrconsts:lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr "Išsklaeisti visus paketus"
|
|
|
|
#: lazarusidestrconsts:lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr "Išskleiti visus modulius"
|
|
|
|
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Veikiamojo redaktoriaus failo vardas su pilnu keliu iki jo"
|
|
|
|
#: lazarusidestrconsts:lisexport
|
|
msgid "Export ..."
|
|
msgstr "Eksportas..."
|
|
|
|
#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr "Eksportuojamas failas %s%s%s jau yra.%sAtverti failą ir jame įrašyti tik kompiliatoriaus parinktis?%s(Kitos faile esančios nuostatos lik tokios pačios.)"
|
|
|
|
#: lazarusidestrconsts:lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr "Eksportuojamas failas egzistuoja"
|
|
|
|
#: lazarusidestrconsts:lisexportlist
|
|
msgid "Export list"
|
|
msgstr "Eksportuoti sąrašą"
|
|
|
|
#: lazarusidestrconsts:liswlexpression
|
|
msgid "Expression"
|
|
msgstr "Išraiška"
|
|
|
|
#: lazarusidestrconsts:lisexpression
|
|
msgid "Expression:"
|
|
msgstr "Išraiška:"
|
|
|
|
#: lazarusidestrconsts:lisextendunitpath
|
|
msgid "Extend unit path?"
|
|
msgstr "Išplėsti modulių kelią?"
|
|
|
|
#: lazarusidestrconsts:liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr "Išorinių įrankių nuostatos"
|
|
|
|
#: lazarusidestrconsts:srkmecexttool
|
|
msgid "External tool %d"
|
|
msgstr "Išorės įrankis %d"
|
|
|
|
#: lazarusidestrconsts:lisexttoolexternaltools
|
|
msgid "External tools"
|
|
msgstr "Išorės įrankiai"
|
|
|
|
#: lazarusidestrconsts:srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Išorės įrankių nuostatos"
|
|
|
|
#: lazarusidestrconsts:dlgextralinespacing
|
|
msgid "Extra line spacing"
|
|
msgstr "Papildomas tarpas tarp eilučių"
|
|
|
|
#: lazarusidestrconsts:lisextract
|
|
msgid "Extract"
|
|
msgstr "Ištraukti"
|
|
|
|
#: lazarusidestrconsts:uemextractproc
|
|
msgid "Extract Procedure"
|
|
msgstr "Ištraukti procedūrą"
|
|
|
|
#: lazarusidestrconsts:srkmecextractproc
|
|
msgid "Extract procedure"
|
|
msgstr "Ištraukti procedūrą"
|
|
|
|
#: lazarusidestrconsts:lismenuextractproc
|
|
msgid "Extract procedure ..."
|
|
msgstr "Ištraukti procedūrą..."
|
|
|
|
#: lazarusidestrconsts:lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "FPC Doc HTML kelias"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
|
|
msgid "FPC SVN source directory"
|
|
msgstr "FPC SVN pirminio kodo katalogas"
|
|
|
|
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
|
|
msgid "FPC Source Directory error"
|
|
msgstr "FPC pirminio kodo katalogo klaida"
|
|
|
|
#: lazarusidestrconsts:dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "FPC pirminio kodo katalogas"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
|
|
msgid "FPC source directory \"%s\" not found."
|
|
msgstr "Nerastas FPC pirminio kodo katalogas \"%s\"."
|
|
|
|
#: lazarusidestrconsts:lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr "FPC modulių kataloge yra pirminio kodo failas:"
|
|
|
|
#: lazarusidestrconsts:lismenufpdoceditor
|
|
msgid "FPDoc Editor"
|
|
msgstr "FPDoc redaktorius"
|
|
|
|
#: lazarusidestrconsts:lisfpdoceditor
|
|
msgid "FPDoc editor"
|
|
msgstr "FPDoc redaktorius"
|
|
|
|
#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
|
|
msgid "FPDoc files path"
|
|
msgstr "FPDoc failų kelias"
|
|
|
|
#: lazarusidestrconsts:lisexttoolfailedtoruntool
|
|
msgid "Failed to run tool"
|
|
msgstr "Nepavyko startuoti įrankį"
|
|
|
|
#: lazarusidestrconsts:dlgcofast
|
|
msgid "Faster Code"
|
|
msgstr "Greitesnį kodą"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatefile
|
|
msgid "File"
|
|
msgstr "Failas"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
|
|
msgid "File %s%s%s already exists in the project."
|
|
msgstr "Failas %s%s%s projekte jau yra."
|
|
|
|
#: lazarusidestrconsts:lisfilehaschangedsave
|
|
msgid "File %s%s%s has changed. Save?"
|
|
msgstr "Failas %s%s%s pakeistas. Įrašyti?"
|
|
|
|
#: lazarusidestrconsts:lisfileisvirtual
|
|
msgid "File %s%s%s is virtual."
|
|
msgstr "Failas %s%s%s yra virtualus."
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenotfound
|
|
msgid "File %s%s%s not found."
|
|
msgstr "Failas %s%s%s nerastas."
|
|
|
|
#: lazarusidestrconsts:lisfilenotfound2
|
|
msgid "File %s%s%s not found.%s"
|
|
msgstr "Failas %s%s%s nerastas.%s"
|
|
|
|
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
|
|
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
|
msgstr "Failas %s%s%s nerastas.%sJį sukurti?%s"
|
|
|
|
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
|
|
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr "Nepanašu kad failas %s%s%s%s yra teksto failas.%sVistiek jį atverti?"
|
|
|
|
#: lazarusidestrconsts:lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Failo savybės"
|
|
|
|
#: lazarusidestrconsts:lisfilesettings
|
|
msgid "File Settings ..."
|
|
msgstr "Failo nuostatos..."
|
|
|
|
#: lazarusidestrconsts:lisaf2pfiletype
|
|
msgid "File Type"
|
|
msgstr "Failo tipas"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "Failas jau egzistuoja"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
|
|
msgid "File already in package"
|
|
msgstr "Pakete jau yra toks failas"
|
|
|
|
#: lazarusidestrconsts:dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Failų prievardžiai"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "Pakete yra toks failas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "Projekto failas"
|
|
|
|
#: lazarusidestrconsts:lisfileisnotwritable
|
|
msgid "File is not writable"
|
|
msgstr "Failas tik skaitymui"
|
|
|
|
#: lazarusidestrconsts:uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "Failas tik skaitymui"
|
|
|
|
#: lazarusidestrconsts:lisfileissymlink
|
|
msgid "File is symlink"
|
|
msgstr "Failas yra simbolinė nuoroda"
|
|
|
|
#: lazarusidestrconsts:lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "Failas jau naudojamas"
|
|
|
|
#: lazarusidestrconsts:lisfilelinkerror
|
|
msgid "File link error"
|
|
msgstr "Klaidinga failo nuoroda"
|
|
|
|
#: lazarusidestrconsts:lisfindfilefilemaskbak
|
|
msgid "File mask (*;*.*;*.bak?)"
|
|
msgstr "Failų vardų kaukė (*;*.*;*.bak?)"
|
|
|
|
#: lazarusidestrconsts:srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Meniu \"Failas\" komandos"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilename
|
|
msgid "File name:"
|
|
msgstr "Failo vardas:"
|
|
|
|
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "Failas nėra vykdomasis"
|
|
|
|
#: lazarusidestrconsts:lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "Failas nerastas"
|
|
|
|
#: lazarusidestrconsts:lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "Failo vardas ne mažosiomis raidėmis"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "Failas neišsaugotas"
|
|
|
|
#: lazarusidestrconsts:lisfilenottext
|
|
msgid "File not text"
|
|
msgstr "Neteksto failas"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "Failas nėra modulis"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilename2
|
|
msgid "Filename"
|
|
msgstr "Failo vardas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Failo ir paketo vardai skiriasi"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Failo vardą naudoja kitas paketas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Failo vardą naudoja projektas"
|
|
|
|
#: lazarusidestrconsts:lisfilenameaddress
|
|
msgid "Filename/Address"
|
|
msgstr "Failo pavadinimas/Adresas"
|
|
|
|
#: lazarusidestrconsts:lispefilename
|
|
msgid "Filename:"
|
|
msgstr "Failo vardas:"
|
|
|
|
#: lazarusidestrconsts:lisoipfilename
|
|
msgid "Filename: %s"
|
|
msgstr "Failo vardas: %s"
|
|
|
|
#: lazarusidestrconsts:dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "Failai"
|
|
|
|
#: lazarusidestrconsts:lisfilter
|
|
msgid "Filter"
|
|
msgstr "Filtras"
|
|
|
|
#: lazarusidestrconsts:lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr "Filtruoti pagal bet kurią metodo dalį"
|
|
|
|
#: lazarusidestrconsts:lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr "Filtruoti pagal metodo pradžią"
|
|
|
|
#: lazarusidestrconsts:srvk_final
|
|
msgid "Final"
|
|
msgstr "Final"
|
|
|
|
#: lazarusidestrconsts:lismenufind
|
|
msgid "Find"
|
|
msgstr "Paieška"
|
|
|
|
#: lazarusidestrconsts:lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "Ieškoti &toliau"
|
|
|
|
#: lazarusidestrconsts:lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "Ieškoti an&kstesnio"
|
|
|
|
#: lazarusidestrconsts:lismenufindinfiles
|
|
msgid "Find &in files ..."
|
|
msgstr "Ieškoti &failuose..."
|
|
|
|
#: lazarusidestrconsts:lismenufinddeclarationatcursor
|
|
msgid "Find Declaration at cursor"
|
|
msgstr "Ieškoti ties žymekliu nurodytojo paskelbimo"
|
|
|
|
#: lazarusidestrconsts:uemfindidentifierreferences
|
|
msgid "Find Identifier References"
|
|
msgstr "Ieškoti identifikatoriaus įrašų"
|
|
|
|
#: lazarusidestrconsts:lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Ieškoti identifikatoriaus įrašų..."
|
|
|
|
#: lazarusidestrconsts:lismenutemplatefindnext
|
|
msgid "Find Next"
|
|
msgstr "Ieškoti toliau"
|
|
|
|
#: lazarusidestrconsts:lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Ieškoti įrašų"
|
|
|
|
#: lazarusidestrconsts:srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Ieškoti bloko kito galo"
|
|
|
|
#: lazarusidestrconsts:srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Ieškoti bloko pradžios"
|
|
|
|
#: lazarusidestrconsts:lismenufindcodeblockstart
|
|
msgid "Find code block start"
|
|
msgstr "Ieškoti kodo bloko pradžios"
|
|
|
|
#: lazarusidestrconsts:liscomppalfindcomponent
|
|
msgid "Find component"
|
|
msgstr "Ieškoti komponentės"
|
|
|
|
#: lazarusidestrconsts:srkmecfinddeclaration
|
|
msgid "Find declaration"
|
|
msgstr "Ieškoti paskelbimo"
|
|
|
|
#: lazarusidestrconsts:srkmecfindidentifierrefs
|
|
msgid "Find identifier references"
|
|
msgstr "Ieškoti identifikatoriaus įrašų"
|
|
|
|
#: lazarusidestrconsts:srkmecfindinfiles
|
|
msgid "Find in files"
|
|
msgstr "Ieškoti failuose"
|
|
|
|
#: lazarusidestrconsts:liskmfindincremental
|
|
msgid "Find incremental"
|
|
msgstr "Prieauginė paieška"
|
|
|
|
#: lazarusidestrconsts:srkmecfindnext
|
|
msgid "Find next"
|
|
msgstr "Ieškoti toliau"
|
|
|
|
#: lazarusidestrconsts:srkmecfindnextwordoccurrence
|
|
msgid "Find next word occurrence"
|
|
msgstr "Ieškoti žodžio toliau"
|
|
|
|
#: lazarusidestrconsts:lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Ieškoti identifikatoriaus arba jį pervardyti"
|
|
|
|
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
|
|
msgid "Find other end of code block"
|
|
msgstr "Ieškoti kodo bloko kitos pabaigos"
|
|
|
|
#: lazarusidestrconsts:lisfpfindpalettecomponent
|
|
msgid "Find palette component"
|
|
msgstr "Ieškoti komponentės paletėje"
|
|
|
|
#: lazarusidestrconsts:srkmecfindprevious
|
|
msgid "Find previous"
|
|
msgstr "Ieškoti ankstesnio"
|
|
|
|
#: lazarusidestrconsts:srkmecfindprevwordoccurrence
|
|
msgid "Find previous word occurrence"
|
|
msgstr "Ieškoti žodžio atgaline tvarka"
|
|
|
|
#: lazarusidestrconsts:srkmecfindproceduredefinition
|
|
msgid "Find procedure definiton"
|
|
msgstr "Ieškoti procedūros apibrėžties"
|
|
|
|
#: lazarusidestrconsts:srkmecfindproceduremethod
|
|
msgid "Find procedure method"
|
|
msgstr "Ieškoti procedūros metodo"
|
|
|
|
#: lazarusidestrconsts:srkmecfind
|
|
msgid "Find text"
|
|
msgstr "Ieškoti teksto"
|
|
|
|
#: lazarusidestrconsts:dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Ieškoti ties žymekliu esančio teksto"
|
|
|
|
#: lazarusidestrconsts:rslanguagefinnish
|
|
msgid "Finnish"
|
|
msgstr "Suomių"
|
|
|
|
#: lazarusidestrconsts:lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr "Taisyti failų vardų raidžių lygius"
|
|
|
|
#: lazarusidestrconsts:lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr "LFM failo taisa"
|
|
|
|
#: lazarusidestrconsts:lisfloatingpoin
|
|
msgid "Floating Point"
|
|
msgstr "Slankaus kablelio"
|
|
|
|
#: lazarusidestrconsts:srkmecjumptoeditor
|
|
msgid "Focus to source editor"
|
|
msgstr "Aktyvuoti pirminio kodo redaktorių"
|
|
|
|
#: lazarusidestrconsts:liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr "Sekti žymeklį"
|
|
|
|
#: lazarusidestrconsts:lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Ne UTF-8 šriftas"
|
|
|
|
#: lazarusidestrconsts:lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr "Vistiek pervardyti"
|
|
|
|
#: lazarusidestrconsts:dlgforecolor
|
|
msgid "Foreground color"
|
|
msgstr "Priekinė spalva"
|
|
|
|
#: lazarusidestrconsts:dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Formų konstruktorius"
|
|
|
|
#: lazarusidestrconsts:rsformdatafiledfm
|
|
msgid "Form data file (*.dfm)|*.dfm"
|
|
msgstr "Formos duomenų failas (*.dfm)|*.dfm"
|
|
|
|
#: lazarusidestrconsts:lisformloaderror
|
|
msgid "Form load error"
|
|
msgstr "Klaida įkeliant formą"
|
|
|
|
#: lazarusidestrconsts:lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Formato klaida"
|
|
|
|
#: lazarusidestrconsts:dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Formos"
|
|
|
|
#: lazarusidestrconsts:lismenuviewforms
|
|
msgid "Forms..."
|
|
msgstr "Formos..."
|
|
|
|
#: lazarusidestrconsts:lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr "Ieškoti p&irmyn"
|
|
|
|
#: lazarusidestrconsts:lisvsrforwardsearch
|
|
msgid "Forward Search"
|
|
msgstr "Ieškoti pirmyn"
|
|
|
|
#: lazarusidestrconsts:fdmorderforwardone
|
|
msgid "Forward one"
|
|
msgstr "Vienu pirmyn"
|
|
|
|
#: lazarusidestrconsts:lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfreepascalcompilernotfound
|
|
msgid "Free Pascal Compiler not found"
|
|
msgstr "Nerastas FreePascal kompiliatorius"
|
|
|
|
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
|
|
msgid "Free Pascal Sources not found"
|
|
msgstr "Nerasti FreePascal pirminiai kodai"
|
|
|
|
#: lazarusidestrconsts:lisfreepascalsourcefile
|
|
msgid "FreePascal source file"
|
|
msgstr "FreePascal pirminio kodo failas"
|
|
|
|
#: lazarusidestrconsts:lisfreepascalsourcedirectory
|
|
msgid "Freepascal source directory"
|
|
msgstr "FreePascal pirminio kodo katalogas"
|
|
|
|
#: lazarusidestrconsts:rslanguagefrench
|
|
msgid "French"
|
|
msgstr "Prancūzų"
|
|
|
|
#: lazarusidestrconsts:lisfunction
|
|
msgid "Function"
|
|
msgstr "Funkcija"
|
|
|
|
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
|
|
msgid "Function: append path delimiter"
|
|
msgstr "Funkcija: kelio gale pridėti kelio skirtuką"
|
|
|
|
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
|
|
msgid "Function: chomp path delimiter"
|
|
msgstr "Funkcija: pašalinti kelio gale esantį skirtuką"
|
|
|
|
#: lazarusidestrconsts:listmfunctionextractfileextension
|
|
msgid "Function: extract file extension"
|
|
msgstr "Funkcija: ištraukti tik failo prievardį"
|
|
|
|
#: lazarusidestrconsts:listmfunctionextractfilenameonly
|
|
msgid "Function: extract file name only"
|
|
msgstr "Funkcija: ištraukti tik failo vardą"
|
|
|
|
#: lazarusidestrconsts:listmfunctionextractfilenameextension
|
|
msgid "Function: extract file name+extension"
|
|
msgstr "Funkcija: ištraukti failo vardą ir prievardį"
|
|
|
|
#: lazarusidestrconsts:listmfunctionextractfilepath
|
|
msgid "Function: extract file path"
|
|
msgstr "Funkcija: ištraukti tik kelią"
|
|
|
|
#: lazarusidestrconsts:dlggpccomp
|
|
msgid "GPC (GNU Pascal Compiler) Compatible"
|
|
msgstr "Suderinamumas su GPC (GNU Pascal Compiler)"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertgplnotice
|
|
msgid "GPL notice"
|
|
msgstr "GPL raštas"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertgeneral
|
|
msgid "General"
|
|
msgstr "Pagrindinis"
|
|
|
|
#: lazarusidestrconsts:lispckeditgeneraloptions
|
|
msgid "General Options"
|
|
msgstr "Pagrindinės parinktys"
|
|
|
|
#: lazarusidestrconsts:srkmecenvironmentoptions
|
|
msgid "General environment options"
|
|
msgstr "Pagrindinės aplinkos parinktys"
|
|
|
|
#: lazarusidestrconsts:dlgcodbx
|
|
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
|
msgstr "Kurti \"DBX\" skirtą derinimo informaciją (sulėtins kompiliavimą)"
|
|
|
|
#: lazarusidestrconsts:dlgcogdb
|
|
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
|
msgstr "Kurti \"GDB\" skirtą derinimo informaciją (sulėtins kompiliavimą)"
|
|
|
|
#: lazarusidestrconsts:dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Kurti \"gprof\" skirtą kodą"
|
|
|
|
#: lazarusidestrconsts:dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Kurti \"valgrind\" skirtą kodą"
|
|
|
|
#: lazarusidestrconsts:dlgcogenerate
|
|
msgid "Generate:"
|
|
msgstr "Generuoti:"
|
|
|
|
#: lazarusidestrconsts:rslanguagegerman
|
|
msgid "German"
|
|
msgstr "Vokiečių"
|
|
|
|
#: lazarusidestrconsts:dlggetposition
|
|
msgid "Get position"
|
|
msgstr "Sužinoti poziciją"
|
|
|
|
#: lazarusidestrconsts:lispldglobal
|
|
msgid "Global"
|
|
msgstr "Globalus"
|
|
|
|
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
|
|
msgid "Global Source Path addition"
|
|
msgstr "Priedas prie pradinio kodo globalaus katalogo"
|
|
|
|
#: lazarusidestrconsts:srkmecgotomarker
|
|
msgid "Go to Marker %d"
|
|
msgstr "Rodyti žymeklį %d"
|
|
|
|
#: lazarusidestrconsts:srkmecgotoeditor
|
|
msgid "Go to editor %d"
|
|
msgstr "Rodyti %s redaktorių"
|
|
|
|
#: lazarusidestrconsts:srkmecgotolinenumber
|
|
msgid "Go to line number"
|
|
msgstr "Rodyti eilutę nurodytu numeriu"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker0
|
|
msgid "Go to marker 0"
|
|
msgstr "Rodyti žymeklį 0"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker1
|
|
msgid "Go to marker 1"
|
|
msgstr "Rodyti žymeklį 1"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker2
|
|
msgid "Go to marker 2"
|
|
msgstr "Rodyti žymeklį 2"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker3
|
|
msgid "Go to marker 3"
|
|
msgstr "Rodyti žymeklį 3"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker4
|
|
msgid "Go to marker 4"
|
|
msgstr "Rodyti žymeklį 4"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker5
|
|
msgid "Go to marker 5"
|
|
msgstr "Rodyti žymeklį 5"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker6
|
|
msgid "Go to marker 6"
|
|
msgstr "Rodyti žymeklį 6"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker7
|
|
msgid "Go to marker 7"
|
|
msgstr "Rodyti žymeklį 7"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker8
|
|
msgid "Go to marker 8"
|
|
msgstr "Rodyti žymeklį 8"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker9
|
|
msgid "Go to marker 9"
|
|
msgstr "Rodyti žymeklį 9"
|
|
|
|
#: lazarusidestrconsts:srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Eiti prie skliausto porininko"
|
|
|
|
#: lazarusidestrconsts:srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Eiti į tolesnį redaktorių"
|
|
|
|
#: lazarusidestrconsts:srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Eiti į ankstesni redaktorių"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor1
|
|
msgid "Go to source editor 1"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 1 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor10
|
|
msgid "Go to source editor 10"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 10 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor2
|
|
msgid "Go to source editor 2"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 2 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor3
|
|
msgid "Go to source editor 3"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 3 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor4
|
|
msgid "Go to source editor 4"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 4 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor5
|
|
msgid "Go to source editor 5"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 5 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor6
|
|
msgid "Go to source editor 6"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 6 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor7
|
|
msgid "Go to source editor 7"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 7 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor8
|
|
msgid "Go to source editor 8"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 8 kortelę"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor9
|
|
msgid "Go to source editor 9"
|
|
msgstr "Rodyti pirminio kodo redaktoriaus 9 kortelę"
|
|
|
|
#: lazarusidestrconsts:srkmecgotoincludedirective
|
|
msgid "Go to to include directive of current include file"
|
|
msgstr "Rodyti veikiamojo įdėtojo failo įdėjimo direktyvą"
|
|
|
|
#: lazarusidestrconsts:listodogoto
|
|
msgid "Goto"
|
|
msgstr "Rodyk kur"
|
|
|
|
#: lazarusidestrconsts:srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Eiti į poziciją"
|
|
|
|
#: lazarusidestrconsts:lismenugotoincludedirective
|
|
msgid "Goto include directive"
|
|
msgstr "Rodyti įterpimo direktyvą"
|
|
|
|
#: lazarusidestrconsts:lismenugotoline
|
|
msgid "Goto line ..."
|
|
msgstr "Rodyti eilutę..."
|
|
|
|
#: lazarusidestrconsts:lisuegotoline
|
|
msgid "Goto line :"
|
|
msgstr "Rodyti eilutę:"
|
|
|
|
#: lazarusidestrconsts:uemnextbookmark
|
|
msgid "Goto next Bookmark"
|
|
msgstr "Rodyti tolesnę žymę"
|
|
|
|
#: lazarusidestrconsts:uemprevbookmark
|
|
msgid "Goto previous Bookmark"
|
|
msgstr "Rodyti ankstesnę žymę"
|
|
|
|
#: lazarusidestrconsts:listodolistgotoline
|
|
msgid "Goto selected source line"
|
|
msgstr "Rodyti eilutę pirminiame kode"
|
|
|
|
#: lazarusidestrconsts:srkmgrabkey
|
|
msgid "Grab key"
|
|
msgstr "Susekti klavišą"
|
|
|
|
#: lazarusidestrconsts:srkmgrabsecondkey
|
|
msgid "Grab second key"
|
|
msgstr "Susekti kitą klavišą"
|
|
|
|
#: lazarusidestrconsts:dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Rankenėlės spalva"
|
|
|
|
#: lazarusidestrconsts:dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Tinklelis"
|
|
|
|
#: lazarusidestrconsts:dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Tinklelio spalva"
|
|
|
|
#: lazarusidestrconsts:dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Tinklelio tarpai X"
|
|
|
|
#: lazarusidestrconsts:dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Tinklelio tarpai Y"
|
|
|
|
#: lazarusidestrconsts:lisgroup
|
|
msgid "Group"
|
|
msgstr "Grupė"
|
|
|
|
#: lazarusidestrconsts:dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr "Grupinis grąžinimas"
|
|
|
|
#: lazarusidestrconsts:lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr "Išplėsti iki didžiausio"
|
|
|
|
#: lazarusidestrconsts:srkmecguessmisplacedifdef
|
|
msgid "Guess misplaced $IFDEF"
|
|
msgstr "Nuspėti nevietoj esančius $IFDEF"
|
|
|
|
#: lazarusidestrconsts:lismenuguessmisplacedifdef
|
|
msgid "Guess misplaced IFDEF/ENDIF"
|
|
msgstr "Nuspėti nevietoj esančius $IFDEF/$ENDIF"
|
|
|
|
#: lazarusidestrconsts:lismenuguessunclosedblock
|
|
msgid "Guess unclosed block"
|
|
msgstr "Nuspėti neužbaigtus blokus"
|
|
|
|
#: lazarusidestrconsts:dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Pagalbinės linijos"
|
|
|
|
#: lazarusidestrconsts:dlgguttercolor
|
|
msgid "Gutter color"
|
|
msgstr "Kairiosios paraštės spalva"
|
|
|
|
#: lazarusidestrconsts:dlggutterwidth
|
|
msgid "Gutter width"
|
|
msgstr "Kairiosios paraštės plotis"
|
|
|
|
#: lazarusidestrconsts:lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr "Užuomina: "
|
|
|
|
#: lazarusidestrconsts:dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Slinkti tik per puse lapo"
|
|
|
|
#: lazarusidestrconsts:lismenueditorhandleonclickevent
|
|
msgid "Handle OnClick Event"
|
|
msgstr "Apdoroti OnClick įvykį"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr "Apdoroja"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr "Apdoroja derintuvė"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr "Apdoroja programa"
|
|
|
|
#: lazarusidestrconsts:srvk_hanja
|
|
msgid "Hanja"
|
|
msgstr "Hanja"
|
|
|
|
#: lazarusidestrconsts:lisaf2phasregisterprocedure
|
|
msgid "Has Register procedure"
|
|
msgstr "Turi procedūra Register"
|
|
|
|
#: lazarusidestrconsts:lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Antraštinis komentaras klasei"
|
|
|
|
#: lazarusidestrconsts:dlgheapsize
|
|
msgid "Heap Size"
|
|
msgstr "Krūvos dydis"
|
|
|
|
#: lazarusidestrconsts:rslanguagehebrew
|
|
msgid "Hebrew"
|
|
msgstr "Žydų"
|
|
|
|
#: lazarusidestrconsts:dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Aukštis:"
|
|
|
|
#: lazarusidestrconsts:srvk_help
|
|
msgid "Help"
|
|
msgstr "Help"
|
|
|
|
#: lazarusidestrconsts:lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Žinyno parinktys"
|
|
|
|
#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
|
|
msgid "Help for FreePascal Compiler message"
|
|
msgstr "Informacija apie FreePascal Compiler pranešimą"
|
|
|
|
#: lazarusidestrconsts:srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Meniu \"Žinynas\" komandos"
|
|
|
|
#: lazarusidestrconsts:lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr "Žinyno parinktys"
|
|
|
|
#: lazarusidestrconsts:lishexadecimal
|
|
msgid "Hexadecimal"
|
|
msgstr "Šešioliktainis"
|
|
|
|
#: lazarusidestrconsts:dlghideideonrun
|
|
msgid "Hide IDE windows on run"
|
|
msgstr "Startuojant programą slėpti IKA langus"
|
|
|
|
#: lazarusidestrconsts:uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr "Sintaksės paryškinimas"
|
|
|
|
#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr "Užuomina: Tikrinti ar du paketai turi modulius tuo pačiu vardu."
|
|
|
|
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
|
msgstr "Užuomina: funkcijai \"Kurti resursų eilutę\" reikia eilutės konstantos.%sPažymėkite tik eilutės reiškinį ir bandykite vėl."
|
|
|
|
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr "Funkcijai \"Kurti išteklių eilutę\" reikia pažymėtos teksto konstantos.%sTad pažymėkite išraišką ir bandykite vėl."
|
|
|
|
#: lazarusidestrconsts:dlgedhintcommand
|
|
msgid "Hint: click on the command you want to edit"
|
|
msgstr "Užuomina: spustelkite kairį pelės mygtuką ant komandos, kurią norite keisti"
|
|
|
|
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
|
|
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
|
msgstr "Užuomina: kompiliatoriaus programą galite nurodyti \"Aplinka -> Aplinkos parinktys -> Failai -> Kompiliatoriaus programa\"."
|
|
|
|
#: lazarusidestrconsts:dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Sufleriai komponenčių paletei"
|
|
|
|
#: lazarusidestrconsts:dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Sufleriai pagrindiniams spartos mygtukams (\"Atverti\", \"Įrašyti\", ...)"
|
|
|
|
#: lazarusidestrconsts:srvk_home
|
|
msgid "Home"
|
|
msgstr "Home"
|
|
|
|
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Spustelėjus \"Home\", žymeklis peršoks į artimiausią pradžią"
|
|
|
|
#: lazarusidestrconsts:lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Horizontaliai"
|
|
|
|
#: lazarusidestrconsts:dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Horizontalūs tarpai tarp tinklelio taškų"
|
|
|
|
#: lazarusidestrconsts:dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Programa-šeimininkė"
|
|
|
|
#: lazarusidestrconsts:uenotimplcapagain
|
|
msgid "I told You: Not implemented yet"
|
|
msgstr "Aš tau sakau: dar neįgyvendinta."
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmid
|
|
msgid "ID"
|
|
msgstr "ID"
|
|
|
|
#: lazarusidestrconsts:liside
|
|
msgid "IDE"
|
|
msgstr "IKA"
|
|
|
|
#: lazarusidestrconsts:lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "IKA dalis"
|
|
|
|
#: lazarusidestrconsts:lisideintf
|
|
msgid "IDE Interface"
|
|
msgstr "IKA interfeisas"
|
|
|
|
#: lazarusidestrconsts:lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "IKA parinktys:"
|
|
|
|
#: lazarusidestrconsts:lismenuideinternals
|
|
msgid "IDE internals"
|
|
msgstr "IKA ypatybės"
|
|
|
|
#: lazarusidestrconsts:lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr "IKA užsiėmęs"
|
|
|
|
#: lazarusidestrconsts:uepins
|
|
msgid "INS"
|
|
msgstr "ĮTERPTI"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsidentifier
|
|
msgid "Identifier"
|
|
msgstr "Identifikatorius"
|
|
|
|
#: lazarusidestrconsts:lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr "Identifikatorius prasideda..."
|
|
|
|
#: lazarusidestrconsts:dlgedidcomlet
|
|
msgid "Identifier completion"
|
|
msgstr "Identifikatoriaus užbaigimas"
|
|
|
|
#: lazarusidestrconsts:lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr "Identifikatoriuje yra..."
|
|
|
|
#: lazarusidestrconsts:lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Identifikatoriaus ilgis:"
|
|
|
|
#: lazarusidestrconsts:dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Identifikatoriaus politika"
|
|
|
|
#: lazarusidestrconsts:lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr "Identifikatoriaus prefiksas:"
|
|
|
|
#: lazarusidestrconsts:lisfriidentifier
|
|
msgid "Identifier: %s"
|
|
msgstr "Identifikatorius: %s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr "If"
|
|
|
|
#: lazarusidestrconsts:uenotimpltext
|
|
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
|
msgstr "Jei jūs galite mums padėti įgyvendinti šią ypatybę, tada rašykite į lazarus@miraclec.com"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsifdef
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr "IfNDef"
|
|
|
|
#: lazarusidestrconsts:dlgignoreverb
|
|
msgid "Ignore"
|
|
msgstr "Ignoruoti"
|
|
|
|
#: lazarusidestrconsts:lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Tarpai nesvarbūs"
|
|
|
|
#: lazarusidestrconsts:lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr "Visada ignoruoti"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Nepaisyti tam tikro tarpo simbolių kiekio"
|
|
|
|
#: lazarusidestrconsts:lisignoreandcontinue
|
|
msgid "Ignore and continue"
|
|
msgstr "Nepaisyti ir tęsti"
|
|
|
|
#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
|
|
msgid "Ignore and save package now"
|
|
msgstr "Ignoruoti ir projektą įrašyti dabar"
|
|
|
|
#: lazarusidestrconsts:lisignorebinaries
|
|
msgid "Ignore binaries"
|
|
msgstr "Praleisti dvejetainius failus"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Nepaisyti naujos eilutės tipų (pvz.: #10 = #13#10)"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
|
|
msgid "Ignore disk changes"
|
|
msgstr "Ignoruoti pasikeitimus diske"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Nepaisyti įdėtų ar pašalintų tuščių eilučių"
|
|
|
|
#: lazarusidestrconsts:lisignoremissingfile
|
|
msgid "Ignore missing file"
|
|
msgstr "Praleisti trūkstamą failą"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Nepaisyti tarpo simbolių (neskaitant naujos eilutės simbolių)"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Nepaisyti tarpo simbolių eilutės gale"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Nepaisyti tarpo simbolių eilutės pradžioje"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Ignoruoti šias išimtines situacijas"
|
|
|
|
#: lazarusidestrconsts:lisignoreusetformasancestor
|
|
msgid "Ignore, use TForm as ancestor"
|
|
msgstr "Ignoruoti, TForm naudoti kaip protėvį."
|
|
|
|
#: lazarusidestrconsts:srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr "IME eilutė"
|
|
|
|
#: lazarusidestrconsts:lisimportlist
|
|
msgid "Import list"
|
|
msgstr "Importuoti sąrašą"
|
|
|
|
#: lazarusidestrconsts:dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Priešais metodus"
|
|
|
|
#: lazarusidestrconsts:lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr "Įtraukti"
|
|
|
|
#: lazarusidestrconsts:dlgassertcode
|
|
msgid "Include Assertion Code"
|
|
msgstr "Įterpti \"Assertion\" kodą"
|
|
|
|
#: lazarusidestrconsts:dlgcoincfiles
|
|
msgid "Include Files (-Fi):"
|
|
msgstr "Įterpiami failai (-Fi):"
|
|
|
|
#: lazarusidestrconsts:lisincludefilter
|
|
msgid "Include Filter"
|
|
msgstr "Įterpimo filtras"
|
|
|
|
#: lazarusidestrconsts:rsincludeversioninfoinexecutable
|
|
msgid "Include Version Info in executable"
|
|
msgstr "Įrašyti versijos informaciją į vykdomąjį failą"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypeinclude
|
|
msgid "Include file"
|
|
msgstr "Įtraukiamasis"
|
|
|
|
#: lazarusidestrconsts:lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr "Įterpimo keliai"
|
|
|
|
#: lazarusidestrconsts:lisfindfileincludesubdirectories
|
|
msgid "Include sub directories"
|
|
msgstr "Ir pakatologiuose"
|
|
|
|
#: lazarusidestrconsts:dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Pridėti sistemos kintamuosius"
|
|
|
|
#: lazarusidestrconsts:lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Jį įtraukia:"
|
|
|
|
#: lazarusidestrconsts:lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Prieauginė paieška"
|
|
|
|
#: lazarusidestrconsts:srkmecblockindent
|
|
msgid "Indent block"
|
|
msgstr "Suteikti blokui įtrauką"
|
|
|
|
#: lazarusidestrconsts:dlgindentcodeto
|
|
msgid "Indent code to"
|
|
msgstr "Įtraukti kodą pagal"
|
|
|
|
#: lazarusidestrconsts:lismenuindentselection
|
|
msgid "Indent selection"
|
|
msgstr "Suteikti įtrauką pažymėjime"
|
|
|
|
#: lazarusidestrconsts:lisindex
|
|
msgid "Index"
|
|
msgstr "Indeksas"
|
|
|
|
#: lazarusidestrconsts:rslanguageindonesian
|
|
msgid "Indonesian"
|
|
msgstr "Indoneziečių"
|
|
|
|
#: lazarusidestrconsts:lisinformationaboutunit
|
|
msgid "Information about %s"
|
|
msgstr "Informacija apie modulį %s"
|
|
|
|
#: lazarusidestrconsts:liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr "Paveldimumas"
|
|
|
|
#: lazarusidestrconsts:dlgcoinherited
|
|
msgid "Inherited"
|
|
msgstr "Paveldėta"
|
|
|
|
#: lazarusidestrconsts:srvk_insert
|
|
msgid "Insert"
|
|
msgstr "Insert"
|
|
|
|
#: lazarusidestrconsts:liskminsertifdef
|
|
msgid "Insert $IFDEF"
|
|
msgstr "Įterpti $IFDEF"
|
|
|
|
#: lazarusidestrconsts:lismenuconditionalselection
|
|
msgid "Insert $IFDEF..."
|
|
msgstr "Įterpti $IFDEF..."
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "Įterpti CVS raktažodį \"Author\""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "Įterpti CVS raktažodį \"Date\""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "Įterpti CVS raktažodį \"Header\""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "Įterpti CVS raktažodį \"ID\""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "Įterpti CVS raktažodį \"Log\""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "Įterpti CVS raktažodį \"Name\""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "Įterpti CVS raktažodį \"Revision\""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "Įterpti CVS raktažodį \"Source\""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "Įterpti pakeitimų žurnalo įrašą"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Įterpti Delphi 5 kompiliatoriaus šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Įterpti Delphi 5 katalogo šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Įterpti Delphi 5 projekto šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Įterpti Delphi 6 kompiliatoriaus šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Įterpti Delphi 6 katalogo šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Įterpti Delphi 6 projekto šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Įterpti Delphi 7 kompiliatoriaus šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Įterpti Delphi 7 katalogo šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Įterpti Delphi 7 projekto šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Įterpti FreePascal kompiliatoriaus šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Įterpti FreePascal projekto šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
|
|
msgid "Insert Free Pascal SVN Source Template"
|
|
msgstr "Įterpti FreePascal SVN pirminio kodo šabloną"
|
|
|
|
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
|
|
msgid "Insert From Template..."
|
|
msgstr "Įterpti iš šablono..."
|
|
|
|
#: lazarusidestrconsts:srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "Įterpti GPL raštą"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Įterpti Kylix 3 kompiliatoriaus šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Įterpti Kylix 3 katalogo šabloną"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Įterpti Kylix 3 projekto šabloną"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "Įterpti LGPL raštą"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
|
|
msgid "Insert Lazarus Directory Template"
|
|
msgstr "Įterpti Lazarus katalogo šabloną"
|
|
|
|
#: lazarusidestrconsts:lisctinsertmacro
|
|
msgid "Insert Macro"
|
|
msgstr "Įterpti makrokomandą"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Įterpimo veiksena"
|
|
|
|
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
|
|
msgid "Insert New Item (after)"
|
|
msgstr "Įterpti naują elementą (po)"
|
|
|
|
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
|
|
msgid "Insert New Item (before)"
|
|
msgstr "Įterpti naują elementą (prieš)"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Įterpti šabloną"
|
|
|
|
#: lazarusidestrconsts:listddinserttodo
|
|
msgid "Insert ToDo"
|
|
msgstr "Įterpti ToDo"
|
|
|
|
#: lazarusidestrconsts:ueminserttodo
|
|
msgid "Insert Todo"
|
|
msgstr "Įterpti ToDo"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr "Įterpti GUID"
|
|
|
|
#: lazarusidestrconsts:liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr "Įterpti nuorodą..."
|
|
|
|
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Įterpti pagal abėcėlę"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr "Įterpti pusjuodžio formatavimo gairę"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr "Įterpti kodo formatavimo gairę"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Įterpti pagal kontekstą"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Įterpti dabartinę datą ir laiką"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Įterpti dabartinį vartotojo vardą"
|
|
|
|
#: lazarusidestrconsts:liskminsertdateandtime
|
|
msgid "Insert date and time"
|
|
msgstr "Įterpti datą ir laiką"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertcharacter
|
|
msgid "Insert from Character Map"
|
|
msgstr "Įterpti iš simbolių lentelės"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Įterpti iš simbolių lentelės"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr "Įterpti kursyvo formatavimo gairę"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr "Įterpti modifikuotą LGPL raštą"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Įterpti mazgą kaip vaiką"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Įterpti mazgą žemiau"
|
|
|
|
#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr "Įterpti paragrafo formatavimo gairę"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr "Įterpti pastabos formatavimo gairę"
|
|
|
|
#: lazarusidestrconsts:dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Iterpti tarpą po"
|
|
|
|
#: lazarusidestrconsts:dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Įterpti tarpą priešais"
|
|
|
|
#: lazarusidestrconsts:lismenuinserttext
|
|
msgid "Insert text"
|
|
msgstr "Įterpti tekstą"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr "Įterpti pabraukimo formatavimo gairę"
|
|
|
|
#: lazarusidestrconsts:liskminsertusername
|
|
msgid "Insert username"
|
|
msgstr "Įterpti naudotojo vardą"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr "Įterpti kintamojo formatavimo gairę"
|
|
|
|
#: lazarusidestrconsts:liskminspect
|
|
msgid "Inspect"
|
|
msgstr "Inspektuoti"
|
|
|
|
#: lazarusidestrconsts:lismenuinspect
|
|
msgid "Inspect ..."
|
|
msgstr "Inspektuoti..."
|
|
|
|
#: lazarusidestrconsts:lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Įdiegti"
|
|
|
|
#: lazarusidestrconsts:lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Įdiegti kitąkart startuojant"
|
|
|
|
#: lazarusidestrconsts:lispckeditinstallpackageintheide
|
|
msgid "Install package in the IDE"
|
|
msgstr "Įdiegti paketą į IKA"
|
|
|
|
#: lazarusidestrconsts:lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Įdiegti pažymėtą"
|
|
|
|
#: lazarusidestrconsts:lisinstallationfailed
|
|
msgid "Installation failed"
|
|
msgstr "Diegimas nepavyko"
|
|
|
|
#: lazarusidestrconsts:lispckexplinstalled
|
|
msgid "Installed"
|
|
msgstr "įdiegtas"
|
|
|
|
#: lazarusidestrconsts:lisinstalledpackages
|
|
msgid "Installed Packages"
|
|
msgstr "Įdiegti paketai"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr "Diegiant paketą %s automatiškai bus įdiegtas ir paketas:"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr "Diegiant paketą %s automatiškai bus įdiegti paketai:"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrminterface
|
|
msgid "Interface"
|
|
msgstr "Interfeisas"
|
|
|
|
#: lazarusidestrconsts:listcompilerinternalerror
|
|
msgid "Internal compiler error! (%d)"
|
|
msgstr "Vidinė kompiliatoriaus klaida! (%d)"
|
|
|
|
#: lazarusidestrconsts:dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Intervalas sekundėmis"
|
|
|
|
#: lazarusidestrconsts:lisinvalidoff
|
|
msgid "Invalid (Off)"
|
|
msgstr "Klaidingas (Pasyvus)"
|
|
|
|
#: lazarusidestrconsts:lisinvalidon
|
|
msgid "Invalid (On)"
|
|
msgstr "Klaidingas (Aktyvus)"
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Klaidingas protėvio tipas"
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidcircle
|
|
msgid "Invalid Circle"
|
|
msgstr "Klaidingas ratas"
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Klaidingas klasės vardas"
|
|
|
|
#: lazarusidestrconsts:lisinvalidcompilerfilename
|
|
msgid "Invalid Compiler Filename"
|
|
msgstr "Blogas kompiliatoriaus vardas"
|
|
|
|
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
|
|
msgid "Invalid Exclude filter"
|
|
msgstr "Klaidingas neįtraukiamųjų filtras"
|
|
|
|
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
|
|
msgid "Invalid Free Pascal source directory"
|
|
msgstr "Klaidingas FreePascal pirminio kodo katalogas"
|
|
|
|
#: lazarusidestrconsts:lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Klaidingas identifikatorius"
|
|
|
|
#: lazarusidestrconsts:lispublprojinvalidincludefilter
|
|
msgid "Invalid Include filter"
|
|
msgstr "Klaidingas įtraukiamųjų filtras"
|
|
|
|
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Klaidingos versijos ribos"
|
|
|
|
#: lazarusidestrconsts:lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Klaidingas paketas"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Klaidingas paketo vardas"
|
|
|
|
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Klaidingas paskalio identifikatorius"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Klaidinga resursų eilutės sekcija"
|
|
|
|
#: lazarusidestrconsts:lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr "Klaidingas testo projektų katalogas"
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Klaidingas modulio vardas"
|
|
|
|
#: lazarusidestrconsts:lispkgsysinvalidunitname
|
|
msgid "Invalid Unitname: %s"
|
|
msgstr "Klaidingas modulio vardas: %s"
|
|
|
|
#: lazarusidestrconsts:lisinvalidcommand
|
|
msgid "Invalid command"
|
|
msgstr "Klaidinga komanda"
|
|
|
|
#: lazarusidestrconsts:lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr "Klaidingas kompiliatorius"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
|
|
msgid "Invalid compiler filename"
|
|
msgstr "Klaidingas kompiliatoriaus failas"
|
|
|
|
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
|
|
msgid "Invalid component class"
|
|
msgstr "Klaidinga komponentės klasė"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Klaidingas derintuvės failas"
|
|
|
|
#: lazarusidestrconsts:lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr "Klaidingas šalinimas"
|
|
|
|
#: lazarusidestrconsts:lisinvaliddestinationdirectory
|
|
msgid "Invalid destination directory"
|
|
msgstr "Klaidingas tikslo katalogas"
|
|
|
|
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Klaidingas reiškinys.%sUžuomina: funkcijai \"Kurti resursų eilutę\" reikia eilutės konstantos, kuri yra tik viename faile. Pažymėkite reiškinį ir bandykite vėl."
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "Klaidingas failo vardas"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Klaidingas failo prievardis"
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Klaidingas failo vardas"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
|
|
msgid "Invalid make filename"
|
|
msgstr "Klaidingas make failas"
|
|
|
|
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Klaidinga maksimali versija"
|
|
|
|
#: lazarusidestrconsts:lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Klaidinga minimali versija"
|
|
|
|
#: lazarusidestrconsts:lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr "Klaidingas daugybinis pažymėjimas"
|
|
|
|
#: lazarusidestrconsts:liserrinvalidoption
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr "Klaidinga parinktis ties pozicija %d: \"%s\""
|
|
|
|
#: lazarusidestrconsts:lisaf2pinvalidpackageid
|
|
msgid "Invalid package ID: %s%s%s"
|
|
msgstr "Klaidingas paketo ID: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Klaidingas paketo failo prievardis"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Klaidingas paketo failo vardas"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Klaidingas paketo vardas"
|
|
|
|
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Klaidingas paketo tipas"
|
|
|
|
#: lazarusidestrconsts:lisprojaddinvalidpackagename
|
|
msgid "Invalid packagename"
|
|
msgstr "Klaidingas paketo vardas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Klaidingas tėvas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Klaidingas tėvinis mazgas"
|
|
|
|
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
|
|
msgid "Invalid pascal unit name"
|
|
msgstr "Klaidingas paskalio modulio vardas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Klaidingas ankstesnis mazgas"
|
|
|
|
#: lazarusidestrconsts:lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr "Klaidingas procedūros vardas"
|
|
|
|
#: lazarusidestrconsts:lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Klaidingas projekto failo vardas"
|
|
|
|
#: lazarusidestrconsts:lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr "Klaidingas paieškos kelias"
|
|
|
|
#: lazarusidestrconsts:lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr "Klaidingas žymėjimas"
|
|
|
|
#: lazarusidestrconsts:lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr "Klaidingas modulio failo vardas"
|
|
|
|
#: lazarusidestrconsts:lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr "Klaidingas modulio vardas"
|
|
|
|
#: lazarusidestrconsts:lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Klaidingas kintamojo vardas"
|
|
|
|
#: lazarusidestrconsts:lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Klaidinga versija"
|
|
|
|
#: lazarusidestrconsts:ueminvertassignment
|
|
msgid "Invert Assignment"
|
|
msgstr "Sukeisti priskyrimą"
|
|
|
|
#: lazarusidestrconsts:srkmecinvertassignment
|
|
msgid "Invert assignment"
|
|
msgstr "Sukeisti priskyrimą"
|
|
|
|
#: lazarusidestrconsts:srvk_irregular
|
|
msgid "Irregular "
|
|
msgstr "Nereguliarus"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypeissues
|
|
msgid "Issues xml file"
|
|
msgstr "Apribojimų xml failas"
|
|
|
|
#: lazarusidestrconsts:rslanguageitalian
|
|
msgid "Italian"
|
|
msgstr "Italų"
|
|
|
|
#: lazarusidestrconsts:dlgedital
|
|
msgid "Italic"
|
|
msgstr "Kursyvas"
|
|
|
|
#: lazarusidestrconsts:dlgoiitemheight
|
|
msgid "Item height"
|
|
msgstr "Elemento aukštis"
|
|
|
|
#: lazarusidestrconsts:lisjitform
|
|
msgid "JIT Form"
|
|
msgstr "JITForm"
|
|
|
|
#: lazarusidestrconsts:rslanguagejapanese
|
|
msgid "Japanese"
|
|
msgstr "Japonų"
|
|
|
|
#: lazarusidestrconsts:lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Rodyti žymėjimą"
|
|
|
|
#: lazarusidestrconsts:lismenujumpback
|
|
msgid "Jump back"
|
|
msgstr "Peršokti atgal"
|
|
|
|
#: lazarusidestrconsts:lismenujumpforward
|
|
msgid "Jump forward"
|
|
msgstr "Peršokti pirmyn"
|
|
|
|
#: lazarusidestrconsts:lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Šokti į"
|
|
|
|
#: lazarusidestrconsts:lismenujumptonextbookmark
|
|
msgid "Jump to next bookmark"
|
|
msgstr "Šokti prie tolesnės žymės"
|
|
|
|
#: lazarusidestrconsts:lismenujumptonexterror
|
|
msgid "Jump to next error"
|
|
msgstr "Šokti prie tolesnės klaidos"
|
|
|
|
#: lazarusidestrconsts:lismenujumptoprevbookmark
|
|
msgid "Jump to previous bookmark"
|
|
msgstr "Šokti prie ankstesnės žymės"
|
|
|
|
#: lazarusidestrconsts:lismenujumptopreverror
|
|
msgid "Jump to previous error"
|
|
msgstr "Šokti prie ankstesnės klaidos"
|
|
|
|
#: lazarusidestrconsts:dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Šokinėjimas (pvz. tarp metodų)"
|
|
|
|
#: lazarusidestrconsts:srvk_junja
|
|
msgid "Junja"
|
|
msgstr "Junja"
|
|
|
|
#: lazarusidestrconsts:srvk_kana
|
|
msgid "Kana"
|
|
msgstr "Kana"
|
|
|
|
#: lazarusidestrconsts:liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Palikti visus tekstinius failus"
|
|
|
|
#: lazarusidestrconsts:dlgkeepcaretx
|
|
msgid "Keep caret X position"
|
|
msgstr "Išlaikyti žymeklio X poziciją"
|
|
|
|
#: lazarusidestrconsts:dlgcokeepvarsreg
|
|
msgid "Keep certain variables in registers"
|
|
msgstr "Registre laikyti dažniausiai naudojamus kintamuosius"
|
|
|
|
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Palikti filtre nurodytus failus"
|
|
|
|
#: lazarusidestrconsts:liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Nekeisti vardo"
|
|
|
|
#: lazarusidestrconsts:dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Išlaikyti procedūrų eilę"
|
|
|
|
#: lazarusidestrconsts:liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr "Jį palikti ir tęsti"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolkey
|
|
msgid "Key"
|
|
msgstr "Klavišas"
|
|
|
|
#: lazarusidestrconsts:srkmkey
|
|
msgid "Key (or 2 keys combination)"
|
|
msgstr "Klavišas (arba dviejų kombinacija)"
|
|
|
|
#: lazarusidestrconsts:dlgkeymappingscheme
|
|
msgid "Key Mapping Scheme"
|
|
msgstr "Klavišų priskyrimo schema"
|
|
|
|
#: lazarusidestrconsts:dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Klavišų priskyrimai"
|
|
|
|
#: lazarusidestrconsts:dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Klavišų priskyrimų klaidos"
|
|
|
|
#: lazarusidestrconsts:liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr "Klavišų priskyrimo schema"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptskeyword
|
|
msgid "Keyword"
|
|
msgstr "Raktažodis"
|
|
|
|
#: lazarusidestrconsts:dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Raktažodžio politika"
|
|
|
|
#: lazarusidestrconsts:lislcl
|
|
msgid "LCL"
|
|
msgstr "LCL"
|
|
|
|
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "LCL interfeiso specifinės parinktys:"
|
|
|
|
#: lazarusidestrconsts:lislclwidgettype
|
|
msgid "LCL Widget Type"
|
|
msgstr "LCL valdiklių tipas"
|
|
|
|
#: lazarusidestrconsts:lislazbuildlclinterface
|
|
msgid "LCL interface"
|
|
msgstr "LCL interfeisas"
|
|
|
|
#: lazarusidestrconsts:lislclunitpathmissing
|
|
msgid "LCL unit path missing"
|
|
msgstr "Trūksta įrašo apie kelią iki LCL modulio"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypelfm
|
|
msgid "LFM - Lazarus form text"
|
|
msgstr "LFM - Lazarus formos kodas"
|
|
|
|
#: lazarusidestrconsts:lislfmfile
|
|
msgid "LFM file"
|
|
msgstr "LFM failas"
|
|
|
|
#: lazarusidestrconsts:lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr "LFM failas sugadintas"
|
|
|
|
#: lazarusidestrconsts:lislfmfilenotfound
|
|
msgid "LFM file not found"
|
|
msgstr "Nerastas LFM failas"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertlgplnotice
|
|
msgid "LGPL notice"
|
|
msgstr "LGPL raštas"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypelrs
|
|
msgid "LRS - Lazarus resource"
|
|
msgstr "LRS - Lazarus ištekliai"
|
|
|
|
#: lazarusidestrconsts:dlgenvlanguage
|
|
msgid "Language"
|
|
msgstr "Kalba"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Kalbos išimtinės situacijos"
|
|
|
|
#: lazarusidestrconsts:rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr "Kalbos parinktys"
|
|
|
|
#: lazarusidestrconsts:rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr "Kalba:"
|
|
|
|
#: lazarusidestrconsts:dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Gale"
|
|
|
|
#: lazarusidestrconsts:dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Pačiame gale"
|
|
|
|
#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr "Paleidžiančioji programa"
|
|
|
|
#: lazarusidestrconsts:lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr "Netinkama paleidžiančioji programa"
|
|
|
|
#: lazarusidestrconsts:lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Startuojamos paskirties komandinė eilutė"
|
|
|
|
#: lazarusidestrconsts:lispkgmanglazarus
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: lazarusidestrconsts:lislazarusdesktopsettings
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Lazarus darbastalio nuostatos"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
|
|
msgid "Lazarus Directory"
|
|
msgstr "Lazarus katalogas"
|
|
|
|
#: lazarusidestrconsts:lislazarusfile
|
|
msgid "Lazarus File"
|
|
msgstr "Lazarus failas"
|
|
|
|
#: lazarusidestrconsts:lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr "Lazarus IKA"
|
|
|
|
#: lazarusidestrconsts:lislazaruseditorv
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr "Lazarus IKA v%s"
|
|
|
|
#: lazarusidestrconsts:lislazarusprojectinfofile
|
|
msgid "Lazarus Project Info file"
|
|
msgstr "Lazarus projekto informacinis failas"
|
|
|
|
#: lazarusidestrconsts:lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Lazarus nustatymų katalogas"
|
|
|
|
#: lazarusidestrconsts:lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Lazarus katalogas"
|
|
|
|
#: lazarusidestrconsts:dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Lazarus katalogas (numatytas visiems projektams)"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
|
|
msgid "Lazarus directory \"%s\" not found."
|
|
msgstr "Nerastas Lazarus katalogas \"%s\"."
|
|
|
|
#: lazarusidestrconsts:lislazarusdirectorynotfound
|
|
msgid "Lazarus directory not found"
|
|
msgstr "Nerastas Lazarus katalogas"
|
|
|
|
#: lazarusidestrconsts:lislazarusform
|
|
msgid "Lazarus form"
|
|
msgstr "Lazarus forma"
|
|
|
|
#: lazarusidestrconsts:lislazarusinclude
|
|
msgid "Lazarus include file"
|
|
msgstr "Lazarus įdedamasis failas"
|
|
|
|
#: lazarusidestrconsts:lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr "Lazarus kalbos ID (t.y. en, de, lt, ...)"
|
|
|
|
#: lazarusidestrconsts:lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr "Lazarus kalbos vardas (t.y. anglų, vokiečių, lietuvių, ...)"
|
|
|
|
#: lazarusidestrconsts:lislazaruspackage
|
|
msgid "Lazarus package"
|
|
msgstr "Lazarus paketas"
|
|
|
|
#: lazarusidestrconsts:lislazarusproject
|
|
msgid "Lazarus project"
|
|
msgstr "Lazarus projektas"
|
|
|
|
#: lazarusidestrconsts:lislazarusprojectsource
|
|
msgid "Lazarus project source"
|
|
msgstr "Lazarus projekto pirminis kodas"
|
|
|
|
#: lazarusidestrconsts:lislazarusunit
|
|
msgid "Lazarus unit"
|
|
msgstr "Lazarus modulis"
|
|
|
|
#: lazarusidestrconsts:lisleaveemptyfo
|
|
msgid "Leave empty for default .po file"
|
|
msgstr "Palikite tuščią jei naudosite numatytąjį .po failą"
|
|
|
|
#: lazarusidestrconsts:srvk_left
|
|
msgid "Left"
|
|
msgstr "Kairėnsrvk_left"
|
|
|
|
#: lazarusidestrconsts:lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Kairės prieraiša"
|
|
|
|
#: lazarusidestrconsts:lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr ""
|
|
"Kairės kraštinės plotis.\n"
|
|
"Ši vertė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą kairiosios kraštinės plotį."
|
|
|
|
#: lazarusidestrconsts:lisleftsides
|
|
msgid "Left sides"
|
|
msgstr "Sutapdinti kairiuosius kraštus"
|
|
|
|
#: lazarusidestrconsts:lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr "Tolygiai rikiuoti pagal kairiuosius kraštus"
|
|
|
|
#: lazarusidestrconsts:dlgleftpos
|
|
msgid "Left:"
|
|
msgstr "Kairė:"
|
|
|
|
#: lazarusidestrconsts:dlglevelnoneopt
|
|
msgid "Level 0 (no extra Optimizations)"
|
|
msgstr "0 lygis (optimizacijos nėra)"
|
|
|
|
#: lazarusidestrconsts:dlglevel1opt
|
|
msgid "Level 1 (quick and debugger friendly)"
|
|
msgstr "1 lygis (įprastų instrukcijų sekos keičiamos greitesniais ekvivalentais)"
|
|
|
|
#: lazarusidestrconsts:dlglevel2opt
|
|
msgid "Level 2 (Level 1 + quick optimizations)"
|
|
msgstr "2 lygis (1 lygis + registro duomenų bereikalingų pakartotinų įkėlimų eliminavimas)"
|
|
|
|
#: lazarusidestrconsts:dlglevel3opt
|
|
msgid "Level 3 (Level 2 + slow optimizations)"
|
|
msgstr "3 lygis (2 lygis + kitos, ilgai daromos optimizacijos)"
|
|
|
|
#: lazarusidestrconsts:lislevels
|
|
msgid "Levels"
|
|
msgstr "Lygiai"
|
|
|
|
#: lazarusidestrconsts:dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Bibliotekos (-Fl):"
|
|
|
|
#: lazarusidestrconsts:lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Biblioteka"
|
|
|
|
#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
|
|
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
|
msgstr "Biblioteka%sFreePascal biblioteka (.dll Windows aplinkoje, .so Linux aplinkoje, .dylib MacOsX aplinkoje). Lazarus automatiškai rūpinsis bibliotekos pirminio kodo failu."
|
|
|
|
#: lazarusidestrconsts:lispckoptslicense
|
|
msgid "License:"
|
|
msgstr "Licenzija:"
|
|
|
|
#: lazarusidestrconsts:lisaboutlazarusmsg
|
|
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgstr "Licenzija: GPL/LGPL%sLazarus yra IKA (integruota kūrimo aplinka), skirtas su FreePascal kurti (vizualinėms bei konsolės) programoms. FreePascal yra (L)GPL tipo paskalio ir objektinio paskalio kompiliatorius, jis dirba Linux, Windows, Mac OS X, FreeBSD ir kitose operacinėse sistemose.%sLazarus yra trūkstamoji galvosukio dalis, kuri jums leidžia visose paminėtose platformose kurti programas aplinkoje panašioje į Delphi. IKA yra GPK (greitas programų kūrimas) įrankis, kuriame yra formų konstruktorius.%sLazarus auga, todėl mums reikia daugiau kūrėjų."
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
|
|
msgid "Limit linecount to"
|
|
msgstr "Riboti eilučių kiekį iki"
|
|
|
|
#: lazarusidestrconsts:listodolline
|
|
msgid "Line"
|
|
msgstr "Eilutė"
|
|
|
|
#: lazarusidestrconsts:dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Eilučių laužymas"
|
|
|
|
#: lazarusidestrconsts:srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Eilučių žymėjimo veiksena"
|
|
|
|
#: lazarusidestrconsts:lislinelength
|
|
msgid "Line/Length"
|
|
msgstr "Eilutė/Ilgis"
|
|
|
|
#: lazarusidestrconsts:lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Eilutės"
|
|
|
|
#: lazarusidestrconsts:lisuidlines
|
|
msgid "Lines:"
|
|
msgstr "Eilučių:"
|
|
|
|
#: lazarusidestrconsts:dlglinksmart
|
|
msgid "Link Smart"
|
|
msgstr "Saistyti sumaniai"
|
|
|
|
#: lazarusidestrconsts:dlglinklibraries
|
|
msgid "Link Style:"
|
|
msgstr "Saistymo stilius:"
|
|
|
|
#: lazarusidestrconsts:lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Saistyklė"
|
|
|
|
#: lazarusidestrconsts:dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Saistymas"
|
|
|
|
#: lazarusidestrconsts:liscmplstlist
|
|
msgid "List"
|
|
msgstr "Sąrašas"
|
|
|
|
#: lazarusidestrconsts:rslanguagelithuanian
|
|
msgid "Lithuanian"
|
|
msgstr "Lietuvių"
|
|
|
|
#: lazarusidestrconsts:dlgloaddfile
|
|
msgid "Load desktop settings from file"
|
|
msgstr "Įkelti darbastalio nuostatas iš failo"
|
|
|
|
#: lazarusidestrconsts:lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Įkelti iš failo"
|
|
|
|
#: lazarusidestrconsts:dlgcoloadsave
|
|
msgid "Load/Save"
|
|
msgstr "Įkelti/Įrašyti"
|
|
|
|
#: lazarusidestrconsts:lispckexplloadedpackages
|
|
msgid "Loaded Packages:"
|
|
msgstr "Įkelti paketai:"
|
|
|
|
#: lazarusidestrconsts:lisloadingfailed
|
|
msgid "Loading %s failed."
|
|
msgstr "Nepavyko įkelti %s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
|
msgstr "%keliant paketą %s bus pakeistas paketas %s%s, esanti faile %s.%sSenojo paketo turinys yra pakeistas.%s%sĮrašyti senojo paketo %s pakeitimus?"
|
|
|
|
#: lazarusidestrconsts:dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Vietiniai"
|
|
|
|
#: lazarusidestrconsts:lismenuviewlocalvariables
|
|
msgid "Local Variables"
|
|
msgstr "Vietiniai kintamieji"
|
|
|
|
#: lazarusidestrconsts:lislocals
|
|
msgid "Locals"
|
|
msgstr "Vietiniai kintamieji"
|
|
|
|
#: lazarusidestrconsts:lislogo
|
|
msgid "Logo"
|
|
msgstr "Logotipas"
|
|
|
|
#: lazarusidestrconsts:lismenulowercaseselection
|
|
msgid "Lowercase selection"
|
|
msgstr "Pažymėjime visas raides mažosiomis"
|
|
|
|
#: lazarusidestrconsts:dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Mažosiomis raidėmis, pirmoji - didžioji"
|
|
|
|
#: lazarusidestrconsts:liskmmacosx
|
|
msgid "Mac OS X"
|
|
msgstr "Mac OS X"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolmacros
|
|
msgid "Macros"
|
|
msgstr "Makrokomandos"
|
|
|
|
#: lazarusidestrconsts:dlgmainmenu
|
|
msgid "Main Menu"
|
|
msgstr "Pagrindinis meniu"
|
|
|
|
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
|
|
msgid "Main Unit has Application.CreateForm statements"
|
|
msgstr "Pagrindiniame modulyje yra sakinių \"Application.CreateForm\""
|
|
|
|
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
|
|
msgid "Main Unit has Application.Title statements"
|
|
msgstr "Pagrindiniame modulyje yra sakinių \"Application.Title\""
|
|
|
|
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
|
|
msgid "Main Unit has Uses Section containing all Units of project"
|
|
msgstr "Pagrindiniame modulyje yra sekcija \"Uses\", kurioje paminėti visi projekto moduliai"
|
|
|
|
#: lazarusidestrconsts:lismainunitispascalsource
|
|
msgid "Main Unit is Pascal Source"
|
|
msgstr "Pagrindinis modulis yra Paskalio pirminis kodas"
|
|
|
|
#: lazarusidestrconsts:lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr "Didysis"
|
|
|
|
#: lazarusidestrconsts:rsmajorrevision
|
|
msgid "Major revision:"
|
|
msgstr "Didysis poversijis:"
|
|
|
|
#: lazarusidestrconsts:lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Daryti vykdomąjį failą"
|
|
|
|
#: lazarusidestrconsts:lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Kurti resursų eilutę..."
|
|
|
|
#: lazarusidestrconsts:lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Kurti resursų eilutę"
|
|
|
|
#: lazarusidestrconsts:lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr "Nerastas Make"
|
|
|
|
#: lazarusidestrconsts:dlgmakepath
|
|
msgid "Make path"
|
|
msgstr "Programos make failas"
|
|
|
|
#: lazarusidestrconsts:srkmecmakeresourcestring
|
|
msgid "Make resource string"
|
|
msgstr "Sukurti resursų eilutę"
|
|
|
|
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Kompiliuoti rankiniu būdu (ne automatiškai)"
|
|
|
|
#: lazarusidestrconsts:dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Paraštės"
|
|
|
|
#: lazarusidestrconsts:dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Žymeklio spalva"
|
|
|
|
#: lazarusidestrconsts:lissmatches
|
|
msgid "Matches"
|
|
msgstr "Atitikmenys"
|
|
|
|
#: lazarusidestrconsts:lismaxs
|
|
msgid "Max %d"
|
|
msgstr "Maksimaliai %d"
|
|
|
|
#: lazarusidestrconsts:dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Maksimalus eilutės ilgis:"
|
|
|
|
#: lazarusidestrconsts:dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Maksimalus atvertų failų sąrašo ilgis"
|
|
|
|
#: lazarusidestrconsts:dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Maksimalus atvertų projektų sąrašo ilgis"
|
|
|
|
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Perdaug įrankių"
|
|
|
|
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Maksimali versija (nebūtina):"
|
|
|
|
#: lazarusidestrconsts:lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Maksimali versija:"
|
|
|
|
#: lazarusidestrconsts:dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Skaitliuko riba"
|
|
|
|
#: lazarusidestrconsts:lismemorydump
|
|
msgid "Memory Dump"
|
|
msgstr "Atminties išklotinė"
|
|
|
|
#: lazarusidestrconsts:srvk_menu
|
|
msgid "Menu"
|
|
msgstr "Menu"
|
|
|
|
#: lazarusidestrconsts:lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Meniu redaktorius"
|
|
|
|
#: lazarusidestrconsts:lismenuviewmessages
|
|
msgid "Messages"
|
|
msgstr "Pranešimai"
|
|
|
|
#: lazarusidestrconsts:dlgmethodinspolicy
|
|
msgid "Method insert policy"
|
|
msgstr "Metodo įterpimo policija"
|
|
|
|
#: lazarusidestrconsts:dlgminimizeallonminimizemain
|
|
msgid "Minimize all on minimize main"
|
|
msgstr "Suskleidžiant pagrindinį suskleisti visus"
|
|
|
|
#: lazarusidestrconsts:lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Minimali versija (nebūtina):"
|
|
|
|
#: lazarusidestrconsts:lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Minimali versija:"
|
|
|
|
#: lazarusidestrconsts:lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr "Mažasis"
|
|
|
|
#: lazarusidestrconsts:rsminorrevision
|
|
msgid "Minor revision:"
|
|
msgstr "Mažasis poversijis:"
|
|
|
|
#: lazarusidestrconsts:fdmmirrorhorizontal
|
|
msgid "Mirror horizontal"
|
|
msgstr "Apsukti horizontaliai"
|
|
|
|
#: lazarusidestrconsts:fdmmirrorvertical
|
|
msgid "Mirror vertical"
|
|
msgstr "Apsukti vertikaliai"
|
|
|
|
#: lazarusidestrconsts:dlgenvmisc
|
|
msgid "Miscellaneous"
|
|
msgstr "Įvairūs"
|
|
|
|
#: lazarusidestrconsts:lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr "Trūksta įvykių"
|
|
|
|
#: lazarusidestrconsts:lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Trūksta paketų"
|
|
|
|
#: lazarusidestrconsts:lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr "Trūksta identifikatorių"
|
|
|
|
#: lazarusidestrconsts:lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr "Trūksta modulio"
|
|
|
|
#: lazarusidestrconsts:dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Maišyti metodus su savybėm"
|
|
|
|
#: lazarusidestrconsts:srvk_modechange
|
|
msgid "Mode Change"
|
|
msgstr "Mode Change"
|
|
|
|
#: lazarusidestrconsts:uemodified
|
|
msgid "Modified"
|
|
msgstr "Pakeista"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL notice"
|
|
msgstr "Modifikuotas LGPL raštas"
|
|
|
|
#: lazarusidestrconsts:lispckeditmodified
|
|
msgid "Modified: %s"
|
|
msgstr "Pakeista: %s"
|
|
|
|
#: lazarusidestrconsts:listodolfile
|
|
msgid "Module"
|
|
msgstr "Modulis"
|
|
|
|
#: lazarusidestrconsts:lismore
|
|
msgid "More"
|
|
msgstr "Daugiau"
|
|
|
|
#: lazarusidestrconsts:lispckeditmore
|
|
msgid "More ..."
|
|
msgstr "Daugiau..."
|
|
|
|
#: lazarusidestrconsts:srvk_lbutton
|
|
msgid "Mouse Button Left"
|
|
msgstr "Pelės kairysis klavišas"
|
|
|
|
#: lazarusidestrconsts:srvk_mbutton
|
|
msgid "Mouse Button Middle"
|
|
msgstr "Pelės vidurinis klavišas"
|
|
|
|
#: lazarusidestrconsts:srvk_rbutton
|
|
msgid "Mouse Button Right"
|
|
msgstr "Pelės dešinysis klavišas"
|
|
|
|
#: lazarusidestrconsts:dlgmouselinks
|
|
msgid "Mouse links"
|
|
msgstr "Aktyvuoti saitą su Ctrl ir pele"
|
|
|
|
#: lazarusidestrconsts:lismenueditormovedown
|
|
msgid "Move Down (or right)"
|
|
msgstr "Stumti žemyn (arba dešinėn)"
|
|
|
|
#: lazarusidestrconsts:uemmoveeditorleft
|
|
msgid "Move Editor Left"
|
|
msgstr "Perkelti redaktorių kairėn"
|
|
|
|
#: lazarusidestrconsts:uemmoveeditorleftmost
|
|
msgid "Move Editor Leftmost"
|
|
msgstr "Perkelti į kairyjį kraštą"
|
|
|
|
#: lazarusidestrconsts:uemmoveeditorright
|
|
msgid "Move Editor Right"
|
|
msgstr "Perkelti redaktorių dešinėn"
|
|
|
|
#: lazarusidestrconsts:uemmoveeditorrightmost
|
|
msgid "Move Editor Rightmost"
|
|
msgstr "Perkelti į dešinyjį kraštą"
|
|
|
|
#: lazarusidestrconsts:lismovepage
|
|
msgid "Move Page ..."
|
|
msgstr "Perkelti lapą..."
|
|
|
|
#: lazarusidestrconsts:lismenueditormoveup
|
|
msgid "Move Up (or left)"
|
|
msgstr "Stumti viršun (arba kairėn)"
|
|
|
|
#: lazarusidestrconsts:lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr "Perkelti komponentę per viena atgal"
|
|
|
|
#: lazarusidestrconsts:lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr "Perkelti komponentę per viena pirmyn"
|
|
|
|
#: lazarusidestrconsts:lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr "Perkelti komponentę galan"
|
|
|
|
#: lazarusidestrconsts:lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr "Perkelti komponentę priekin"
|
|
|
|
#: lazarusidestrconsts:srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Perkelti žymeklį lapu žemiau"
|
|
|
|
#: lazarusidestrconsts:srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Perkelti žymeklį lapu kairiau"
|
|
|
|
#: lazarusidestrconsts:srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Perkelti žymeklį lapu dešiniau"
|
|
|
|
#: lazarusidestrconsts:srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Perkelti žymeklį į absoliučią pradžią"
|
|
|
|
#: lazarusidestrconsts:srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Perkelti žymeklį į absoliučią pabaigą"
|
|
|
|
#: lazarusidestrconsts:srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Perkelti žymeklį į lapo pabaigą"
|
|
|
|
#: lazarusidestrconsts:srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Perkelti žymeklį į eilutės pabaigą"
|
|
|
|
#: lazarusidestrconsts:srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Perkelti žymeklį į eilutės pradžia"
|
|
|
|
#: lazarusidestrconsts:srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Perkelti žymeklį į lapo pradžią"
|
|
|
|
#: lazarusidestrconsts:srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Perkelti žymeklį lapu aukščiau"
|
|
|
|
#: lazarusidestrconsts:srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Perkelti žymeklį žodžiu kairiau"
|
|
|
|
#: lazarusidestrconsts:srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Perkelti žymeklį žodžiu dešiniau"
|
|
|
|
#: lazarusidestrconsts:lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Perkelti priklausinį žemyn"
|
|
|
|
#: lazarusidestrconsts:lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Perkelti priklausinį aukštyn"
|
|
|
|
#: lazarusidestrconsts:srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Perkelti redaktorių kairėn"
|
|
|
|
#: lazarusidestrconsts:srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr "Perkelti redaktorių į kairyjį kraštą"
|
|
|
|
#: lazarusidestrconsts:srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Perkelti redaktorių dešinėn"
|
|
|
|
#: lazarusidestrconsts:srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr "Perkelti redaktorių į dešinyjį kraštą"
|
|
|
|
#: lazarusidestrconsts:lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr "Įrašus perkelti į paveldą"
|
|
|
|
#: lazarusidestrconsts:lispemovefiledown
|
|
msgid "Move file down"
|
|
msgstr "Perkelti failą žemyn"
|
|
|
|
#: lazarusidestrconsts:lispemovefileup
|
|
msgid "Move file up"
|
|
msgstr "Perkelti failą aukštyn"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Perkelti mazgą žemyn"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Mazgą perkelti vienu lygiu žemiau"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Mazgą perkelti vienu lygiu aukščiau"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Perkelti mazgą aukštyn"
|
|
|
|
#: lazarusidestrconsts:lispatheditmovepathdown
|
|
msgid "Move path down"
|
|
msgstr "Perkelti kelią žemyn"
|
|
|
|
#: lazarusidestrconsts:lispatheditmovepathup
|
|
msgid "Move path up"
|
|
msgstr "Perkelti kelią aukštyn"
|
|
|
|
#: lazarusidestrconsts:fdmordermovetoback
|
|
msgid "Move to back"
|
|
msgstr "Perkelti į galą"
|
|
|
|
#: lazarusidestrconsts:fdmordermovetofront
|
|
msgid "Move to front"
|
|
msgstr "Perkelti į priekį"
|
|
|
|
#: lazarusidestrconsts:dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr "Pažymėti kelis"
|
|
|
|
#: lazarusidestrconsts:fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Kelios pažymėtos komponentės turi būti toje pačioje formoje."
|
|
|
|
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "Pastaba: nepavyko sukurti \"Define\" šablono, skirto FreePascal pirminiam kodui"
|
|
|
|
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "Pastaba: nepavyko sukurti \"Define\" šablono, skirto Lazarus pirminiam kodui"
|
|
|
|
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "Pastaba: nerastas CodeTools nustatymų failas - naudojami numatytieji nustatymai."
|
|
|
|
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "Pastaba: įkeliami senasis CodeTools parinkčių failas: "
|
|
|
|
#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
|
|
msgid "NOTE: only absolute paths are supported now"
|
|
msgstr "Pastaba: šiuo metu palaikomi tik absoliutūs keliai"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmname
|
|
msgid "Name"
|
|
msgstr "Vardas"
|
|
|
|
#: lazarusidestrconsts:lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Naujos procedūros vardas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsname
|
|
msgid "Name:"
|
|
msgstr "Vardas:"
|
|
|
|
#: lazarusidestrconsts:dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Vardų suteikimas"
|
|
|
|
#: lazarusidestrconsts:lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Niekada, tik rankiniu būdu"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatenew
|
|
msgid "New"
|
|
msgstr "Naujas"
|
|
|
|
#: lazarusidestrconsts:lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Naujas..."
|
|
|
|
#: lazarusidestrconsts:lisnewancestors
|
|
msgid "New Ancestors"
|
|
msgstr "Naujas protėvis"
|
|
|
|
#: lazarusidestrconsts:lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Nauja klasė"
|
|
|
|
#: lazarusidestrconsts:lisa2pnewcomponent
|
|
msgid "New Component"
|
|
msgstr "Nauja komponentė"
|
|
|
|
#: lazarusidestrconsts:lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "Naujas failas"
|
|
|
|
#: lazarusidestrconsts:lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Nauja forma"
|
|
|
|
#: lazarusidestrconsts:lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Naujas projektas..."
|
|
|
|
#: lazarusidestrconsts:lismenunewprojectfromfile
|
|
msgid "New Project from file ..."
|
|
msgstr "Naujas projektas iš failo..."
|
|
|
|
#: lazarusidestrconsts:lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Nauja priklausomybė"
|
|
|
|
#: lazarusidestrconsts:lismenueditornewtemplatedescription
|
|
msgid "New Template Description..."
|
|
msgstr "Naujas šablono aprašymas..."
|
|
|
|
#: lazarusidestrconsts:lismenunewunit
|
|
msgid "New Unit"
|
|
msgstr "Naujas modulis"
|
|
|
|
#: lazarusidestrconsts:lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Naujos klasės vardaas:"
|
|
|
|
#: lazarusidestrconsts:liskmnewpackage
|
|
msgid "New package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenunewpackage
|
|
msgid "New package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Naujas projektas"
|
|
|
|
#: lazarusidestrconsts:liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Naujas projektas iš failo"
|
|
|
|
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "Naujojo modulio nėra modulių kelyje"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "Mazgas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangnewpackage
|
|
msgid "NewPackage"
|
|
msgstr "Naujas paketas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Nauja eilutė"
|
|
|
|
#: lazarusidestrconsts:srvk_next
|
|
msgid "Next"
|
|
msgstr "Next"
|
|
|
|
#: lazarusidestrconsts:srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Tolesnė žymė"
|
|
|
|
#: lazarusidestrconsts:lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "Nerasta \"ResourceString\" sekcija"
|
|
|
|
#: lazarusidestrconsts:lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr "Abstrakčių metodų nerasta"
|
|
|
|
#: lazarusidestrconsts:lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Nedaryti atsarginių kopijų"
|
|
|
|
#: lazarusidestrconsts:lisnochange
|
|
msgid "No change"
|
|
msgstr "Nekeisti"
|
|
|
|
#: lazarusidestrconsts:lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr "Kodas nepažymėtas"
|
|
|
|
#: lazarusidestrconsts:lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr "Nėra paveldėtų kompiliatoriaus parinkčių."
|
|
|
|
#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Nenurodyta derintuvė"
|
|
|
|
#: lazarusidestrconsts:dlgednoerr
|
|
msgid "No errors in key mapping found."
|
|
msgstr "Klavišų priskyrimuose klaidų nerasta."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Nėra pažymėtų elementų"
|
|
|
|
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
|
msgstr "%s%s%s priklausiniui nerastas paketas.%sNurodykite egzistuojantį paketą."
|
|
|
|
#: lazarusidestrconsts:lisoipnopackageselected
|
|
msgid "No package selected"
|
|
msgstr "Paketas nepažymėtas"
|
|
|
|
#: lazarusidestrconsts:lisnoprogramfilesfound
|
|
msgid "No program file %s%s%s found."
|
|
msgstr "Nerastas programos failas %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Nerasta teksto konstanta"
|
|
|
|
#: lazarusidestrconsts:lisldnovalidlazdocpath
|
|
msgid "No valid LazDoc path"
|
|
msgstr "Klaidingas LazDoc kelias"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
|
|
msgid "Node and its children are only valid for this project"
|
|
msgstr "Mazgas ir jo vaikai galioja tik šiam projektui"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Mazgas tik skaitymui"
|
|
|
|
#: lazarusidestrconsts:srvk_nonconvert
|
|
msgid "Nonconvert"
|
|
msgstr "Nonconvert"
|
|
|
|
#: lazarusidestrconsts:dlgenvnone
|
|
msgid "None"
|
|
msgstr "Joks"
|
|
|
|
#: lazarusidestrconsts:dlgconormal
|
|
msgid "Normal Code"
|
|
msgstr "Normalų kodą"
|
|
|
|
#: lazarusidestrconsts:srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Įprasta žymėjimo veiksena"
|
|
|
|
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
|
|
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr "Įprastai filtre nurodomas reguliarusis reiškinys. Paprastojoje sintaksėje taškas \".\" įra įprastas simbolis, žvaigždė \"*\" atitinka betką, klaustukas \"?\" atitinka vieną kažkokį simbolį, kablelis arba kabliataškis atskiria alternatyvas. Pavyzdžiui: prasta sintaksė *.pas;*pp atitinka ^(.*\\.pas|.*\\.pp)$"
|
|
|
|
#: lazarusidestrconsts:lisnotadelphiproject
|
|
msgid "Not a Delphi project"
|
|
msgstr "Ne Delphi projektas"
|
|
|
|
#: lazarusidestrconsts:lisnotadelphiunit
|
|
msgid "Not a Delphi unit"
|
|
msgstr "Ne Delhi modulis"
|
|
|
|
#: lazarusidestrconsts:lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Nerasta"
|
|
|
|
#: lazarusidestrconsts:lisnotimplemented
|
|
msgid "Not implemented"
|
|
msgstr "Neįgyvendinta"
|
|
|
|
#: lazarusidestrconsts:uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Dar neįgyvendinta"
|
|
|
|
#: lazarusidestrconsts:lisnotimplementedyet2
|
|
msgid "Not implemented yet."
|
|
msgstr "Dar neįgyvendinta..."
|
|
|
|
#: lazarusidestrconsts:lisnotimplementedyet
|
|
msgid "Not implemented yet:%s%s"
|
|
msgstr "Dar neįgyvendinta:%s%s"
|
|
|
|
#: lazarusidestrconsts:lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Ne dabar"
|
|
|
|
#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
|
|
msgid "Note: All keys will be set to the values of the choosen scheme."
|
|
msgstr "Pastaba: visi klavišai bus nustatyti pagal pasirinktą schemą."
|
|
|
|
#: lazarusidestrconsts:dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Pastaba: projekto failai - visi failai, esantys projekto kataloge"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Skaičius"
|
|
|
|
#: lazarusidestrconsts:srvk_numlock
|
|
msgid "Numlock"
|
|
msgstr "Numlock"
|
|
|
|
#: lazarusidestrconsts:srvk_numpad
|
|
msgid "Numpad %d"
|
|
msgstr "Numpad %d"
|
|
|
|
#: lazarusidestrconsts:lisifdok
|
|
msgid "OK"
|
|
msgstr "Tinka"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr "OS išimtinės situacijos"
|
|
|
|
#: lazarusidestrconsts:uepovr
|
|
msgid "OVR"
|
|
msgstr "KEISTI"
|
|
|
|
#: lazarusidestrconsts:lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Objektas"
|
|
|
|
#: lazarusidestrconsts:lismenuviewobjectinspector
|
|
msgid "Object Inspector"
|
|
msgstr "Objektų inspektorius"
|
|
|
|
#: lazarusidestrconsts:liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr "Objetų inspektoriaus komandos"
|
|
|
|
#: lazarusidestrconsts:lisokbtn
|
|
msgid "Ok"
|
|
msgstr "Tinka"
|
|
|
|
#: lazarusidestrconsts:lisoldancestors
|
|
msgid "Old Ancestors"
|
|
msgstr "Buvęs protėvis"
|
|
|
|
#: lazarusidestrconsts:lisoldclass
|
|
msgid "Old Class"
|
|
msgstr "Buvusi klasė"
|
|
|
|
#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr "Darant projektą, ištikro vykdyti komandą \"Kurti failą\""
|
|
|
|
#: lazarusidestrconsts:lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "Neveikos metu"
|
|
|
|
#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr "Startuojant projektą, ištikro vykdyti komandą \"Startuoti failą\""
|
|
|
|
#: lazarusidestrconsts:lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Internetinis žinynas"
|
|
|
|
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
|
|
msgid "Online Help not yet implemented"
|
|
msgstr "Kontekstinis žinynas dar neįgyvendintas"
|
|
|
|
#: lazarusidestrconsts:lispldonlyexistingfiles
|
|
msgid "Only existing files"
|
|
msgstr "Tik egzistuojantys failai"
|
|
|
|
#: lazarusidestrconsts:lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr "Ieškoti tik ištisų žodžių"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Tik pažymėtoje srityje"
|
|
|
|
#: lazarusidestrconsts:lisfindfileonlytextfiles
|
|
msgid "Only text files"
|
|
msgstr "Tik teksto failai"
|
|
|
|
#: lazarusidestrconsts:lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr "Naudoti tik kategorijai"
|
|
|
|
#: lazarusidestrconsts:lishintopen
|
|
msgid "Open"
|
|
msgstr "Atverti"
|
|
|
|
#: lazarusidestrconsts:lisopenlfm
|
|
msgid "Open %s"
|
|
msgstr "Atverti %s"
|
|
|
|
#: lazarusidestrconsts:lismenuopen
|
|
msgid "Open ..."
|
|
msgstr "Atverti..."
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
|
|
msgid "Open Diff in editor"
|
|
msgstr "Diff atverti redaktoriuje"
|
|
|
|
#: lazarusidestrconsts:lisopenfile2
|
|
msgid "Open File ..."
|
|
msgstr "Atverti failą..."
|
|
|
|
#: lazarusidestrconsts:liscpopenpackage
|
|
msgid "Open Package %s"
|
|
msgstr "Atverti paketą %s"
|
|
|
|
#: lazarusidestrconsts:lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr "Atverti paketo failą"
|
|
|
|
#: lazarusidestrconsts:lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Atverti paketą?"
|
|
|
|
#: lazarusidestrconsts:lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Atverti peržiūros langą"
|
|
|
|
#: lazarusidestrconsts:lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Atverti projektą..."
|
|
|
|
#: lazarusidestrconsts:lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Atverti projekto failą"
|
|
|
|
#: lazarusidestrconsts:lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Atverti projektą?"
|
|
|
|
#: lazarusidestrconsts:lismenutemplateopenrecent
|
|
msgid "Open Recent"
|
|
msgstr "Atverti paskiausiuosius"
|
|
|
|
#: lazarusidestrconsts:lismenuopenrecent
|
|
msgid "Open Recent ..."
|
|
msgstr "Atverti paskutinį naudotą..."
|
|
|
|
#: lazarusidestrconsts:lismenuopenrecentproject
|
|
msgid "Open Recent Project ..."
|
|
msgstr "Atverti paskutinį naudotą projektą..."
|
|
|
|
#: lazarusidestrconsts:liscpopenunit
|
|
msgid "Open Unit %s"
|
|
msgstr "Atverti modulį %s"
|
|
|
|
#: lazarusidestrconsts:lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr "Įkelti kaip XML failą"
|
|
|
|
#: lazarusidestrconsts:lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr "Atverti failą"
|
|
|
|
#: lazarusidestrconsts:lisopenfile
|
|
msgid "Open file"
|
|
msgstr "Atverti failą"
|
|
|
|
#: lazarusidestrconsts:srkmecopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr "Atverti ties žymekliu nurodytą failą"
|
|
|
|
#: lazarusidestrconsts:lismenuopenfilenameatcursor
|
|
msgid "Open filename at cursor"
|
|
msgstr "Atverti ties žymekliu nurodytą failą"
|
|
|
|
#: lazarusidestrconsts:dlgqopenlastprj
|
|
msgid "Open last project at start"
|
|
msgstr "Startuojant atverti paskutinisyk atvertą projektą"
|
|
|
|
#: lazarusidestrconsts:lisoipopenloadedpackage
|
|
msgid "Open loaded package"
|
|
msgstr "Atverti įkeltą paketą"
|
|
|
|
#: lazarusidestrconsts:lismenuopenpackage
|
|
msgid "Open loaded package ..."
|
|
msgstr "Atverti įkeltą paketą..."
|
|
|
|
#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
|
|
msgid "Open or Load Compiler Options"
|
|
msgstr "Atverti arba įkelti kompiliatoriaus parinktis"
|
|
|
|
#: lazarusidestrconsts:liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Atverti paketą"
|
|
|
|
#: lazarusidestrconsts:lisopenpackage2
|
|
msgid "Open package %s"
|
|
msgstr "Atverti paketą %s"
|
|
|
|
#: lazarusidestrconsts:liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr "Atverti paketo failą"
|
|
|
|
#: lazarusidestrconsts:lismenuopenpackagefile
|
|
msgid "Open package file (.lpk) ..."
|
|
msgstr "Atverti paketo failą (.lpk)..."
|
|
|
|
#: lazarusidestrconsts:lismenuopenpackageofcurunit
|
|
msgid "Open package of current unit"
|
|
msgstr "Atverti veikiamojo modulio paketą"
|
|
|
|
#: lazarusidestrconsts:lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Atverti projektą"
|
|
|
|
#: lazarusidestrconsts:lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr "Vėl atverti projektą"
|
|
|
|
#: lazarusidestrconsts:lisiecoopenrecent
|
|
msgid "Open recent"
|
|
msgstr "Atverti paskutinį naudotą"
|
|
|
|
#: lazarusidestrconsts:lismenuopenrecentpkg
|
|
msgid "Open recent package ..."
|
|
msgstr "Atverti paskutinį naudotą paketą..."
|
|
|
|
#: lazarusidestrconsts:lisopensymlink
|
|
msgid "Open symlink"
|
|
msgstr "Atverti simbolinę nuorodą"
|
|
|
|
#: lazarusidestrconsts:lisopentarget
|
|
msgid "Open target"
|
|
msgstr "Atvert paskyrą"
|
|
|
|
#: lazarusidestrconsts:lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr "Failą įkelti kaip įprastą pirminį kodą"
|
|
|
|
#: lazarusidestrconsts:lisopenthepackage
|
|
msgid "Open the package %s?"
|
|
msgstr "Atverti paketą %s?"
|
|
|
|
#: lazarusidestrconsts:lisopentheproject
|
|
msgid "Open the project %s?"
|
|
msgstr "Atverti projektą %s?"
|
|
|
|
#: lazarusidestrconsts:liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Atverti modulį"
|
|
|
|
#: lazarusidestrconsts:dlgoptimiz
|
|
msgid "Optimizations:"
|
|
msgstr "Optimizacija:"
|
|
|
|
#: lazarusidestrconsts:liserrnooptionallowed
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr "Parinkčiai ties pozicija %d argumentai nepriimtini: %s"
|
|
|
|
#: lazarusidestrconsts:liserroptionneeded
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr "Parinkčiai ties pozicija %d reikia nurodyti argumentą: %s"
|
|
|
|
#: lazarusidestrconsts:fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Parinktis: pritraukti prie tinklelio taškų"
|
|
|
|
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Parinktis: pritraukti prie pagalbinių linijų"
|
|
|
|
#: lazarusidestrconsts:dlgfropts
|
|
msgid "Options"
|
|
msgstr "Parinktys"
|
|
|
|
#: lazarusidestrconsts:lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Parinktys:"
|
|
|
|
#: lazarusidestrconsts:dlgcoopts
|
|
msgid "Options: "
|
|
msgstr "Parinktys: "
|
|
|
|
#: lazarusidestrconsts:fdmorder
|
|
msgid "Order"
|
|
msgstr "Eilė"
|
|
|
|
#: lazarusidestrconsts:dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Pradžia"
|
|
|
|
#: lazarusidestrconsts:dlgcoother
|
|
msgid "Other"
|
|
msgstr "Kiti"
|
|
|
|
#: lazarusidestrconsts:dlgcosources
|
|
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Kiti pirminiai kodai (.pp/.pas failai, skirta tik IKA, ne kompiliatoriui)"
|
|
|
|
#: lazarusidestrconsts:dlgotherunitfiles
|
|
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
|
msgstr "Kitų modulių failai (-Fu) (atskirti kabliataškiais):"
|
|
|
|
#: lazarusidestrconsts:dlgenvotherfiles
|
|
msgid "Other files"
|
|
msgstr "Kiti failai"
|
|
|
|
#: lazarusidestrconsts:rsotherinfo
|
|
msgid "Other info"
|
|
msgstr "Kita informacija"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr "Išvestis"
|
|
|
|
#: lazarusidestrconsts:dlgpooutputsettings
|
|
msgid "Output Settings"
|
|
msgstr "Išvesties nuostatos"
|
|
|
|
#: lazarusidestrconsts:lispkgdefsoutputdirectory
|
|
msgid "Output directory"
|
|
msgstr "Išvesties katalogas"
|
|
|
|
#: lazarusidestrconsts:dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Perpildymą"
|
|
|
|
#: lazarusidestrconsts:lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr "Įgyvendinti visus pažymėtus"
|
|
|
|
#: lazarusidestrconsts:lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr "Įgyvendinti pirmą pažymetą"
|
|
|
|
#: lazarusidestrconsts:lisoverridelanguage
|
|
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgstr "Viršesnė kalba. Pavyzdžiui: --language=de. Galimas reikšmes galite sužinoti žvilgterėje į kalbų katalogą."
|
|
|
|
#: lazarusidestrconsts:lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Kurti viršesnį sistemos kintamąjį"
|
|
|
|
#: lazarusidestrconsts:srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Perrašymo veiksena"
|
|
|
|
#: lazarusidestrconsts:lisoverwritefileondisk
|
|
msgid "Overwrite file on disk"
|
|
msgstr "Perrašyti failą diske"
|
|
|
|
#: lazarusidestrconsts:lisoverwritefile
|
|
msgid "Overwrite file?"
|
|
msgstr "Perrašyti failą?"
|
|
|
|
#: lazarusidestrconsts:listodolowner
|
|
msgid "Owner"
|
|
msgstr "Savininkas"
|
|
|
|
#: lazarusidestrconsts:rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr "PO išvesties katalogas:"
|
|
|
|
#: lazarusidestrconsts:lispackage
|
|
msgid "Package"
|
|
msgstr "Paketas"
|
|
|
|
#: lazarusidestrconsts:lispckeditpackage
|
|
msgid "Package %s"
|
|
msgstr "Paketas %s"
|
|
|
|
#: lazarusidestrconsts:lispckexplpackagenotfound
|
|
msgid "Package %s not found"
|
|
msgstr "%s paketas nerastas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagechangedsave
|
|
msgid "Package %s%s%s changed. Save?"
|
|
msgstr "Paketas %s%s%s pakeistas. Įrašyti pakeitimus?"
|
|
|
|
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
|
|
msgid "Package %s%s%s has changed.%sSave package?"
|
|
msgstr "Paketas %s%s%s pakeistas.%sĮrašyti paketą?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
|
|
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
|
msgstr "Paketui %s%s%s nurodytas blogas katalogas:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisaf2ppackagenotfound
|
|
msgid "Package %s%s%s not found."
|
|
msgstr "Paketas %s%s%s nerastas."
|
|
|
|
#: lazarusidestrconsts:lismenupackagegraph
|
|
msgid "Package Graph ..."
|
|
msgstr "Paketų grafas..."
|
|
|
|
#: lazarusidestrconsts:lispackageinfo
|
|
msgid "Package Info"
|
|
msgstr "Informacija apie paketą"
|
|
|
|
#: lazarusidestrconsts:lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr "Paketo saitai"
|
|
|
|
#: lazarusidestrconsts:lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Paketo vardas"
|
|
|
|
#: lazarusidestrconsts:lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Paketo vardas:"
|
|
|
|
#: lazarusidestrconsts:lispckoptspackageoptions
|
|
msgid "Package Options"
|
|
msgstr "Paketo parinktys"
|
|
|
|
#: lazarusidestrconsts:lispkgreg
|
|
msgid "Package Registration"
|
|
msgstr "Paketo registracija"
|
|
|
|
#: lazarusidestrconsts:lispkgdefssrcdirmark
|
|
msgid "Package Source Directory Mark"
|
|
msgstr "Paketo pradinio katalogo žymė"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Paketų konfliktas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagefilemissing
|
|
msgid "Package file missing"
|
|
msgstr "Trūksta paketo failo"
|
|
|
|
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
|
|
msgid "Package file not found"
|
|
msgstr "Nerastas paketo failas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
|
|
msgid "Package file not saved"
|
|
msgstr "Paketo failas neišsaugotas"
|
|
|
|
#: lazarusidestrconsts:liskmpackagegraph
|
|
msgid "Package graph"
|
|
msgstr "Paketų grafas"
|
|
|
|
#: lazarusidestrconsts:dlgpldpackagegroup
|
|
msgid "Package group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
|
|
msgid "Package is no designtime package"
|
|
msgstr "Paketas nėra skirtas modeliavimo rėžimui"
|
|
|
|
#: lazarusidestrconsts:lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Paketas tik skaitymui"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Paketas reikalingas"
|
|
|
|
#: lazarusidestrconsts:lismenupackagelinks
|
|
msgid "Package links ..."
|
|
msgstr "Paketo saitai..."
|
|
|
|
#: lazarusidestrconsts:srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr "Paketo menių komandos"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Paketas šiuo vardu jau egzistuoja"
|
|
|
|
#: lazarusidestrconsts:lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Paketo vardas prasideda..."
|
|
|
|
#: lazarusidestrconsts:lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Paketo varde yra..."
|
|
|
|
#: lazarusidestrconsts:lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Paketą reikia įdiegti"
|
|
|
|
#: lazarusidestrconsts:lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Paketas nerastas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackage
|
|
msgid "Package: %s"
|
|
msgstr "Paketui: %s"
|
|
|
|
#: lazarusidestrconsts:lispckoptspackagetype
|
|
msgid "PackageType"
|
|
msgstr "Paketo tipas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Paketų failų prievardis turi būti .lpk"
|
|
|
|
#: lazarusidestrconsts:lispackagestoinstallintheide
|
|
msgid "Packages to install in the IDE"
|
|
msgstr "Į IKA diegtini paketai"
|
|
|
|
#: lazarusidestrconsts:lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Perilgas vardas"
|
|
|
|
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
|
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
|
msgstr "Piešti tik IKA esančius konstruktoriaus elementus (sumažina lėtų kompiuterių apkrovą)"
|
|
|
|
#: lazarusidestrconsts:liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr "Paletė"
|
|
|
|
#: lazarusidestrconsts:lisa2ppalettepage
|
|
msgid "Palette Page:"
|
|
msgstr "Paletės lapas:"
|
|
|
|
#: lazarusidestrconsts:lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Pastraipos"
|
|
|
|
#: lazarusidestrconsts:liscmparameter
|
|
msgid "Parameter"
|
|
msgstr "Parametras"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parametrai:"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
|
|
msgid "Parent node can not contain child nodes."
|
|
msgstr "Tėvinis mazgas negali turėti mazgų-sūnų."
|
|
|
|
#: lazarusidestrconsts:dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Analizė"
|
|
|
|
#: lazarusidestrconsts:lislazbuildabopart
|
|
msgid "Part"
|
|
msgstr "Dalis"
|
|
|
|
#: lazarusidestrconsts:lispascalsourcefile
|
|
msgid "Pascal source file"
|
|
msgstr "Paskalio pirminio kodo failas"
|
|
|
|
#: lazarusidestrconsts:lispascalunit
|
|
msgid "Pascal unit"
|
|
msgstr "Paskalio modulis"
|
|
|
|
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
|
|
msgid "Pascal units must have the extension .pp or .pas"
|
|
msgstr "Paskalio modulių failų prievardis turi būti .pp arba .pas"
|
|
|
|
#: lazarusidestrconsts:lispasscount
|
|
msgid "Pass Count"
|
|
msgstr "Kirsta kartų"
|
|
|
|
#: lazarusidestrconsts:dlgpassoptslinker
|
|
msgid "Pass Options To The Linker (Delimiter is space)"
|
|
msgstr "Perduoti parinktis saistyklei (atskirta kabliataškiais)"
|
|
|
|
#: lazarusidestrconsts:lismenupaste
|
|
msgid "Paste"
|
|
msgstr "Įdėti"
|
|
|
|
#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
|
|
msgid "Paste Components from clipboard"
|
|
msgstr "Įdėti komponentę iš iškarpinės"
|
|
|
|
#: lazarusidestrconsts:srkmecpaste
|
|
msgid "Paste clipboard to current position"
|
|
msgstr "Iš iškarpinės įdėti veikiamojoje vietoje"
|
|
|
|
#: lazarusidestrconsts:lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Įterpti pažymėtas komponentes iš iškarpinės"
|
|
|
|
#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr "Kelio redaktorius"
|
|
|
|
#: lazarusidestrconsts:lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Kelio šablonai"
|
|
|
|
#: lazarusidestrconsts:listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Failas:"
|
|
|
|
#: lazarusidestrconsts:dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Keliai"
|
|
|
|
#: lazarusidestrconsts:lisuidpathsreadonly
|
|
msgid "Paths (Read Only)"
|
|
msgstr "Keliai (tik skaitymui)"
|
|
|
|
#: lazarusidestrconsts:lismenupause
|
|
msgid "Pause"
|
|
msgstr "Pauzė"
|
|
|
|
#: lazarusidestrconsts:srvk_pause
|
|
msgid "Pause key"
|
|
msgstr "Pause klavišas"
|
|
|
|
#: lazarusidestrconsts:liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr "Pristabdyti veiką"
|
|
|
|
#: lazarusidestrconsts:dlgpersistentcaret
|
|
msgid "Persistent caret"
|
|
msgstr "Nuolatinis žymeklis"
|
|
|
|
#: lazarusidestrconsts:lisccochecktestdir
|
|
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
|
msgstr "Patikrinkite testinių projektų katalogą %s\"Aplinka -> Aplinkos parinktys -> Failai -> Katalogas testo projektų darymui\""
|
|
|
|
#: lazarusidestrconsts:lispleasecheckthecompilername
|
|
msgid "Please check the compiler name"
|
|
msgstr "Patikrinkite kompiliatoriaus vardą"
|
|
|
|
#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
|
|
msgid "Please check the freepascal source directory"
|
|
msgstr "Patikrinkite FreePascal pirminio kodo katalogą"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr "Sąraše nurodykite resursų eilutės sekciją"
|
|
|
|
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "Prieš startuojant atverkite modulį."
|
|
|
|
#: lazarusidestrconsts:srkmpresskey
|
|
msgid "Please press a key ..."
|
|
msgstr "Spustelkit kokį nors klavišą..."
|
|
|
|
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Failą būtina įrašyti prieš dedant jį į paketą."
|
|
|
|
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
|
|
msgid "Please save the package first."
|
|
msgstr "Pirma išsaugokite paketą."
|
|
|
|
#: lazarusidestrconsts:lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "Pažymėkite paketą"
|
|
|
|
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
|
|
msgid "Please select a package to open"
|
|
msgstr "Nurodykit kurį paketą atverti"
|
|
|
|
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Būtina pažymėti kurį nors iš elementų."
|
|
|
|
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr "Prieš ištraukiant naują procedūrą/metodą pažymėkite kažkiek kodo."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Taškas"
|
|
|
|
#: lazarusidestrconsts:lispointer
|
|
msgid "Pointer"
|
|
msgstr "Rodyklė"
|
|
|
|
#: lazarusidestrconsts:rslanguagepolish
|
|
msgid "Polish"
|
|
msgstr "Lenkų"
|
|
|
|
#: lazarusidestrconsts:rslanguagepolishwin
|
|
msgid "Polish(CP1250)"
|
|
msgstr "Lenkų(CP1250)"
|
|
|
|
#: lazarusidestrconsts:rslanguagepolishiso
|
|
msgid "Polish(ISO 8859-2)"
|
|
msgstr "Lenkų(ISO 8859-2)"
|
|
|
|
#: lazarusidestrconsts:rslanguageportugues
|
|
msgid "Portuguese"
|
|
msgstr "Portugalų"
|
|
|
|
#: lazarusidestrconsts:lisceomode
|
|
msgid "Preferred Exhibition Mode"
|
|
msgstr "Pairmiau rodyti"
|
|
|
|
#: lazarusidestrconsts:dlgwrdpreview
|
|
msgid "Preview"
|
|
msgstr "Peržiūra"
|
|
|
|
#: lazarusidestrconsts:dlgcdtpreview
|
|
msgid "Preview (Max line length = 1)"
|
|
msgstr "Peržiūra (maksimalus eilutės ilgis - 1)"
|
|
|
|
#: lazarusidestrconsts:srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Ankstesnė žymė"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Ankstesnis mazgas negali turėti mazgų-vaikų."
|
|
|
|
#: lazarusidestrconsts:srvk_print
|
|
msgid "Print"
|
|
msgstr "Print"
|
|
|
|
#: lazarusidestrconsts:listodolistprintlist
|
|
msgid "Print todo items"
|
|
msgstr "Spauzdinti ToDo sąrašą"
|
|
|
|
#: lazarusidestrconsts:srvk_prior
|
|
msgid "Prior"
|
|
msgstr "Prior"
|
|
|
|
#: lazarusidestrconsts:listodolpriority
|
|
msgid "Priority"
|
|
msgstr "Prioritetas"
|
|
|
|
#: lazarusidestrconsts:lisprivate
|
|
msgid "Private"
|
|
msgstr "Private"
|
|
|
|
#: lazarusidestrconsts:lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Private metodas"
|
|
|
|
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
|
msgstr "Prieš tesiant reiktų įdiegti kai kuriuos paketus.%s%sDėmesio:%sProjektas priklauso nuo kai kurių paketų, kuriuose yra moduliai su Register procedūra. Įprastai Register procedūra naudojama komponentėms diegti į IKA. Tačiau šie moduliai priklauso paketams, kurie dar nėra įdiegti į IKA. Bandant IKA atverti formą, kuri naudoja šias komponentes, bus pranešta kad trūksta komponenčių ir tolesnis formos įkėlimas gali pridaryti nepageidautinų nemalonumų.%s%sTai neatsilieps projekto atvėrimui ar jo pirminiam kodui.%s%sTai rik reiškia, kad nėra gerai prieš diegiant trūkstamus paketu atverti formas kūrimui.%s%s"
|
|
|
|
#: lazarusidestrconsts:lisprocedure
|
|
msgid "Procedure"
|
|
msgstr "Procedūra"
|
|
|
|
#: lazarusidestrconsts:uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Rodyti procedūros paskelbimą arba jos kodą"
|
|
|
|
#: lazarusidestrconsts:srkmecprocedurelist
|
|
msgid "Procedure List ..."
|
|
msgstr "Procedurų sąrašas..."
|
|
|
|
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Procedūros įterpimo politika"
|
|
|
|
#: lazarusidestrconsts:lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr "Procedūra su interfeisu"
|
|
|
|
#: lazarusidestrconsts:lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr "Proceduros"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Procesas"
|
|
|
|
#: lazarusidestrconsts:lisprogram
|
|
msgid "Program"
|
|
msgstr "Programa"
|
|
|
|
#: lazarusidestrconsts:lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Aptikta programa"
|
|
|
|
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Programos pirminio kodo failo prievardis turi būti panašus į paskalio: .pas, .pp arba .lpr"
|
|
|
|
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
|
|
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
|
msgstr "Programa%sFreePascal programa. Lazarus automatiškai rūpinsis programos failu."
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolprogramfilename
|
|
msgid "Programfilename:"
|
|
msgstr "Programos failo vardas:"
|
|
|
|
#: lazarusidestrconsts:lisexeprograms
|
|
msgid "Programs"
|
|
msgstr "Programos"
|
|
|
|
#: lazarusidestrconsts:lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Eiga"
|
|
|
|
#: lazarusidestrconsts:dlgenvproject
|
|
msgid "Project"
|
|
msgstr "Projektas"
|
|
|
|
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
|
|
msgid "Project %s%s%s successfully built. :)"
|
|
msgstr "Projektas %s%s%s sėkmingai padarytas :)"
|
|
|
|
#: lazarusidestrconsts:lisedtdefprojectincpath
|
|
msgid "Project IncPath"
|
|
msgstr "Projekto IncPath"
|
|
|
|
#: lazarusidestrconsts:lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Kelias iki projekto įterpinių"
|
|
|
|
#: lazarusidestrconsts:lisprojectinformation
|
|
msgid "Project Information"
|
|
msgstr "Informacija apie projektą"
|
|
|
|
#: lazarusidestrconsts:lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Projekto inspektorius"
|
|
|
|
#: lazarusidestrconsts:lisprojinspprojectinspector
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Projekto inspektorius - %s"
|
|
|
|
#: lazarusidestrconsts:dlgprojectoptions
|
|
msgid "Project Options"
|
|
msgstr "Projekto parinktys"
|
|
|
|
#: lazarusidestrconsts:lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Projekto parinktys..."
|
|
|
|
#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
|
|
msgid "Project Source Directory Mark"
|
|
msgstr "Projekto pradinio katalogo žymė"
|
|
|
|
#: lazarusidestrconsts:lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Kelias iki projekto pirminio kodo"
|
|
|
|
#: lazarusidestrconsts:lisedtdefprojectsrcpath
|
|
msgid "Project SrcPath"
|
|
msgstr "Projekto SrcPath"
|
|
|
|
#: lazarusidestrconsts:lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Kelias iki projekto modulių"
|
|
|
|
#: lazarusidestrconsts:lisedtdefprojectunitpath
|
|
msgid "Project UnitPath"
|
|
msgstr "Projekto UnitPath"
|
|
|
|
#: lazarusidestrconsts:lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Projektas pakeistas"
|
|
|
|
#: lazarusidestrconsts:lisprojectclosed
|
|
msgid "Project closed"
|
|
msgstr "Projektas užvertas"
|
|
|
|
#: lazarusidestrconsts:lisprojectdirectory
|
|
msgid "Project directory"
|
|
msgstr "Projekto katalogas"
|
|
|
|
#: lazarusidestrconsts:lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Projekto failo vardas"
|
|
|
|
#: lazarusidestrconsts:dlgprojfiles
|
|
msgid "Project files"
|
|
msgstr "Projekto failai"
|
|
|
|
#: lazarusidestrconsts:lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "Aptiktas projekto informacinis failas"
|
|
|
|
#: lazarusidestrconsts:lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Projektas yra vykdomasis"
|
|
|
|
#: lazarusidestrconsts:lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr "Projekto makrokomandos savybės"
|
|
|
|
#: lazarusidestrconsts:srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Menių \"Projektas\" komandos"
|
|
|
|
#: lazarusidestrconsts:lispkgmangproject
|
|
msgid "Project: %s"
|
|
msgstr "Projektui: %s"
|
|
|
|
#: lazarusidestrconsts:lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Kvietimas įvesti vertę"
|
|
|
|
#: lazarusidestrconsts:lisceproperties
|
|
msgid "Properties"
|
|
msgstr "Savybės"
|
|
|
|
#: lazarusidestrconsts:lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Savybės:"
|
|
|
|
#: lazarusidestrconsts:dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "\"Property\" užbaigimas"
|
|
|
|
#: lazarusidestrconsts:dlgpropnamecolor
|
|
msgid "Property name"
|
|
msgstr "Savybės vardas"
|
|
|
|
#: lazarusidestrconsts:lisprotected
|
|
msgid "Protected"
|
|
msgstr "Protected"
|
|
|
|
#: lazarusidestrconsts:lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr "Protected metodas"
|
|
|
|
#: lazarusidestrconsts:lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr "Pateiktys"
|
|
|
|
#: lazarusidestrconsts:lisemdpublic
|
|
msgid "Public"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr "Public metodas"
|
|
|
|
#: lazarusidestrconsts:lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Skelbti paketą"
|
|
|
|
#: lazarusidestrconsts:lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Skelbti projektą..."
|
|
|
|
#: lazarusidestrconsts:liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Skelbti projektą"
|
|
|
|
#: lazarusidestrconsts:lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Skelbiamo projekto katalogas"
|
|
|
|
#: lazarusidestrconsts:lisemdpublished
|
|
msgid "Published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr "Published metodas"
|
|
|
|
#: lazarusidestrconsts:lislazbuildquickbuildoptions
|
|
msgid "Quick Build Options"
|
|
msgstr "Lengvos darymo parinktys"
|
|
|
|
#: lazarusidestrconsts:lismenuquickcompile
|
|
msgid "Quick compile"
|
|
msgstr "Spartus kompiliavimas"
|
|
|
|
#: lazarusidestrconsts:liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr "Kompiliuoti greitai, nesaistyti"
|
|
|
|
#: lazarusidestrconsts:lismenuquicksyntaxcheck
|
|
msgid "Quick syntax check"
|
|
msgstr "Sparti sintaksės patikra"
|
|
|
|
#: lazarusidestrconsts:lismenuquit
|
|
msgid "Quit"
|
|
msgstr "Baigti darbą"
|
|
|
|
#: lazarusidestrconsts:lisquitlazarus
|
|
msgid "Quit Lazarus"
|
|
msgstr "Baigti Lazarus darbą"
|
|
|
|
#: lazarusidestrconsts:dlgcorange
|
|
msgid "Range"
|
|
msgstr "Rėžį"
|
|
|
|
#: lazarusidestrconsts:lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Išnaujo talpinti priklausinį"
|
|
|
|
#: lazarusidestrconsts:lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Išnaujo talpinti failą"
|
|
|
|
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Kompiliuoti išnaujo šį ir kitus reikiamus paketus?"
|
|
|
|
#: lazarusidestrconsts:lisreaderror
|
|
msgid "Read Error"
|
|
msgstr "Skaitymo klaida"
|
|
|
|
#: lazarusidestrconsts:uemreadonly
|
|
msgid "Read Only"
|
|
msgstr "Tik skaitymui"
|
|
|
|
#: lazarusidestrconsts:lispckeditreadonly
|
|
msgid "Read Only: %s"
|
|
msgstr "Tik skaitymui: %s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsreaderror
|
|
msgid "Read error"
|
|
msgstr "Klaida įkeliant"
|
|
|
|
#: lazarusidestrconsts:dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "\"Read\" prefiksas"
|
|
|
|
#: lazarusidestrconsts:uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Tik skaitymui"
|
|
|
|
#: lazarusidestrconsts:lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Daryti Lazarus išnaujo?"
|
|
|
|
#: lazarusidestrconsts:lisiecorecentfiles
|
|
msgid "Recent files"
|
|
msgstr "Paskutiniai naudoti"
|
|
|
|
#: lazarusidestrconsts:lispckeditrecompileallrequired
|
|
msgid "Recompile all required"
|
|
msgstr "Kompiliuoti visus būtinus"
|
|
|
|
#: lazarusidestrconsts:lispckeditrecompileclean
|
|
msgid "Recompile clean"
|
|
msgstr "Kompiliuoti išvalant"
|
|
|
|
#: lazarusidestrconsts:lisrecordstruct
|
|
msgid "Record/Structure"
|
|
msgstr "Įrašas/Struktūra"
|
|
|
|
#: lazarusidestrconsts:lismenuredo
|
|
msgid "Redo"
|
|
msgstr "Pakartoti"
|
|
|
|
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
|
|
msgid "Reduce designer painting"
|
|
msgstr "Sumažinti paišymą konstruktoriuje"
|
|
|
|
#: lazarusidestrconsts:uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Pertvarkymas"
|
|
|
|
#: lazarusidestrconsts:dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr "Paminėjimas"
|
|
|
|
#: lazarusidestrconsts:dlgunitdeprefresh
|
|
msgid "Refresh"
|
|
msgstr "Atnaujinti"
|
|
|
|
#: lazarusidestrconsts:lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Atnaujinti automatiškai"
|
|
|
|
#: lazarusidestrconsts:listodolistrefresh
|
|
msgid "Refresh todo items"
|
|
msgstr "Atnaujinti ToDo sąrašą"
|
|
|
|
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
|
|
msgid "Register procedure is nil"
|
|
msgstr "Procedūra Register yra nil"
|
|
|
|
#: lazarusidestrconsts:lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Registruoti modulį"
|
|
|
|
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
|
|
msgid "RegisterUnit was called, but no package is registering."
|
|
msgstr "Paleistas RegisterUnit, tačiau paketas nėra registruojamas."
|
|
|
|
#: lazarusidestrconsts:lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Registruoti įskiepiai"
|
|
|
|
#: lazarusidestrconsts:lispkgsysregistrationerror
|
|
msgid "Registration Error"
|
|
msgstr "Klaida registruojant"
|
|
|
|
#: lazarusidestrconsts:lisrelativepaths
|
|
msgid "Relative paths"
|
|
msgstr "Santykiniai keliai"
|
|
|
|
#: lazarusidestrconsts:lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Laida"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffrevertall
|
|
msgid "Reload from disk"
|
|
msgstr "Įkelti išnaujo"
|
|
|
|
#: lazarusidestrconsts:lisexttoolremove
|
|
msgid "Remove"
|
|
msgstr "Pašalinti"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedependency2
|
|
msgid "Remove Dependency?"
|
|
msgstr "Panaikinti priklausomybę?"
|
|
|
|
#: lazarusidestrconsts:liskmremoveactiveunitfromproject
|
|
msgid "Remove active unit from project"
|
|
msgstr "Pašalinti iš projekto aktyvųjį modulį"
|
|
|
|
#: lazarusidestrconsts:lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Pašalinti klaidingas savybes"
|
|
|
|
#: lazarusidestrconsts:liskmremovebreakpoint
|
|
msgid "Remove break point"
|
|
msgstr "Pašalinti stabdos tašką"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Pašalinti priklausinį"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
|
|
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
|
msgstr "Panaikinti priklausomybę %s%s%s%spaketui %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:srkmecremoveemptymethods
|
|
msgid "Remove empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Pašalinti failą"
|
|
|
|
#: lazarusidestrconsts:lisprojinspremovefilefromproject
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Pašalinti failą %s iš projekto?"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovefilefrompackage
|
|
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
|
msgstr "Išmesti failą %s%s%s%siš paketo %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Išmesti failą?"
|
|
|
|
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Pašalinti nurodytus failus"
|
|
|
|
#: lazarusidestrconsts:lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Pašalinti iš projekto..."
|
|
|
|
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
|
|
msgid "Remove from favourite properties"
|
|
msgstr "Pašalinti iš mėgstamiausiųjų savybių"
|
|
|
|
#: lazarusidestrconsts:lisremovefromproject
|
|
msgid "Remove from project"
|
|
msgstr "Pašalinti iš projekto"
|
|
|
|
#: lazarusidestrconsts:lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Pašalinti kelią"
|
|
|
|
#: lazarusidestrconsts:lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Pašalinti pažymėtą elementą"
|
|
|
|
#: lazarusidestrconsts:lisremovethem
|
|
msgid "Remove them"
|
|
msgstr "Pašalinti elementą"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
|
msgid "Removed Files (these entries are not saved to the lpk file)"
|
|
msgstr "Pašalinti failai (šie įrašai lpk faile neįrašyti)"
|
|
|
|
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
|
|
msgid "Removed required packages"
|
|
msgstr "Pašalinti reikiami paketai"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
|
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
|
msgstr "Pašalinti reikiami paketai (šie įrašai lpk faile neįrašyti)"
|
|
|
|
#: lazarusidestrconsts:lisfrirename
|
|
msgid "Rename"
|
|
msgstr "Pervardyti"
|
|
|
|
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr "Failo varde vien mažosios raidės?"
|
|
|
|
#: lazarusidestrconsts:uemrenameidentifier
|
|
msgid "Rename Identifier"
|
|
msgstr "Pervardyti identifikatorių"
|
|
|
|
#: lazarusidestrconsts:lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Pervardyti identifikatorių..."
|
|
|
|
#: lazarusidestrconsts:lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr "Pervardyti visus surastus"
|
|
|
|
#: lazarusidestrconsts:lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Nepavyko pervardyti failą"
|
|
|
|
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
|
|
msgid "Rename file in package?"
|
|
msgstr "Pervardinti failą pakete?"
|
|
|
|
#: lazarusidestrconsts:lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Pervardyti failą?"
|
|
|
|
#: lazarusidestrconsts:srkmecrenameidentifier
|
|
msgid "Rename identifier"
|
|
msgstr "Pervardyti identifikatorių"
|
|
|
|
#: lazarusidestrconsts:lisfrirenameto
|
|
msgid "Rename to"
|
|
msgstr "Pervardyti į"
|
|
|
|
#: lazarusidestrconsts:lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr "Pervardyti mažosiomis"
|
|
|
|
#: lazarusidestrconsts:lisrepeatcount
|
|
msgid "Repeat Count:"
|
|
msgstr "Kartojimų kiekis:"
|
|
|
|
#: lazarusidestrconsts:lismenureplace
|
|
msgid "Replace"
|
|
msgstr "Pakeisti"
|
|
|
|
#: lazarusidestrconsts:dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "P&akeisti visus"
|
|
|
|
#: lazarusidestrconsts:lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Pakeisti failą"
|
|
|
|
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
|
|
msgid "Replace existing file %s%s%s?"
|
|
msgstr "Pakeisti esamą failą %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:srkmecreplace
|
|
msgid "Replace text"
|
|
msgstr "Pakeisti tekstą"
|
|
|
|
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
|
|
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
|
msgstr "Pakeisti rastąjį %s%s%s%s į %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr "Pakeisti pažymėtąjį nepavyko."
|
|
|
|
#: lazarusidestrconsts:dlgreport
|
|
msgid "Report"
|
|
msgstr "Ataskaita"
|
|
|
|
#: lazarusidestrconsts:lismenureportingbug
|
|
msgid "Reporting a bug..."
|
|
msgstr "Pranešti apie ydą..."
|
|
|
|
#: lazarusidestrconsts:lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Būtini paketai"
|
|
|
|
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
|
|
msgid "Rescan FPC source directory"
|
|
msgstr "Peržvelgti FPC pirminio kodo katalogą"
|
|
|
|
#: lazarusidestrconsts:lisvsrresetresultlist
|
|
msgid "Reset Result List"
|
|
msgstr "Atstatyti rezultatų sąrašą"
|
|
|
|
#: lazarusidestrconsts:lismenuresetdebugger
|
|
msgid "Reset debugger"
|
|
msgstr "Atstatyti derintuvę pradžion"
|
|
|
|
#: lazarusidestrconsts:lisresourceloaderror
|
|
msgid "Resource load error"
|
|
msgstr "Klaida įkeliant resursus"
|
|
|
|
#: lazarusidestrconsts:lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Klaida išsaugojant resursus"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "Tokia resursų eilutė jau yra"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Išteklių eilutės sekcija:"
|
|
|
|
#: lazarusidestrconsts:lismenurestart
|
|
msgid "Restart"
|
|
msgstr "Startuoti išnaujo"
|
|
|
|
#: lazarusidestrconsts:lislazbuildrestartafterbuild
|
|
msgid "Restart after successful Build"
|
|
msgstr "Sėkmingai padarius, perstatuoti"
|
|
|
|
#: lazarusidestrconsts:rsiwprestorewindowgeometry
|
|
msgid "Restore window geometry"
|
|
msgstr "Atstatyti lango geometriją"
|
|
|
|
#: lazarusidestrconsts:rsiwprestorewindowsize
|
|
msgid "Restore window size"
|
|
msgstr "Atstatyti lango dydį"
|
|
|
|
#: lazarusidestrconsts:lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr "Apribojimų naršyklė"
|
|
|
|
#: lazarusidestrconsts:dlgccoresults
|
|
msgid "Results"
|
|
msgstr "Rezultatai"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmresume
|
|
msgid "Resume"
|
|
msgstr "Tęsti"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
|
|
msgid "Resume Handled"
|
|
msgstr "Tęsti apdorojant"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
|
|
msgid "Resume Unhandled"
|
|
msgstr "Tęsti praleidžiant"
|
|
|
|
#: lazarusidestrconsts:srvk_return
|
|
msgid "Return"
|
|
msgstr "Return"
|
|
|
|
#: lazarusidestrconsts:lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Atstatyti"
|
|
|
|
#: lazarusidestrconsts:lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Atstatyti nepavyko"
|
|
|
|
#: lazarusidestrconsts:lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Atstatyti paketą?"
|
|
|
|
#: lazarusidestrconsts:srvk_right
|
|
msgid "Right"
|
|
msgstr "Right"
|
|
|
|
#: lazarusidestrconsts:dlgrightclickselects
|
|
msgid "Right Click selects"
|
|
msgstr "Dešinysis pelės spustelėjimas pažymi"
|
|
|
|
#: lazarusidestrconsts:lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Dešinės prieraiša"
|
|
|
|
#: lazarusidestrconsts:lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr ""
|
|
"Dešinės kraštinės plotis.\n"
|
|
"Ši vertė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą dešiniosios kraštinės plotį."
|
|
|
|
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
|
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
|
msgstr "Spustelėje dešinį pelės mygtuką ant medžio elemento iššoks meniu su visomis galimomis paketo funkcijomis."
|
|
|
|
#: lazarusidestrconsts:dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "Dešinioji paraštė"
|
|
|
|
#: lazarusidestrconsts:dlgrightmargincolor
|
|
msgid "Right margin color"
|
|
msgstr "Dešiniosios paraštės spalva"
|
|
|
|
#: lazarusidestrconsts:dlgrightmousemovescursor
|
|
msgid "Right mouse moves caret"
|
|
msgstr "Spragtelėjus dešinį pelės mygtuką perkeliamas žymeklis"
|
|
|
|
#: lazarusidestrconsts:lisrightsides
|
|
msgid "Right sides"
|
|
msgstr "Sutapdinti dešiniuosius kraštus"
|
|
|
|
#: lazarusidestrconsts:lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr "Tolygiai rikiuoti pagal dešiniuosius kraštus"
|
|
|
|
#: lazarusidestrconsts:dlgrubberbandgroup
|
|
msgid "Rubber band"
|
|
msgstr "Žymėjimo rėmelis"
|
|
|
|
#: lazarusidestrconsts:lismenuprojectrun
|
|
msgid "Run"
|
|
msgstr "Startuoti"
|
|
|
|
#: lazarusidestrconsts:lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr "Startavimo komanda"
|
|
|
|
#: lazarusidestrconsts:lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Startuoti failą"
|
|
|
|
#: lazarusidestrconsts:lismenurunparameters
|
|
msgid "Run Parameters ..."
|
|
msgstr "Startavimo parametrai..."
|
|
|
|
#: lazarusidestrconsts:srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Meniu \"Startuoti\" komandos"
|
|
|
|
#: lazarusidestrconsts:dlgrunparameters
|
|
msgid "Run parameters"
|
|
msgstr "Starto parametrai"
|
|
|
|
#: lazarusidestrconsts:liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Startuoti programą"
|
|
|
|
#: lazarusidestrconsts:lismenuruntocursor
|
|
msgid "Run to cursor"
|
|
msgstr "Startuoti iki žymeklio"
|
|
|
|
#: lazarusidestrconsts:lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Nepavyko Startuoti-Iki"
|
|
|
|
#: lazarusidestrconsts:lispckoptsruntimeonly
|
|
msgid "Runtime only"
|
|
msgstr "Tik vykdymo metu"
|
|
|
|
#: lazarusidestrconsts:rslanguagerussian
|
|
msgid "Russian"
|
|
msgstr "Rusų"
|
|
|
|
#: lazarusidestrconsts:lissvnrevision
|
|
msgid "SVN Revision: "
|
|
msgstr "SVN poversijis:"
|
|
|
|
#: lazarusidestrconsts:dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Tokspat vardas (pakatalogyje)"
|
|
|
|
#: lazarusidestrconsts:lismenusave
|
|
msgid "Save"
|
|
msgstr "Įrašyti"
|
|
|
|
#: lazarusidestrconsts:lissavespace
|
|
msgid "Save "
|
|
msgstr "Įrašyti "
|
|
|
|
#: lazarusidestrconsts:lissave
|
|
msgid "Save ..."
|
|
msgstr "Įrašyti..."
|
|
|
|
#: lazarusidestrconsts:lismenusaveall
|
|
msgid "Save All"
|
|
msgstr "Įrašyti visus"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatesaveas
|
|
msgid "Save As"
|
|
msgstr "Įrašyti taip"
|
|
|
|
#: lazarusidestrconsts:dlgcharcasefileact
|
|
msgid "Save As - auto rename pascal files lower case"
|
|
msgstr "Išsaugant kitaip paskalio failus automatiškai pervardyti mažosiomis raidėmis"
|
|
|
|
#: lazarusidestrconsts:lismenusaveas
|
|
msgid "Save As ..."
|
|
msgstr "Įrašyti taip..."
|
|
|
|
#: lazarusidestrconsts:lismenueditorsaveastemplate
|
|
msgid "Save As Template..."
|
|
msgstr "Įrašyti kaip šabloną..."
|
|
|
|
#: lazarusidestrconsts:lispckeditsavechanges
|
|
msgid "Save Changes?"
|
|
msgstr "Įrašyti pakeitimus?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangsavepackagelpk
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Įrašyti paketą %s (*.lpk)"
|
|
|
|
#: lazarusidestrconsts:lispkgmangsavepackage
|
|
msgid "Save Package?"
|
|
msgstr "Įrašyti paketą?"
|
|
|
|
#: lazarusidestrconsts:lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Įrašyti projektą"
|
|
|
|
#: lazarusidestrconsts:lissaveprojectlpi
|
|
msgid "Save Project %s (*.lpi)"
|
|
msgstr "Įrašyti projektą %s (.lpi)"
|
|
|
|
#: lazarusidestrconsts:lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Projektą įrašyti taip..."
|
|
|
|
#: lazarusidestrconsts:lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Įrašyti nuostatas"
|
|
|
|
#: lazarusidestrconsts:lishintsaveall
|
|
msgid "Save all"
|
|
msgstr "Įrašyti visus"
|
|
|
|
#: lazarusidestrconsts:lissaveallmessagestofile
|
|
msgid "Save all messages to file"
|
|
msgstr "Visus pranešimus įrašyti failan"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
|
|
msgid "Save and Exit"
|
|
msgstr "Įrašyti ir išeiti"
|
|
|
|
#: lazarusidestrconsts:lissaveandexitdialog
|
|
msgid "Save and exit dialog"
|
|
msgstr "Įrašyti ir uždaryti"
|
|
|
|
#: lazarusidestrconsts:lissaveandrebuildide
|
|
msgid "Save and rebuild IDE"
|
|
msgstr "Įrašyti ir daryti IKA"
|
|
|
|
#: lazarusidestrconsts:lissavechangestoproject
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Įrašyti pakeitimus projekte %s?"
|
|
|
|
#: lazarusidestrconsts:lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Įrašyti pakeitimus?"
|
|
|
|
#: lazarusidestrconsts:dlgsavedfile
|
|
msgid "Save desktop settings to file"
|
|
msgstr "Įrašyti darbastalio nustatas faile"
|
|
|
|
#: lazarusidestrconsts:dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Įrašyti redaktoriaus informaciją apie užvertus failus"
|
|
|
|
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
|
|
msgid "Save editor info of non project files"
|
|
msgstr "Įrašyti redaktoriaus informaciją apie projektui nepriklausančius failus"
|
|
|
|
#: lazarusidestrconsts:dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Įrašyti redaktoriaus informaciją tik apie projekto failus"
|
|
|
|
#: lazarusidestrconsts:lissavefilebeforeclosingform
|
|
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
|
msgstr "Įrašyti failą %s%s%s%sprieš užveriant formą %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lissavefileas
|
|
msgid "Save file as"
|
|
msgstr "Įrašyti failą taip"
|
|
|
|
#: lazarusidestrconsts:lisa2psavefiledialog
|
|
msgid "Save file dialog"
|
|
msgstr "Įrašyti failą"
|
|
|
|
#: lazarusidestrconsts:fdmsaveformasxml
|
|
msgid "Save form as xml"
|
|
msgstr "Įrašyti formą kaip xml"
|
|
|
|
#: lazarusidestrconsts:lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "Įrašyti .lpi faile"
|
|
|
|
#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr "Įrašyti .lps faile, projekto kataloge"
|
|
|
|
#: lazarusidestrconsts:lisposaveinideconfigdirectory
|
|
msgid "Save in IDE config directory"
|
|
msgstr "Įrašyti IKA nustatymų kataloge"
|
|
|
|
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
|
|
msgid "Save info of closed editor files"
|
|
msgstr "Įrašyti informaciją apie užvertus redaktoriaus failus"
|
|
|
|
#: lazarusidestrconsts:lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Įrašyti pranešimus faile (*.txt)"
|
|
|
|
#: lazarusidestrconsts:lispckeditsavepackage
|
|
msgid "Save package"
|
|
msgstr "Įrašyti paketą"
|
|
|
|
#: lazarusidestrconsts:lispkgmangsavepackage2
|
|
msgid "Save package?"
|
|
msgstr "Įrašyti paketą?"
|
|
|
|
#: lazarusidestrconsts:liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Įrašyti projektą"
|
|
|
|
#: lazarusidestrconsts:liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr "Įrašyti projektą taip"
|
|
|
|
#: lazarusidestrconsts:lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Sesijos informaciją įrašyti į"
|
|
|
|
#: lazarusidestrconsts:lislazbuildsavesettings
|
|
msgid "Save settings"
|
|
msgstr "Įrašyti nuostatas"
|
|
|
|
#: lazarusidestrconsts:lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Įrašyti faile"
|
|
|
|
#: lazarusidestrconsts:lisiecosavetorecent
|
|
msgid "Save to recent"
|
|
msgstr "Įrašyti paskutinįsyk naudotame"
|
|
|
|
#: lazarusidestrconsts:liskmsaveall
|
|
msgid "SaveAll"
|
|
msgstr "Įrašyti visus"
|
|
|
|
#: lazarusidestrconsts:liskmsaveas
|
|
msgid "SaveAs"
|
|
msgstr "Įrašyti taip"
|
|
|
|
#: lazarusidestrconsts:fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Mastelis"
|
|
|
|
#: lazarusidestrconsts:lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr "Santykinis mastelis:"
|
|
|
|
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
|
|
msgid "Scan Unit for Unit Name and Register procedure"
|
|
msgstr "Modulyje ieškoti modulio vardo ir užregistruoti procedūrą"
|
|
|
|
#: lazarusidestrconsts:liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Ieškoti FPC pranešimų"
|
|
|
|
#: lazarusidestrconsts:liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Ieškoti Make pranešimų"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
msgid "Scan output for Free Pascal Compiler messages"
|
|
msgstr "Išvestyje ieškoti FreePascalCompiler pranešimų"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
|
|
msgid "Scan output for make messages"
|
|
msgstr "Išvestyje ieškoti make pranešimų"
|
|
|
|
#: lazarusidestrconsts:dlgscope
|
|
msgid "Scope"
|
|
msgstr "Sritis"
|
|
|
|
#: lazarusidestrconsts:srvk_scroll
|
|
msgid "Scroll"
|
|
msgstr "Sroll"
|
|
|
|
#: lazarusidestrconsts:dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Slenkant per lapą slinkti viena eilute mažiau"
|
|
|
|
#: lazarusidestrconsts:srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Slinkti žemyn per vieną eilutę"
|
|
|
|
#: lazarusidestrconsts:srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Slinkti kairėn per vieną simbolį"
|
|
|
|
#: lazarusidestrconsts:dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Failo pabaiga nesustabdo slinkties"
|
|
|
|
#: lazarusidestrconsts:dlgscrollpastendline
|
|
msgid "Scroll past end of line"
|
|
msgstr "Eilutės pabaiga nesustabdo slinkties"
|
|
|
|
#: lazarusidestrconsts:srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Slinkti dešinėn per vieną simbolį"
|
|
|
|
#: lazarusidestrconsts:srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Slinkti aukštyn per vieną eilutę"
|
|
|
|
#: lazarusidestrconsts:lissearchfor
|
|
msgid "Search For "
|
|
msgstr "Ko ieškoti"
|
|
|
|
#: lazarusidestrconsts:lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Ieškos rezultatai"
|
|
|
|
#: lazarusidestrconsts:lissearchagain
|
|
msgid "Search again"
|
|
msgstr "Ieškoti toliau"
|
|
|
|
#: lazarusidestrconsts:lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr "Taip pat ir komentaruose"
|
|
|
|
#: lazarusidestrconsts:lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
|
|
msgid "Search or Filter Phrases In List"
|
|
msgstr "Ieškoti arba filtruoti žodžius sąraše"
|
|
|
|
#: lazarusidestrconsts:lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Ieškos keliai:"
|
|
|
|
#: lazarusidestrconsts:lisuesearchstringnotfound
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Ieškomasis tekstas %s nerastas!"
|
|
|
|
#: lazarusidestrconsts:dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Iešką nutraukė naudotojas."
|
|
|
|
#: lazarusidestrconsts:lisssearchtext
|
|
msgid "Search text"
|
|
msgstr "Teksto paieška"
|
|
|
|
#: lazarusidestrconsts:lisfrisearchwhere
|
|
msgid "Search where"
|
|
msgstr "Kur ieškoti"
|
|
|
|
#: lazarusidestrconsts:lisssearching
|
|
msgid "Searching"
|
|
msgstr "Ieškoma"
|
|
|
|
#: lazarusidestrconsts:dlgsearchcaption
|
|
msgid "Searching..."
|
|
msgstr "Ieškoma..."
|
|
|
|
#: lazarusidestrconsts:lisuesearching
|
|
msgid "Searching: %s"
|
|
msgstr "Ieškoma: %s"
|
|
|
|
#: lazarusidestrconsts:liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Taip pat žiūrėkite"
|
|
|
|
#: lazarusidestrconsts:lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Peržvelkit pranešimus."
|
|
|
|
#: lazarusidestrconsts:srkmecselleft
|
|
msgid "SelLeft"
|
|
msgstr "Žymėti simboliu kairiau"
|
|
|
|
#: lazarusidestrconsts:srkmecselright
|
|
msgid "SelRight"
|
|
msgstr "Žymėti simboliu dešiniau"
|
|
|
|
#: lazarusidestrconsts:lismenuselect
|
|
msgid "Select"
|
|
msgstr "Žymėjimas"
|
|
|
|
#: lazarusidestrconsts:srkmecselectall
|
|
msgid "Select All"
|
|
msgstr "Žymėti viską"
|
|
|
|
#: lazarusidestrconsts:lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr "Išrink kodo makrokomandą"
|
|
|
|
#: lazarusidestrconsts:lisselectdfmfiles
|
|
msgid "Select Delphi form files (*.dfm)"
|
|
msgstr "Nurodykite Delphi formos failus (*.dfm)"
|
|
|
|
#: lazarusidestrconsts:srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Žymėti eilute žemiau"
|
|
|
|
#: lazarusidestrconsts:srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr "Žymėti ir eiti į XY"
|
|
|
|
#: lazarusidestrconsts:srkmecsellineend
|
|
msgid "Select Line End"
|
|
msgstr "Žymėti iki eilutės galo"
|
|
|
|
#: lazarusidestrconsts:srkmecsellinestart
|
|
msgid "Select Line Start"
|
|
msgstr "Žymėti iki eilutės pradžios"
|
|
|
|
#: lazarusidestrconsts:lismenueditorselectmenu
|
|
msgid "Select Menu:"
|
|
msgstr "Rinkitės menių:"
|
|
|
|
#: lazarusidestrconsts:srkmecselpagebottom
|
|
msgid "Select Page Bottom"
|
|
msgstr "Žymėti iki lapo apačios"
|
|
|
|
#: lazarusidestrconsts:srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Žymėti lapu žemiau"
|
|
|
|
#: lazarusidestrconsts:srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Žymėti lapu kairiau"
|
|
|
|
#: lazarusidestrconsts:srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "Žymėti lapu dešiniau"
|
|
|
|
#: lazarusidestrconsts:srkmecselpagetop
|
|
msgid "Select Page Top"
|
|
msgstr "Žymėti iki lapo viršaus"
|
|
|
|
#: lazarusidestrconsts:srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Žymėti lapu aukščiau"
|
|
|
|
#: lazarusidestrconsts:lismenueditorselecttemplate
|
|
msgid "Select Template:"
|
|
msgstr "Rinkitės šabloną:"
|
|
|
|
#: lazarusidestrconsts:srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Žymėti eilute aukščiau"
|
|
|
|
#: lazarusidestrconsts:srkmecselwordleft
|
|
msgid "Select Word Left"
|
|
msgstr "Žymėti žodžiu kairiau"
|
|
|
|
#: lazarusidestrconsts:srkmecselwordright
|
|
msgid "Select Word Right"
|
|
msgstr "Žymėti žodžiu dešiniau"
|
|
|
|
#: lazarusidestrconsts:lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr "Rinkitės žinyno elementą:"
|
|
|
|
#: lazarusidestrconsts:lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Pažymėkit mazgą"
|
|
|
|
#: lazarusidestrconsts:lisnpselectaprojecttype
|
|
msgid "Select a project type"
|
|
msgstr "Pasirinkite projekto tipą"
|
|
|
|
#: lazarusidestrconsts:lismenuselectall
|
|
msgid "Select all"
|
|
msgstr "Pažymėti viską"
|
|
|
|
#: lazarusidestrconsts:lismenuselectcodeblock
|
|
msgid "Select code block"
|
|
msgstr "Pažymėti kodo bloką"
|
|
|
|
#: lazarusidestrconsts:lispatheditselectdirectory
|
|
msgid "Select directory"
|
|
msgstr "Rinkitės katalogą"
|
|
|
|
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
|
|
msgid "Select grand childs"
|
|
msgstr "Žymėti provaikius"
|
|
|
|
#: lazarusidestrconsts:lismenuselectline
|
|
msgid "Select line"
|
|
msgstr "Pažymėti eilutę"
|
|
|
|
#: lazarusidestrconsts:liskmselectlineend
|
|
msgid "Select line end"
|
|
msgstr "Žymėti iki eilutės galo"
|
|
|
|
#: lazarusidestrconsts:liskmselectlinestart
|
|
msgid "Select line start"
|
|
msgstr "Žymėti iki eilutės pradžios"
|
|
|
|
#: lazarusidestrconsts:lissamselectnone
|
|
msgid "Select none"
|
|
msgstr "Nuimti žymėjimą"
|
|
|
|
#: lazarusidestrconsts:liskmselectpagebottom
|
|
msgid "Select page bottom"
|
|
msgstr "Žymėti iki lapo apačios"
|
|
|
|
#: lazarusidestrconsts:liskmselectpagetop
|
|
msgid "Select page top"
|
|
msgstr "Žymėti iki lapo viršaus"
|
|
|
|
#: lazarusidestrconsts:lismenuselectparagraph
|
|
msgid "Select paragraph"
|
|
msgstr "Pažymėti paragrafą"
|
|
|
|
#: lazarusidestrconsts:lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Pažymėkite tėvinę komponentę"
|
|
|
|
#: lazarusidestrconsts:lisselectfile
|
|
msgid "Select the file"
|
|
msgstr "Pažymėti failą"
|
|
|
|
#: lazarusidestrconsts:srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Žymėti iki absoliučios pradžios"
|
|
|
|
#: lazarusidestrconsts:srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Žymėti iki absoliučios pabaigos"
|
|
|
|
#: lazarusidestrconsts:lismenuselecttobrace
|
|
msgid "Select to brace"
|
|
msgstr "Pažymėti iki skliaustelio"
|
|
|
|
#: lazarusidestrconsts:lismenuselectword
|
|
msgid "Select word"
|
|
msgstr "Pažymėti žodį"
|
|
|
|
#: lazarusidestrconsts:liskmselectwordleft
|
|
msgid "Select word left"
|
|
msgstr "Pažymėti žodį kairėje"
|
|
|
|
#: lazarusidestrconsts:liskmselectwordright
|
|
msgid "Select word right"
|
|
msgstr "Pažymėti žodį dešinėje"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Pažymėtas mazgas:"
|
|
|
|
#: lazarusidestrconsts:lispckexplisrequiredby
|
|
msgid "Selected package is required by:"
|
|
msgstr "Pažymėtojo paketo reikia:"
|
|
|
|
#: lazarusidestrconsts:dlgruberbandselectioncolor
|
|
msgid "Selection"
|
|
msgstr "Žymėjimas"
|
|
|
|
#: lazarusidestrconsts:lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Pažymėta daugiau nei eilutės konstanta"
|
|
|
|
#: lazarusidestrconsts:lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Žymėjimo įrankis"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Kabliataškis"
|
|
|
|
#: lazarusidestrconsts:dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Sesija"
|
|
|
|
#: lazarusidestrconsts:srkmecsetmarker
|
|
msgid "Set Marker %d"
|
|
msgstr "Uždėti žymeklį %d"
|
|
|
|
#: lazarusidestrconsts:uemsetfreebookmark
|
|
msgid "Set a free Bookmark"
|
|
msgstr "Padėti laisvą žymę"
|
|
|
|
#: lazarusidestrconsts:lismenusetfreebookmark
|
|
msgid "Set a free bookmark"
|
|
msgstr "Padėti laisvą žymę"
|
|
|
|
#: lazarusidestrconsts:dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Visiems priskirti numatytas vertes"
|
|
|
|
#: lazarusidestrconsts:dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Priskirti numatytą vertę"
|
|
|
|
#: lazarusidestrconsts:liskmsetfreebookmark
|
|
msgid "Set free Bookmark"
|
|
msgstr "Padėti laisvą žymę"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker0
|
|
msgid "Set marker 0"
|
|
msgstr "Uždėti žymeklį 0"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker1
|
|
msgid "Set marker 1"
|
|
msgstr "Uždėti žymeklį 1"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker2
|
|
msgid "Set marker 2"
|
|
msgstr "Uždėti žymeklį 2"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker3
|
|
msgid "Set marker 3"
|
|
msgstr "Uždėti žymeklį 3"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker4
|
|
msgid "Set marker 4"
|
|
msgstr "Uždėti žymeklį 4"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker5
|
|
msgid "Set marker 5"
|
|
msgstr "Uždėti žymeklį 5"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker6
|
|
msgid "Set marker 6"
|
|
msgstr "Uždėti žymeklį 6"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker7
|
|
msgid "Set marker 7"
|
|
msgstr "Uždėti žymeklį 7"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker8
|
|
msgid "Set marker 8"
|
|
msgstr "Uždėti žymeklį 8"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker9
|
|
msgid "Set marker 9"
|
|
msgstr "Uždėti žymeklį 9"
|
|
|
|
#: lazarusidestrconsts:dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "\"Set\" kintamojo vardas"
|
|
|
|
#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr "Vistiek padėti stabdos tašką"
|
|
|
|
#: lazarusidestrconsts:srvk_shift
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts:srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr "Shift Tab"
|
|
|
|
#: lazarusidestrconsts:liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr "Santrumpa"
|
|
|
|
#: lazarusidestrconsts:liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr "Trumpas aprašymas"
|
|
|
|
#: lazarusidestrconsts:lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr "Suskleisti ar išplėsti failo vardą"
|
|
|
|
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
|
|
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
|
msgstr "Failo vardą rašyti vien mažosiomis raidėmis:%s%s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisshow
|
|
msgid "Show"
|
|
msgstr "Rodyti"
|
|
|
|
#: lazarusidestrconsts:lisaf2pshowall
|
|
msgid "Show All"
|
|
msgstr "Rodyti visus"
|
|
|
|
#: lazarusidestrconsts:liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr "Rodyti kategorijas"
|
|
|
|
#: lazarusidestrconsts:lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Rodyti CodeTools vertes"
|
|
|
|
#: lazarusidestrconsts:dlgcoshowerr
|
|
msgid "Show Errors"
|
|
msgstr "Rodyti klaidas"
|
|
|
|
#: lazarusidestrconsts:dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Rodyti pagalbines linijas"
|
|
|
|
#: lazarusidestrconsts:dlgshowhint
|
|
msgid "Show Hints"
|
|
msgstr "Rodyti užuominas"
|
|
|
|
#: lazarusidestrconsts:dlghintsparametersendernotused
|
|
msgid "Show Hints for parameter \"Sender\" not used"
|
|
msgstr "Rodyti užuominas apie nenaudojamus \"Sender\" parametrus"
|
|
|
|
#: lazarusidestrconsts:dlghintsunused
|
|
msgid "Show Hints for unused units in main source"
|
|
msgstr "Rodyti užuominas apie pagrindiniame pirminiame kode nenaudojamus modulius"
|
|
|
|
#: lazarusidestrconsts:uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Rodyti eilučių numerius"
|
|
|
|
#: lazarusidestrconsts:dlgshownotes
|
|
msgid "Show Notes"
|
|
msgstr "Rodyti pastabas"
|
|
|
|
#: lazarusidestrconsts:dlgcoshowoptions
|
|
msgid "Show Options"
|
|
msgstr "Rodyti parinktis"
|
|
|
|
#: lazarusidestrconsts:fdmshowoptions
|
|
msgid "Show Options for form editing"
|
|
msgstr "Formos konstravimo parinktys"
|
|
|
|
#: lazarusidestrconsts:liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr "Rodyti pirminio kodo mazgus"
|
|
|
|
#: lazarusidestrconsts:dlgshowwarnings
|
|
msgid "Show Warnings"
|
|
msgstr "Rodyti perspėjimus"
|
|
|
|
#: lazarusidestrconsts:srkmecshowabstractmethods
|
|
msgid "Show abstract methods"
|
|
msgstr "Rodyti abstrakčius metodus"
|
|
|
|
#: lazarusidestrconsts:lisa2pshowall
|
|
msgid "Show all"
|
|
msgstr "Rodyti visus"
|
|
|
|
#: lazarusidestrconsts:liscoshowallmessages
|
|
msgid "Show all messages"
|
|
msgstr "Rodyti visus pranešimus"
|
|
|
|
#: lazarusidestrconsts:dlgshowprocserror
|
|
msgid "Show all procs on error"
|
|
msgstr "Įvykus klaidai rodyti visus procedūrų paskelbimus"
|
|
|
|
#: lazarusidestrconsts:dlgqshowborderspacing
|
|
msgid "Show border spacing"
|
|
msgstr "Rodyti rėmelio plotį"
|
|
|
|
#: lazarusidestrconsts:dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Redaktoriaus kortelėse rodyti \"Užverti\" mygtukus"
|
|
|
|
#: lazarusidestrconsts:srkmecshowcodecontext
|
|
msgid "Show code context"
|
|
msgstr "Rodyti kodo turinį"
|
|
|
|
#: lazarusidestrconsts:dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Rodyti kompiliuotas procedūras"
|
|
|
|
#: lazarusidestrconsts:dlgshowcompileroptions
|
|
msgid "Show compiler options"
|
|
msgstr "Rodyti kompiliatoriaus parinktis"
|
|
|
|
#: lazarusidestrconsts:dlgshowcaps
|
|
msgid "Show component captions"
|
|
msgstr "Rodyti komponenčių antraštes"
|
|
|
|
#: lazarusidestrconsts:dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Rodyti sąlygines instrukcijas"
|
|
|
|
#: lazarusidestrconsts:dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Rodyti derinimo informaciją"
|
|
|
|
#: lazarusidestrconsts:dlgshowdefinedmacros
|
|
msgid "Show defined macros"
|
|
msgstr "Rodyti "
|
|
|
|
#: lazarusidestrconsts:dlgshowedrhints
|
|
msgid "Show editor hints"
|
|
msgstr "Redaktoriuje rodyti informacinius langelius"
|
|
|
|
#: lazarusidestrconsts:liscodehelpshowemptymethods
|
|
msgid "Show empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Rodyti viską"
|
|
|
|
#: lazarusidestrconsts:dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Rodyti vykdomosios bylos informaciją (tik Win32)"
|
|
|
|
#: lazarusidestrconsts:dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Rodyti pagrindinę informaciją"
|
|
|
|
#: lazarusidestrconsts:lispldshowgloballinks
|
|
msgid "Show global links"
|
|
msgstr "Rodyti globalius saitus"
|
|
|
|
#: lazarusidestrconsts:dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Rodyti tinklelį"
|
|
|
|
#: lazarusidestrconsts:dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Rodyti kairiosios paraštės informacinius langelius"
|
|
|
|
#: lazarusidestrconsts:lisshowhintsinobjectinspector
|
|
msgid "Show hints in Object Inspector"
|
|
msgstr "Rodyti informacinius langelius objektų inspektoriuje"
|
|
|
|
#: lazarusidestrconsts:lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr "Rodyti identifikatorius"
|
|
|
|
#: lazarusidestrconsts:dlgshowlinenumbers
|
|
msgid "Show line numbers"
|
|
msgstr "Rodyti eilučių numerius"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Rodyti pranešimą sustabdžius"
|
|
|
|
#: lazarusidestrconsts:dlgshownothing
|
|
msgid "Show nothing (only errors)"
|
|
msgstr "Slėpti viską (išskyrus klaidas)"
|
|
|
|
#: lazarusidestrconsts:lisshowoldtaborder
|
|
msgid "Show old tab order"
|
|
msgstr "Rodyti buvusią vietą tabuliatoriaus eilėje"
|
|
|
|
#: lazarusidestrconsts:lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Rodyti paketus"
|
|
|
|
#: lazarusidestrconsts:dlgshowscrollhint
|
|
msgid "Show scroll hint"
|
|
msgstr "Slenkant rodyti informacinį langelį"
|
|
|
|
#: lazarusidestrconsts:dlgshowsummary
|
|
msgid "Show summary"
|
|
msgstr "Rodyti apibendrinimą"
|
|
|
|
#: lazarusidestrconsts:dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Rodyti apibrėžtas makrokomandas"
|
|
|
|
#: lazarusidestrconsts:lisshowunits
|
|
msgid "Show units"
|
|
msgstr "Rodyti modulius"
|
|
|
|
#: lazarusidestrconsts:dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Rodyti naudojamus failus"
|
|
|
|
#: lazarusidestrconsts:lispldshowuserlinks
|
|
msgid "Show user links"
|
|
msgstr "Rodyti vartotojo saitus"
|
|
|
|
#: lazarusidestrconsts:lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr "Sutraukti iki mažiausio"
|
|
|
|
#: lazarusidestrconsts:lissibling
|
|
msgid "Sibling"
|
|
msgstr "Kaimynas"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Signalai"
|
|
|
|
#: lazarusidestrconsts:lissimplesyntax
|
|
msgid "Simple Syntax"
|
|
msgstr "Paprasta sintaksė"
|
|
|
|
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Paprasta sintaksė (pvz.: * vietoje .*)"
|
|
|
|
#: lazarusidestrconsts:fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Dydis"
|
|
|
|
#: lazarusidestrconsts:lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Dydis:"
|
|
|
|
#: lazarusidestrconsts:lisccoskip
|
|
msgid "Skip"
|
|
msgstr "Praleisti"
|
|
|
|
#: lazarusidestrconsts:liscoskipcallingcompiler
|
|
msgid "Skip calling Compiler"
|
|
msgstr "Nešaukti kompiliatoriaus"
|
|
|
|
#: lazarusidestrconsts:lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr "Tęsti įkrovą praleidžiant failą"
|
|
|
|
#: lazarusidestrconsts:lisskiploadinglastproject
|
|
msgid "Skip loading last project"
|
|
msgstr "Neįkelti paskutinio naudoto projekto"
|
|
|
|
#: lazarusidestrconsts:lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr "Praleisti šį paketą"
|
|
|
|
#: lazarusidestrconsts:rslanguageslovak
|
|
msgid "Slovak"
|
|
msgstr "Slovakų"
|
|
|
|
#: lazarusidestrconsts:dlgcosmaller
|
|
msgid "Smaller Code"
|
|
msgstr "Mažesnį kodą"
|
|
|
|
#: lazarusidestrconsts:dlgcosmartlinkable
|
|
msgid "Smart Linkable"
|
|
msgstr "Saistoma sumaniai"
|
|
|
|
#: lazarusidestrconsts:dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr "Gudrus tabuliatorius"
|
|
|
|
#: lazarusidestrconsts:dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "Pritraukti prie pagalbinių linijų"
|
|
|
|
#: lazarusidestrconsts:dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Pritraukti prie tinklelio taškų"
|
|
|
|
#: lazarusidestrconsts:srvk_snapshot
|
|
msgid "Snapshot"
|
|
msgstr "Snapshot"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Kai kurie failai buvo pakeisti iš išorės:"
|
|
|
|
#: lazarusidestrconsts:lissorrynotimplementedyet
|
|
msgid "Sorry, not implemented yet"
|
|
msgstr "Deja, dar neįgyvendinta"
|
|
|
|
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Deja, šis tipas dar neįgyvendintas"
|
|
|
|
#: lazarusidestrconsts:lispesortfiles
|
|
msgid "Sort files"
|
|
msgstr "Rūšiuoti failus"
|
|
|
|
#: lazarusidestrconsts:lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Rūšiuoti pažymėtą"
|
|
|
|
#: lazarusidestrconsts:lismenusortselection
|
|
msgid "Sort selection ..."
|
|
msgstr "Rūšiuoti pažymėtą..."
|
|
|
|
#: lazarusidestrconsts:lisceomodesource
|
|
msgid "Source"
|
|
msgstr "Pirminis kodas"
|
|
|
|
#: lazarusidestrconsts:lismenuviewsourceeditor
|
|
msgid "Source Editor"
|
|
msgstr "Pirminio kodo redaktorius"
|
|
|
|
#: lazarusidestrconsts:srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Pirminio kodo redaktoriaus komandos"
|
|
|
|
#: lazarusidestrconsts:lissourceanddestinationarethesame
|
|
msgid "Source and Destination are the same:%s%s"
|
|
msgstr "Šaltinis ir tikslas sutampa:%s%s"
|
|
|
|
#: lazarusidestrconsts:lismenuaddbpsource
|
|
msgid "Source breakpoint"
|
|
msgstr "Stabdos taškas pirminiame kode"
|
|
|
|
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
|
|
msgid "Source directory %s%s%s does not exist."
|
|
msgstr "Pirminio kodo katalogas %s%s%s neegzistuoja."
|
|
|
|
#: lazarusidestrconsts:lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Pirminis kodas pakeistas"
|
|
|
|
#: lazarusidestrconsts:lissourceofpagehaschangedsave
|
|
msgid "Source of page %s%s%s has changed. Save?"
|
|
msgstr "Pirminis kodas lape %s%s%s pakeistas. Įrašyti?"
|
|
|
|
#: lazarusidestrconsts:lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Keliai iki pirminio kodo"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Pirminio kodo peržiūra"
|
|
|
|
#: lazarusidestrconsts:dlgspacenotcosmos
|
|
msgid "Space"
|
|
msgstr "Tarpo simbolis"
|
|
|
|
#: lazarusidestrconsts:lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Vienodais tarpais tarp elementu"
|
|
|
|
#: lazarusidestrconsts:srvk_space
|
|
msgid "Space key"
|
|
msgstr "Space klavišas"
|
|
|
|
#: lazarusidestrconsts:rslanguagespanish
|
|
msgid "Spanish"
|
|
msgstr "Ispanų"
|
|
|
|
#: lazarusidestrconsts:lisuidsrc
|
|
msgid "Src"
|
|
msgstr "Pirm.kod."
|
|
|
|
#: lazarusidestrconsts:dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Dėklą"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
|
|
msgid "Standard Edit Menu"
|
|
msgstr "Standartinis redaktoriaus meniu"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
|
|
msgid "Standard File Menu"
|
|
msgstr "Standartinis failo meniu"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
|
|
msgid "Standard Help Menu"
|
|
msgstr "Standartinis žinyno meniu"
|
|
|
|
#: lazarusidestrconsts:lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr "Startuti su nauju projektu"
|
|
|
|
#: lazarusidestrconsts:lisstarter
|
|
msgid "Starter"
|
|
msgstr "Paleidimo programa"
|
|
|
|
#: lazarusidestrconsts:lisoipstate
|
|
msgid "State"
|
|
msgstr "Būsena"
|
|
|
|
#: lazarusidestrconsts:dlgstatickeyword
|
|
msgid "Static Keyword in Objects"
|
|
msgstr "Objektuose statiniai raktažodžiai"
|
|
|
|
#: lazarusidestrconsts:lishintstepinto
|
|
msgid "Step Into"
|
|
msgstr "Žengti gilyn"
|
|
|
|
#: lazarusidestrconsts:lishintstepover
|
|
msgid "Step Over"
|
|
msgstr "Žengti virš"
|
|
|
|
#: lazarusidestrconsts:lismenustepinto
|
|
msgid "Step into"
|
|
msgstr "Žengti gilyn"
|
|
|
|
#: lazarusidestrconsts:lismenustepover
|
|
msgid "Step over"
|
|
msgstr "Žengti virš"
|
|
|
|
#: lazarusidestrconsts:lismenustop
|
|
msgid "Stop"
|
|
msgstr "Stabdyti"
|
|
|
|
#: lazarusidestrconsts:lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Nutraukti derinimą?"
|
|
|
|
#: lazarusidestrconsts:dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Po kelių klaidų sustoti:"
|
|
|
|
#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Sustabdyti šiuo metu vykdomą programos derinimą ir daryti projektą išnaujo?"
|
|
|
|
#: lazarusidestrconsts:lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Sustabdyti derinimą?"
|
|
|
|
#: lazarusidestrconsts:liskmstopprogram
|
|
msgid "Stop program"
|
|
msgstr "Sustabdyti programą"
|
|
|
|
#: lazarusidestrconsts:lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Nutraukti derinimą?"
|
|
|
|
#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
|
|
msgid "Store dependency filename"
|
|
msgstr "Talpinti priklausomo failo vardą"
|
|
|
|
#: lazarusidestrconsts:dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "\"Stored\" postfiksas"
|
|
|
|
#: lazarusidestrconsts:lisstreamerror
|
|
msgid "Stream Error"
|
|
msgstr "Srauto klaida"
|
|
|
|
#: lazarusidestrconsts:lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Klaida siunčiant srautu"
|
|
|
|
#: lazarusidestrconsts:lisstring
|
|
msgid "String"
|
|
msgstr "Tekstas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "Eilutės konstanta"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "Teksto konstanta pirminiame kode"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "Eilutės su tokia pat verte:"
|
|
|
|
#: lazarusidestrconsts:dlgcostrip
|
|
msgid "Strip Symbols From Executable"
|
|
msgstr "Pašalinti simbolius iš vykdomojo failo"
|
|
|
|
#: lazarusidestrconsts:lisstyle
|
|
msgid "Style"
|
|
msgstr "Stilius"
|
|
|
|
#: lazarusidestrconsts:lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr "Vidinė procedūra"
|
|
|
|
#: lazarusidestrconsts:lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr "Vidinė procedūra tame pačiame lygyje"
|
|
|
|
#: lazarusidestrconsts:dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Pakatalogis"
|
|
|
|
#: lazarusidestrconsts:dlgsubpropkcolor
|
|
msgid "Subpropertes"
|
|
msgstr "Posavybės"
|
|
|
|
#: lazarusidestrconsts:lissuccess
|
|
msgid "Success"
|
|
msgstr "Tvarka"
|
|
|
|
#: lazarusidestrconsts:lisa2pswitchpaths
|
|
msgid "Switch Paths"
|
|
msgstr "Kitoks kelias"
|
|
|
|
#: lazarusidestrconsts:srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Persijungti tarp formos ir modulio"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Simbolis"
|
|
|
|
#: lazarusidestrconsts:dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Simbolis gale (.pp~)"
|
|
|
|
#: lazarusidestrconsts:dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Simbolis priekyje (.~pp)"
|
|
|
|
#: lazarusidestrconsts:lissynedit
|
|
msgid "SynEdit"
|
|
msgstr "SynEdit"
|
|
|
|
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
|
|
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
|
msgstr ""
|
|
"SynEdit - Lazarus naudojama redagavimo komponentė.\n"
|
|
"http://sourceforge.net/projects/synedit/"
|
|
|
|
#: lazarusidestrconsts:srkmecsyntaxcheck
|
|
msgid "Syntax check"
|
|
msgstr "Sintaksės patikra"
|
|
|
|
#: lazarusidestrconsts:dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Sintaksės parinktys"
|
|
|
|
#: lazarusidestrconsts:dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Sistemos kintamieji"
|
|
|
|
#: lazarusidestrconsts:dlgbp7cptb
|
|
msgid "TP/BP 7.0 Compatible"
|
|
msgstr "Suderinamumas su TP/BP 7.0"
|
|
|
|
#: lazarusidestrconsts:srvk_tab
|
|
msgid "Tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts:listaborderof
|
|
msgid "Tab Order of"
|
|
msgstr "Vieta tabuliatoriaus eilėje"
|
|
|
|
#: lazarusidestrconsts:dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tabuliatorius įtraukia blokus"
|
|
|
|
#: lazarusidestrconsts:fdmtaborder
|
|
msgid "Tab order..."
|
|
msgstr "Tabuliatoriaus eilė..."
|
|
|
|
#: lazarusidestrconsts:liseotabwidths
|
|
msgid "Tab widths"
|
|
msgstr "Tabuliatoriaus plotis"
|
|
|
|
#: lazarusidestrconsts:dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Vietoj tabuliatoriaus - tarpo simboliai"
|
|
|
|
#: lazarusidestrconsts:lismenutabstospacesselection
|
|
msgid "Tabs to spaces in selection"
|
|
msgstr "Pažymėtoje srityje tabuliatorius keisti tarpais"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqboapplcltarget
|
|
msgid "Target"
|
|
msgstr "Paskyra"
|
|
|
|
#: lazarusidestrconsts:listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Skirtas procesoriui"
|
|
|
|
#: lazarusidestrconsts:lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Skirtas procesuriui:"
|
|
|
|
#: lazarusidestrconsts:listargetos
|
|
msgid "Target OS"
|
|
msgstr "Skirtas OS"
|
|
|
|
#: lazarusidestrconsts:liscotargetosspecificoptions
|
|
msgid "Target OS specific options"
|
|
msgstr "Skirtos OS specifinės parinktys"
|
|
|
|
#: lazarusidestrconsts:lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Skirtas OS:"
|
|
|
|
#: lazarusidestrconsts:dlgtargetplatform
|
|
msgid "Target Platform:"
|
|
msgstr "Skirtas platformai:"
|
|
|
|
#: lazarusidestrconsts:lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr "Daryti kataloge:"
|
|
|
|
#: lazarusidestrconsts:dlgpotargetfilename
|
|
msgid "Target file name:"
|
|
msgstr "Būsimo failo vardas:"
|
|
|
|
#: lazarusidestrconsts:listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr "Būsimo failo vardas + parametrai"
|
|
|
|
#: lazarusidestrconsts:listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Projekto būsimo failo vardas"
|
|
|
|
#: lazarusidestrconsts:dlgtargetproc
|
|
msgid "Target i386"
|
|
msgstr "Paskirtis i386"
|
|
|
|
#: lazarusidestrconsts:lismenueditortemplatepreview
|
|
msgid "Template Preview"
|
|
msgstr "Šablono peržiūra"
|
|
|
|
#: lazarusidestrconsts:dlgtplfname
|
|
msgid "Template file name"
|
|
msgstr "Šablono failo vardas"
|
|
|
|
#: lazarusidestrconsts:lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Šablonai"
|
|
|
|
#: lazarusidestrconsts:dlgccotest
|
|
msgid "Test"
|
|
msgstr "Testas"
|
|
|
|
#: lazarusidestrconsts:listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Testo katalogas"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Nerastas testo katalogas \"%s\"."
|
|
|
|
#: lazarusidestrconsts:dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr "Testas: tikrinamas kompiliatorius..."
|
|
|
|
#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr "Testas: tikrinami kompiliatoriaus nustatymai..."
|
|
|
|
#: lazarusidestrconsts:dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr "Testas: tikrinama kompiliatoriaus data..."
|
|
|
|
#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
|
|
msgid "Test: Checking fpc configs ..."
|
|
msgstr "Testas: tikrinami FPC nustatymai..."
|
|
|
|
#: lazarusidestrconsts:dlgccotestmissingppu
|
|
msgid "Test: Checking missing fpc ppu ..."
|
|
msgstr "Testas: tikrinama ar trūksta FPC ppu..."
|
|
|
|
#: lazarusidestrconsts:dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr "Testas: tikrinami pirminiai kodo failai FPC ppu paieškos keliuose..."
|
|
|
|
#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr "Testas: kompiliuojamas tuščias failas"
|
|
|
|
#: lazarusidestrconsts:dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr "Testas: kompiliuojamas tuščias failas..."
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypetext
|
|
msgid "Text"
|
|
msgstr "Teksto"
|
|
|
|
#: lazarusidestrconsts:dlgtextattributes
|
|
msgid "Text attributes"
|
|
msgstr "Teksto atributai"
|
|
|
|
#: lazarusidestrconsts:srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Teksto keitimo komandos"
|
|
|
|
#: lazarusidestrconsts:srkmcatmarker
|
|
msgid "Text marker commands"
|
|
msgstr "Teksto žymeklio komandos"
|
|
|
|
#: lazarusidestrconsts:srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Teksto ieškos ir pakeitimo komandos"
|
|
|
|
#: lazarusidestrconsts:srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Teksto žymėjimo komandos"
|
|
|
|
#: lazarusidestrconsts:lisfindfiletexttofind
|
|
msgid "Text to find:"
|
|
msgstr "Ieškoti teksto:"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgtext1
|
|
msgid "Text1"
|
|
msgstr "Tekstas1"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgtext2
|
|
msgid "Text2"
|
|
msgstr "Tekstas2"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus,%sir kurį naudoja šis projektas %s.%sPavyzdžiui: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus,%sir kurį naudoja šis projektas %s.%sPavyzdžiui: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus.%sPavyzdžiui: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "%s pagrindinis katalogas,%skuriame Borland įdiegė visus %s pirminius kodus.%sPavyzdžiui: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "%s projekto katalogas,%skuriame yra .dpr ir .dpk failai."
|
|
|
|
#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
|
msgstr "Nėra startavimui reikalingo programos-ryšulio %s%s arba ji nėra vykdomasis.%sGal norite jį sukurti?%s%sNustatymus rasite \"Projektas -> Projekto parinktys... -> Taikomoji programa\"."
|
|
|
|
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
|
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
|
msgstr "FCL - FreePascal komponenčių biblioteka, pateikia visas objektinio paskalio bazines klases."
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
|
|
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
|
msgstr "FPC pirminio kodo katalogas \"%s\" nėra geras. Įprastai jame yra katalogai \"rtl\", \"packages\", \"compiler\", ... ."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
|
|
msgid "The Free Pascal SVN source directory."
|
|
msgstr "FreePascal SVN pirminio kodo katalogas."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
|
msgstr "FreePascal SVN pirminio teksto katalogas. Nebūtina, tačiau nurodžius tai pagerins paskelbimo kode paiešką bei programos derinimą."
|
|
|
|
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
|
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
|
msgstr "Nerastas FreePascal kompiliatorius (failas: %s).%sRekomenduotina instaliuoti fpc."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "FreePascal projekto katalogas."
|
|
|
|
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
|
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
|
msgstr "Nerastas FreePascal pirminių kodų katalogas.%sKai kurios funkcijos neveiks.%sRekomenduotina įdiegti FreePascal pirminius kodus ir nurodyti kelią iki jų%s\"Aplinka -> Aplinkos parinktys -> Failai\"."
|
|
|
|
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
|
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
|
msgstr "LCL - Lazarus komponenčių biblioteka, turinti visas pagrindines komponentes reikalingas formos kūrimui."
|
|
|
|
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
|
msgstr "LFM (Lazarus forma) faile aptikta klaidų. Pavyzdžiui, jame yra savybių/klasių, kurių nėra dabartiniame LCL. Yra įprasta šias savybes/klases pašalinti ir po to paskalio kodą taisyti rankiniu būdu."
|
|
|
|
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
|
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
|
msgstr "Lazarus katalogas nerastas.%sJūs negalėsite kurti LCL programų.%sPatikrinkite \"Aplinka -> Aplinkos parinktys -> Failai\"."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
|
|
msgid "The Lazarus main directory."
|
|
msgstr "Lazarus pagrindinis katalogas."
|
|
|
|
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
|
|
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgstr "Maksimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maksimali versija žemesnė už minimalią."
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
|
|
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgstr "Minimali versija %s%s%s klaidinga.%sNaudokite formatą \"Didysis.Mažasis.Laida.DarymoNumeris\".%sPavyzdžiui: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
|
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
|
msgstr "RTL - biblioteka veikos rėžimui, tai visų FreePascal programų bazė."
|
|
|
|
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
|
|
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
|
msgstr "Nerastas katalogas testui:%s%s%s%s%s(tikrinkite aplinkos parinktis)"
|
|
|
|
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
|
|
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgstr "Protėvio tipo %s%s%s vardas tokspat kaip ir%smodulio %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
|
msgstr "Protėvio tipas %s%s%s nėra paskalio identifikatorius."
|
|
|
|
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
|
msgstr "Klasė %s%s%s yra \"TControl\" tipo, todėl jos neis įdėti ne į valdiklį.%sĮdėti nepavyks."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
|
|
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
|
msgstr "Klasės vardas %s%s%stokspat kaip ir protėvio tipo %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
|
|
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
|
msgstr "Klasės vardas %s%s%s jau figūruoja%spaketo %s%sfaile: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
|
|
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgstr "Klasės vardas %s%s%s tokspat kaip ir%smodulio %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
|
|
msgid "The class name %s%s%s is not a valid pascal identifier."
|
|
msgstr "Klasės vardas %s%s%s nėra paskalio identifikatorius."
|
|
|
|
#: lazarusidestrconsts:listhecodetoolsfoundanerror
|
|
msgid "The codetools found an error:%s%s%s"
|
|
msgstr "CodeTools rado klaidą:%s%s%s"
|
|
|
|
#: lazarusidestrconsts:listhecommandafterisnotexecutable
|
|
msgid "The command after %s%s%s is not executable."
|
|
msgstr "Komanda esanti po %s%s%s nėra vykdomasis failas."
|
|
|
|
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
|
|
msgid "The command after publishing is invalid:%s%s%s%s"
|
|
msgstr "Komanda esanti po paskelbimo yra klaidinga:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisccoppunotfounddetailed
|
|
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
|
msgstr "Nerastas sukompiliuotas FPC modulis \"%s.ppu\".%sGreičiausiai, \"fpc.cfg\" faile yra klaida. Arba sugadintas įdiegtasis FPC."
|
|
|
|
#: lazarusidestrconsts:lisccocompilernotanexe
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr "Kompiliatorius \"%s\" nėra vykdomasis failas.%sDetalės: %s"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
|
|
msgid "The compiler file \"%s\" is not an executable."
|
|
msgstr "Kompiliatoriaus failas \"%s\" nėra paleidžiamasis."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
|
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
|
msgstr "Paketo %s kompiliatoriaus failas nėra vykdomasis:%s%s"
|
|
|
|
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
|
msgstr "%s%s%s klasės komponento redaktorius padarė klaidą:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
|
|
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
|
msgstr "%s%s%s klasės%s komponentų redaktorius, iššauktas veiksmažodžio #%s %s%s%s,%spadarė klaidą:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
|
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
|
msgstr "Dabartinis FreePascal pirminio kodo katalogas %s%s%s%s nėra geras.%sPatikrinkite \"Aplinka -> Aplinkos parinktys -> Failai\"."
|
|
|
|
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
|
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr "Dabartinis FreePascal pirminių kodų katalogas %s%s%s%s nėra geras.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti \"Aplinka -> Aplinkos parinktys -> Failai\"."
|
|
|
|
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
|
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
|
msgstr "Dabartinis Lazarus katalogas %s%s%s%s nėra geras.%sBe jo neis kurti LCL taikomųjų programų.%sPatikrinkite \"Aplinka -> Aplinkos parinktys -> Failai\"."
|
|
|
|
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
|
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr "Dabartinis Lazarus katalogas %s%s%s%s nėra geras.%sBe jo neis kurti LCL taikomųjų programų.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti \"Aplinka -> Aplinkos parinktys -> Failai\"."
|
|
|
|
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
|
|
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr "Dabartinis kompiliatorius, vardu %s%s%s%s, nėra vykdomasis failas.%sPaspaudus \"Tinka\" bus parinktas numatytasis %s%s%s.%sArba jį galite nustatyti \"Aplinka -> Aplinkos parinktys -> Failai\"."
|
|
|
|
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
|
|
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
|
msgstr "Dabartinis kompiliatorius, vardu %s%s%s%s, nėra vykdomasis failas.%sPatikrinkite \"Aplinka -> Aplinkos parinktys -> Failai\"."
|
|
|
|
#: lazarusidestrconsts:lisuethecurre
|
|
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
|
msgstr "Dabartinis redaktoriaus šriftas nėra suderintas su UTF-8 koduote, o jūsų sistema naudoja būtent šią koduotę.%sTai reiškia kad ne ASCII simboliai greičiausiai bus rodomi klaidingai.%sKitą šriftą galite pasirinkti redaktoriaus parinktyse."
|
|
|
|
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
|
|
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
|
msgstr "Dabartinis failo%s%s%s%s modulio kelias yra%s%s%s%s.%s%sTrūksta įrašo apie kelią iki LCL modulių %s%s%s.%s%sUžuomina naujokams:%ssukurkite Lazarus programą ir patalpinkite failą projekto kataloge."
|
|
|
|
#: lazarusidestrconsts:lisccodatesdiffer
|
|
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr "FPC \".ppu\" failų datos skiriasi daugiau nei valanda.%sGali būti failai yra iš skirtingų diegimų.%sPirmas failas: %s%sAntras failas: %s"
|
|
|
|
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
|
msgstr "Nerasta derintuvė %s%s%s,%sarba ji nėra vykdomasis failas.%s%sŽvilgterėkit į \"Aplinka -> Derintuvės parinktys\"."
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "Derintuvės failas \"%s\" nėra paleidžiamasis."
|
|
|
|
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
|
|
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
|
msgstr "Priklausinys %s%s%s nerastas.%sNurodykite egzistuojantį paketą."
|
|
|
|
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
|
|
msgid "The destination directory%s%s%s%s does not exist."
|
|
msgstr "Paskirties katalogas%s%s%s%s neegzistuoja."
|
|
|
|
#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
|
|
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
|
msgstr "Katalogo įrašas %s%s%s nebebūtinas modulių kelyje.%sPašalinti katalogo įrašą?"
|
|
|
|
#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
|
|
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
|
msgstr "Katalogas %s%s%s nefigūruoja modulių kelyje.%sPridėti katalogą prie modulio kelio?"
|
|
|
|
#: lazarusidestrconsts:dlgthedirectory
|
|
msgid "The directory \""
|
|
msgstr "Katalogas \""
|
|
|
|
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
|
msgstr "Panašu kad failas %s yra kažkurio Lazarus projekto programos failas."
|
|
|
|
#: lazarusidestrconsts:listhefile
|
|
msgid "The file %s%s%s"
|
|
msgstr "Failas %s%s%s"
|
|
|
|
#: lazarusidestrconsts:listhefileisasymlinkopeninstead
|
|
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
|
msgstr "Failas %s%s%s yra simbolinė nuoroda.%s%sAr vietoj jo atverti %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
|
|
msgid "The file %s%s%s is already in the package."
|
|
msgstr "Failas %s%s%s jau yra pakete"
|
|
|
|
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
|
|
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
|
msgstr "Failas %s%s%s nėra Delphi projektas (.dpr)"
|
|
|
|
#: lazarusidestrconsts:listhefileisnotadelphiunit
|
|
msgid "The file %s%s%s is not a Delphi unit."
|
|
msgstr "Failas %s%s%s nėra Delphi modulis."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
|
|
msgid "The file %s%s%s is not a lazarus package."
|
|
msgstr "Failas %s%s%s nėra Lazarus paketas."
|
|
|
|
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "Failas %s%s%s yra šio projekto dalis.%sDalintis failais tarp projektų bei paketų nėra gerai."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
|
|
msgid "The file %s%s%s%sis already in the package %s."
|
|
msgstr "Failas %s%s%s%s jau yra pakete %s."
|
|
|
|
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
|
msgstr "Failas %s%s%s%s yra ne paketo modulių kelyje.%s%s%s%s%s įtraukti kaip modulių kelią?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
|
|
msgid "The file %s%s%s%sof package %s is missing."
|
|
msgstr "Trūksta failo %s%s%s%s, priklausančio paketui %s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
|
|
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
|
msgstr "Pirma reikia įrašyti failą %s%s%s%s, priklausantį paketui %s."
|
|
|
|
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
|
|
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr "Panašu kad failas %s%s%s%s yra programa. Užverti šį projektą ir tai programai sukurti naują Lazarus projektą?%sPaspaudus \"Ne\" failas bus įkeltas kaip įprastas pirminis kodas."
|
|
|
|
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
|
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
|
msgstr "Failas %s%s%s%s rastas viename iš paketo %s pradinio kodo katalogų. Panašu kad failas yra kompiliuotas modulis. Kompiliuoti moduliai turi būti paketo išvesties kataloge, kitaip gali kilti problemų kitiems paketams naudojant šį paketą.%s%sPašalinti šį neaiškųjį failą?"
|
|
|
|
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
|
|
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
|
msgstr "Failas %s%s%s%s nerastas.%sIeškosite patys?%s"
|
|
|
|
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "Failas %s%s%s%s nerastas.%sPaspaudus \"Tęsti\" projektas bus įkeliamas toliau,%spaspaudus \"Nutraukti\" įkėlimas bus nutrauktas."
|
|
|
|
#: lazarusidestrconsts:uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "Failas \""
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
|
|
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "Failo vardas %s%s%s yra šio projekto dalis%sProjektai ir paketai neturėtų dalintis failais."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
|
|
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
|
msgstr "Failo vardą %s%s%s naudoja%spaketas %s%s%s%s, esantis faile %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
|
msgstr "Failo vardas %s%s%s ir paketo vardas %s%s%s, įrašytas šiame faile, skiriasi.%sPakeisti paketo vardą į %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr "Neaiškus failo vardas %s%s%s, nes paketas dar neturi nustatyto katalogo.%sNurodykite pilną kelią iki failo."
|
|
|
|
#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
|
msgstr "Šių metodų, kuriuos naudoja %s, nėra pirminiame kode%s%s%s%s%s%sPašalinti betikslius įrašus?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr "Nepavyko įkelti šio paketo:"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr "Nepavyko įkelti šių paketų:"
|
|
|
|
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
|
|
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
|
|
msgstr "Šių modulių nepavyko rasti:%s%s%s%s 1) Ko gero šie moduliai nėra modulių kelyje, tada jūs galite nutraukti viską, ištaisyti modulių kelią ir bandyti vėl.%s 2) Arba jūs galite praleisti trūkstamus modulius ir vėliau jiems uždėti komentarą."
|
|
|
|
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
|
|
msgid "The host application %s%s%s is not executable."
|
|
msgstr "Programa-šeimininkas %s%s%s nėra vykdomasis failas."
|
|
|
|
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
|
msgstr "Nerasta paleidžiančioji programa%s%s%s%s, arba ji nėra paleidžiamasis failas.%s%sŽvilgterėkit į \"Startuoti -> Startavimo parametrai -> Vietiniai\"."
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
|
|
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
|
msgstr "Lazarus katalogas \"%s\" nėra geras. Įprastai jame yra katalogai \"lcl\", \"debugger\", \"designer\", \"components\", ... ."
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
|
|
msgid "The make file \"%s\" is not an executable."
|
|
msgstr "Programos make failas \"%s\" nėra vykdomasis."
|
|
|
|
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
|
|
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Maksimali versiją %s%s%s nėra gera versija paketui.%s(geras pavyzdys būtų 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
|
|
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Minimali versiją %s%s%s nėra gera versija paketui.%s(geras pavyzdys būtų 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
|
|
msgid "The name %s%s%s is not a valid pascal identifier."
|
|
msgstr "Vardas %s%s%s nėra paskalio identifikatorius."
|
|
|
|
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
|
|
msgid "The name \"%s\" is not a valid pascal identifier."
|
|
msgstr "Vardas \"%s\" nėra paskalio identifikatorius."
|
|
|
|
#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr "Naujojo modulio nėra dar nėra modulių paieškos kelyje.%sĮtraukti modulio katalogą į modulių paieškos kelią?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
|
msgstr "Paketas %s skirtas tik veikos rėžimui.%s Veikos rėžimo paketų negalima diegti į IKA."
|
|
|
|
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
|
|
msgid "The package %s is read only."
|
|
msgstr "Paketas %s tik skaitymui."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
|
msgstr "Paketo %s reikia %s, kuris paženklintas kaip diegiamasis.%sŽvilgterėkit į paketų grafą."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
|
|
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
|
msgstr "Paketui %s priklauso failas%s%s%s%s.%sFailą pervardinti ir pakete?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
|
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
|
msgstr "Nepavyko kompiliuoti paketą %s%s%s .%sPašalinti jį iš diegimo sarašo?"
|
|
|
|
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
|
|
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
|
msgstr "Paketas %s%s%s nustatytas automatiniam diegimui.%sTai reiškia, kad jis bus įdiegtas į IKA. Diegimo paketai%sturi būti designtime tipo."
|
|
|
|
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
|
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgstr "Paketas %s%s%s įdiegtas, tačiau nerastas paketo failas (.lpk).%sTodėl sukurtas tuščias paketas."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Paketas %s%s%s paženklintas kaip diegiamasis, tačiau jo nepavyko rasti.%sPašalinti priklausinį iš paketų diegimo sąrašo?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Paketas %s%s%s paženklintas diegimui.%sŠiuo metu Lazarus palaiko tik statiškai saistytus paketus. Tad diegimo procesas yra toks- daryti Lazarus išnaujo ir po to jį startuoti vėl.%s%sDaryti Lazarus iš naujo dabar?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Paketas %s%s%s paženklintas.%sŠiuo metu Lazarus palaiko tik statiškai saistytus paketus. Tad išdiegimo procesas yra toks- daryti Lazarus išnaujo ir po to jį startuoti vėl.%s%sDaryti Lazarus išnaujo dabar?"
|
|
|
|
#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
|
msgstr "Paketo failo vardas %s%s%s, įrašytas %s%s%s%s, nėra tinkamas Lazarus paketo vardas."
|
|
|
|
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
|
|
msgid "The package has already a dependency for the package %s%s%s."
|
|
msgstr "Paketas jau priklauso nuo paketo %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
|
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
|
msgstr "Paketo vardas %s%s%s klaidingas%sNurodykite egzistuojantį paketą."
|
|
|
|
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
|
|
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
|
msgstr "Klaidingas paketo vardas %s%s%s.%sNurodykite egzistuojantį paketą."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "Paketo vardas %s%s%s yra klaidingas.%sParinkite kitokį vardą (pvz.: paketas.lpk)"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
|
|
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
|
msgstr "Paketo vardas %s%s%s, įrašytas%sfaile %s%s%s, yra klaidingas."
|
|
|
|
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
|
|
msgid "The page name %s%s%s is too long (max 100 chars)."
|
|
msgstr "Perilgas lapo vardas %s%s%s (gali būti nedaugiau 100 simbolių)"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgstr "Šio projekto FreePascal kompiliatoriaus programa su keliu iki jos. Būtina įrašyti jei žemiau nurodysit FPC SVN pirminio kodo katalogą. Šis įrasa naudojamas automatiškai kuriant makrokomandas."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr "FreePascal kompiliatoriaus programa su keliu iki jos.%sPavyzdžiui: %s/usr/bin/%s -n%s arba %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
|
|
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
|
msgstr "Nerasta programa %ssmake%s.%sŠi programa reikalinga Lazarus darymui.%s"
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
|
|
msgid "The project has already a dependency for the package %s%s%s."
|
|
msgstr "Projektas jau turi priklausomybe paketui %s%s%s."
|
|
|
|
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
|
|
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
|
msgstr "Projekto informacinis failas %s%s%s%s toks pat kaip ir projekto pagrindinio pirminio kodo failas!"
|
|
|
|
#: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin
|
|
msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically."
|
|
msgstr "Projektas užvertas. Šiuo atveju yra trys galimybės.%sUžuomina: jums nebūtina pačiam užverti projektą, tai padaroma automatiškai."
|
|
|
|
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Prieš darymą projektas turi būti išsaugotas%sAplinkos parinktyse parinkę testo katalogą,%snaujus projektus bus galima kurti ir daryti vienu metu.%sĮrašyti projektą?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Projektui reikia paketo %s%s%s.%sTačiau jo nepavyko rasti. Žvilgterėkit į \"Projektas -> Projekto inspektorius\"."
|
|
|
|
#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
|
|
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
|
msgstr "Resursų klasė %s%s%s paveldėta iš %s%s%s. Greičiausiai rašybos klaida TForm-ai."
|
|
|
|
#: lazarusidestrconsts:lismakeresstrchooseanothername
|
|
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "Tokia resursų eilutė %s%s%s jau yra.%sParinkite kitokį vardą.%sNorint ją įdėti to nepaisant, spauskite \"Ignoruoti\"."
|
|
|
|
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
|
|
msgid "The root component can not be deleted."
|
|
msgstr "Šakninio komponento negalima Pašalinti."
|
|
|
|
#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr "Modulis %s dubliuojasi %s modulių kelyje:"
|
|
|
|
#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr "Modulis %s nepriklauso jokiam paketui ar projektui.%sPriskirkite modulį paketui ar projektui.%sNeina sukurti FPDoc failo."
|
|
|
|
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
|
|
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
|
msgstr "Modulis %s%s%s jau egzistuoja.%sPaspaudus \"Ignoruoti\" bus pervadyjama,%spaspaudus \"Atsisakyti\" šis pirminis kodas nebus išsaugotas,%so paspaudus \"Nutraukti\" bus nutrauktas visas išsaugojimo procesas."
|
|
|
|
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
|
|
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
|
|
msgstr "Modulio failo varde %s%s%s nevisos raidės yra mažosios.%sFreePascal kompiliatorius 1.0.x priima failus, kurių varduose tik mažosios raidės. Jei jūs nenaudojate FPC 1.0.x, tada jūs galite ignoruoti šį pranešimą.%s%sPervardyti failą?"
|
|
|
|
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
|
|
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
|
msgstr "Jau pačio modulio vardas yra toks %s%s%s. Paskalio identifikatoriai turi būti unikalūs."
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
|
|
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
|
msgstr "Pridedamojo modulio vardas %s%s%s jau figūruoja šiame projekte,%sžvilgterėkit į projekto failą: %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
|
|
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
|
msgstr "Pridedamųjų failų sąraše yra keli moduliai tokiu pat vardu %s%s%s,%svieno iš jų failas: %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
|
|
msgid "The unit name %s%s%s does not correspond to the filename."
|
|
msgstr "Modulio %s%s%s ir failo vardai neatitinka."
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
|
|
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
|
msgstr "Modulio vardas %s%s%s nėra paskalio identifikatorius."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
|
msgstr "Modulio vardas %s%s%s tokspat kaip ir užregistruota komponentė.%sDėlto galite sulaukti keistų pranešimų apie klaidas."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
|
|
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
|
msgstr "Modulio %s%s%s%s ir failo %s%s%s vardai skiriasi."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
|
|
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
|
msgstr "Modulio vardas %s%s%s jau yra pakete:%s%s"
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
|
|
msgid "The unitname %s%s%s already exists in this package."
|
|
msgstr "Modulio vardas %s%s%s jau yra pakete."
|
|
|
|
#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
|
|
msgid "The unitname is not a valid pascal identifier."
|
|
msgstr "Modulio vardas nėra paskalio identifikatorius."
|
|
|
|
#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
|
|
msgid "The unitname is used when the IDE extends uses clauses."
|
|
msgstr "Modulio vardas naudojamas kai IKA praplečia naudojamų modulių sąrašą."
|
|
|
|
#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr "Yra %s abstrakčių metodų, kuriuos galima įgyvendinti.%sPažymėkite metodus, kuriuos reikia įgyvendinti:"
|
|
|
|
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
|
|
msgid "There are more functions in the popupmenu"
|
|
msgstr "Daugiau funkcijų yra iškylančiame menių"
|
|
|
|
#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr "Nebėra abstrakčių metodų, kuriuos būtų galima įgyvendinti."
|
|
|
|
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "Kataloge yra failų, kurių vardai%sskiriasi tik raidžių lygiais:%s%s%sJuos ištrinti?"
|
|
|
|
#: lazarusidestrconsts:lisccoseveralcompilers
|
|
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr "Kelyje aptikti keli FreePascal kompiliatoriai.%s%s%sGalbūt užmiršot ištrinti senąjį kompiliatorių?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
|
|
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
|
msgstr "Rasti du moduliai tuo pačiu vardu:%s%s1. %s%s%s iš %s%s2. %s%s%s iš %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisccoppuolderthancompiler
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr "Rastas \".ppu\"failas, kuris yra senesnis už patį kompiliatorių:%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
|
msgstr "Rastas FPC modulis tuo pačiu vardu kaip ir paketas:%s%s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
|
|
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
|
msgstr "Rastas FPC modulis tuo pačiu vardu kaip ir:%s%s%s%s%s iš %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
|
|
msgid "There is a circle in the required packages. See package graph."
|
|
msgstr "Reikiamuose paketuose rastas ratas. Žvilgterėkit į paketų grafą."
|
|
|
|
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
|
|
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
|
msgstr "Rastas kitas failas tokiu pat vardu bei panašiu prievardžiu.%sFailas: %s%sNeaiškusis failas: %s%s%sPašalinti neaiškųjį failą?"
|
|
|
|
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Čia daugiausia gali būti %s įrankių."
|
|
|
|
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
|
|
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
|
msgstr "Projekte jau yra modulis %s%s%s tokiu pat vardu.%sParinkite kitokį vardą."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
|
msgstr "Rastas modulis tuo pačiu vardu kaip ir paketas:%s%s1. %s%s%s iš %s%s2. %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:listhereisalreadyaformwiththename
|
|
msgid "There is already a form with the name %s%s%s"
|
|
msgstr "Forma tokiu vardu %s%s%s jau yra"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
|
|
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
|
msgstr "Paketas %s%s%s jau yra įkeltas%siš failo %s%s%s.%sŽvilgterėkit į \"Components -> Paketų grafas\".%sPakeitimas neįmanomas."
|
|
|
|
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
|
msgstr "Modulis tokiu vardu %s%s%s jau yra. Paskalio identifikatoriai turi būti unikalūs."
|
|
|
|
#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr "Modulis tokiu vardu jau egzistuoja.%sFailas: %s"
|
|
|
|
#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
|
|
msgid "There is already another component with the name %s%s%s."
|
|
msgstr "Jau yra komponentas tokiu vardu %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
|
|
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
|
msgstr "Aptiktas paketas jau naudojantis vardą %s%s%s.%sKonfliktinis paketas: %s%s%s%sFailas: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Reikiamuose paketuose aptiktas neišsaugotas paketas. Žvilgterėkit į paketų grafą."
|
|
|
|
#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
|
msgstr "Nenurodyta derintuvė.%sStabdos taškai neveiks kol nebus nurodyta derintuvė. Ji nurodoma menių esančiame derintuvės parinkčių dialoge."
|
|
|
|
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr "Rašant pažymėtąją komponentę %s:%s įvyko klaida:%s%s"
|
|
|
|
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr "Konvertuojant pažymėtosios komponentės %s:%s dvejetainį srautą įvyko klaida:%s%s"
|
|
|
|
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr "Komponentę srautu kopijuojant į iškarpinę įvyko klaida:%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr "Failas nerastas nėviename įkeltame pakete."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
|
msgid "This file was automatically created by Lazarus. Do not edit!"
|
|
msgstr "Šį failą automatiškai sukūrė Lazarus. Nekeiskite jo!"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr "Tai virtualus paketas. Jis kolkas dar neturi pirminio kodo. Todėl pirma išsaugokite paketą."
|
|
|
|
#: lazarusidestrconsts:lisresourcefilecomment
|
|
msgid "This is an automatically generated lazarus resource file"
|
|
msgstr "Tai automatiškai sugeneruotas Lazarus resursų failas"
|
|
|
|
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
|
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
|
msgstr "Tai numatytasis paketas. Naudojamas komponenčių be paketo. Tos komponentės yra pasenusios."
|
|
|
|
#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
"Tai kaimyninė komponentė, prie kurios bus pririštas apatinis kraštas.\n"
|
|
"Jei reikalingas tėvas, palikite lauką tuščia."
|
|
|
|
#: lazarusidestrconsts:lisleftsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
"Tai kaimyninė komponentė, prie kurios bus pririštas kairysis kraštas.\n"
|
|
"Jei reikalingas tėvas, palikite lauką tuščia."
|
|
|
|
#: lazarusidestrconsts:lisrightsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
"Tai kaimyninė komponentė, prie kurios bus pririštas dešinysis kraštas.\n"
|
|
"Jei reikalingas tėvas, palikite lauką tuščia."
|
|
|
|
#: lazarusidestrconsts:listopsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
|
msgstr ""
|
|
"Tai kaimyninė komponentė, prie kurios bus pririštas viršutinis kraštas.\n"
|
|
"Jei reikalingas tėvas, palikite lauką tuščia."
|
|
|
|
#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr "Panašu kad tai paskalio failas.%sRekomenduotina failo varde naudoti tik mažąsias raides, tokiu būdu išvengsite problemų, susijusių su įvairiomis failų sistemomis ar įvairiais kompiliatoriais.%sPervardyti mažosiomis raidėmis?"
|
|
|
|
#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr "Šio metodo negalima įgyvendinti, nes jis paskelbtas dabartinėje klasėje."
|
|
|
|
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
|
msgstr "Šis paketas įdiegtas, tačiau nerastas jo lpk failas. Pasyvinami visi jo komponentai. Ištaisykite tai."
|
|
|
|
#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr "Šis paketas pateikia tą patį kaip ir šie paketai:"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
|
msgid "This source is only used to compile and install the package."
|
|
msgstr "Šis pirminis kodas skirtas tik paketo kompiliavimui ir diegimui."
|
|
|
|
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr "Sakinį ištraukti neis.%sPrieš ištraukiant naują procedūrą/metodą pažymėkite kažkiek kodo."
|
|
|
|
#: lazarusidestrconsts:listhiswillhappencontinue
|
|
msgid "This will happen:%s%s%sContinue?"
|
|
msgstr "Bus daroma:%s%s%sTęsti?"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Gija"
|
|
|
|
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Reikia pavadinimo ir failo vardo"
|
|
|
|
#: lazarusidestrconsts:dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Antraštė:"
|
|
|
|
#: lazarusidestrconsts:lismenuviewtodolist
|
|
msgid "ToDo List"
|
|
msgstr "ToDo sąrašas"
|
|
|
|
#: lazarusidestrconsts:listodolistoptions
|
|
msgid "ToDo options..."
|
|
msgstr "ToDo parinktys..."
|
|
|
|
#: lazarusidestrconsts:lishinttoggleformunit
|
|
msgid "Toggle Form/Unit"
|
|
msgstr "Rodyti formą arba modulį"
|
|
|
|
#: lazarusidestrconsts:srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Perjungti veikseną"
|
|
|
|
#: lazarusidestrconsts:liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr "Persijungti tarp formos ir modulio"
|
|
|
|
#: lazarusidestrconsts:lismenuviewtoggleformunit
|
|
msgid "Toggle form/unit view"
|
|
msgstr "Rodyti formą arba modulį"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewbreakpoints
|
|
msgid "Toggle view Breakpoints"
|
|
msgstr "Keisti \"Stabdos taškai\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewcallstack
|
|
msgid "Toggle view Call Stack"
|
|
msgstr "Keisti \"Kreipčių dėklas\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr "Keisti \"Kodo tyrinėtojas\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
|
|
msgid "Toggle view Debugger Output"
|
|
msgstr "Keisti \"Derintuvės išvestis\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr "Keisti \"Dokumentacijos redaktorius\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr "Keisti IKA sparčiųjų mygtukų matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewlocalvariables
|
|
msgid "Toggle view Local Variables"
|
|
msgstr "Keisti \"Vietiniai kintamieji\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr "Keisti \"Pranešimai\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr "Keisti \"Objektų inspektorius\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr "Keisti \"Ieškos rezultatai\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr "Keisti \"Pirminio kodo redaktorius\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewwatches
|
|
msgid "Toggle view Watches"
|
|
msgstr "Keisti \"Stebimieji\" matomumą"
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
|
|
msgid "Toggle view component palette"
|
|
msgstr "Keisti komponenčių paletės matomumą"
|
|
|
|
#: lazarusidestrconsts:liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Leksema:"
|
|
|
|
#: lazarusidestrconsts:lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Įrankiai"
|
|
|
|
#: lazarusidestrconsts:srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Meniu \"Įrankiai\" komandos"
|
|
|
|
#: lazarusidestrconsts:dlgtooltipeval
|
|
msgid "Tooltip expression evaluation"
|
|
msgstr "Reiškinio įverčio informacinis langelis"
|
|
|
|
#: lazarusidestrconsts:dlgtooltiptools
|
|
msgid "Tooltip symbol Tools"
|
|
msgstr "Simbolio įrankių informacinis langelis"
|
|
|
|
#: lazarusidestrconsts:listop
|
|
msgid "Top"
|
|
msgstr "Viršun"
|
|
|
|
#: lazarusidestrconsts:listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Viršaus prieraiša"
|
|
|
|
#: lazarusidestrconsts:listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr ""
|
|
"Viršutinės kraštinės plotis.\n"
|
|
"Ši vertė pridėta prie pagrindinio kraštinės pločio ir nusakys bendrą viršutinės kraštinės plotį."
|
|
|
|
#: lazarusidestrconsts:listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr "Tolygiai rikiuoti pagal viršutinius kraštus"
|
|
|
|
#: lazarusidestrconsts:dlgtoppos
|
|
msgid "Top:"
|
|
msgstr "Viršus:"
|
|
|
|
#: lazarusidestrconsts:listops
|
|
msgid "Tops"
|
|
msgstr "Sutapdinti viršutinius kraštus"
|
|
|
|
#: lazarusidestrconsts:dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Eilučių galuose pašalinti tarpo simbolius"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatetutorial
|
|
msgid "Tutorial"
|
|
msgstr "Pavyzdys"
|
|
|
|
#: lazarusidestrconsts:dlgenvtype
|
|
msgid "Type"
|
|
msgstr "Tipas"
|
|
|
|
#: lazarusidestrconsts:lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Tipas:"
|
|
|
|
#: lazarusidestrconsts:liscetypes
|
|
msgid "Types"
|
|
msgstr "Tipai"
|
|
|
|
#: lazarusidestrconsts:dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "Didžiosiomis raidėmis"
|
|
|
|
#: lazarusidestrconsts:rslanguageukrainian
|
|
msgid "Ukrainian"
|
|
msgstr "Ukrainiečių"
|
|
|
|
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr "Nepavyko dvejetainį srautą konvertuoti į tekstą"
|
|
|
|
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr "Komponentę kopijuoti į iškarpinę nepavyko"
|
|
|
|
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
|
msgstr "Nepavyko %s įdėti į projektą, nes projekte jau yra modulis tokiu pat vardu."
|
|
|
|
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgstr "Resurso T%s:FORMDATA nepavyko įrašyti į resursų failą %s%s%s%s.%sKogero tai sintaksės klaida."
|
|
|
|
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
|
|
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgstr "Resursu faile %s%s%s%snepavyko įrašyti resursų antraštinį komentarą.%sKogero tai sintaksės klaida."
|
|
|
|
#: lazarusidestrconsts:lisunabletobackupfileto
|
|
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
|
msgstr "Nepavyko padaryti failo %s%s%s atsarginę kopiją į %s%s%s!"
|
|
|
|
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Programos pirminiame kode nepavyko pakeisti automatiškai kuriamų formų sąrašo.%sPirma ištaisykite klaidas."
|
|
|
|
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
|
|
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
|
msgstr "Nepavyko apvalyti %s%s%s.%sPatinkrinkite leidimus."
|
|
|
|
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Nepavyko apvalyti tikslo katalogo"
|
|
|
|
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr "Nepavyko komponentės tekstą konvertuoti į dvejetainį formatą:%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoconvertfileerror
|
|
msgid "Unable to convert file %s%s%s%sError: %s"
|
|
msgstr "Nepavyko konvertuoti failą %s%s%s%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
|
|
msgid "Unable to convert lfm to lrs and write lrs file."
|
|
msgstr "Nepavyko LFM konvertuoti į LRS ir sukurti LRS failą."
|
|
|
|
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
|
|
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
|
msgstr "Nepavyko faile %s%s%s%s%sesantį tekstą konvertuoti į dvejetainį srautą. (%s)"
|
|
|
|
#: lazarusidestrconsts:lisunabletocopyfile
|
|
msgid "Unable to copy file"
|
|
msgstr "Nepavyko kopijuoti failą"
|
|
|
|
#: lazarusidestrconsts:lisunabletocopyfileto
|
|
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
|
msgstr "Nepavyko kopijuoti failą %s%s%s%sį %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletocopyfileto2
|
|
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
|
msgstr "Nepavyko kopijuoti failą %s%s%s%sį %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr "Nepavyko sukurti testinio failo"
|
|
|
|
#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
|
|
msgid "Unable to create Test pascal file \"%s\"."
|
|
msgstr "Nepavyko sukurti testinio paskalio failo \"%s\"."
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
|
|
msgid "Unable to create backup directory %s%s%s."
|
|
msgstr "Nepavyko sukurti atsarginių kopijų katalogo %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
|
|
msgid "Unable to create directory"
|
|
msgstr "Nepavyko sukurti katalogą"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatedirectory2
|
|
msgid "Unable to create directory %s%s%s"
|
|
msgstr "Nepavyko sukurti katalogą %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatedirectory
|
|
msgid "Unable to create directory %s%s%s."
|
|
msgstr "Nepavyko sukurti katalogą %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatefile
|
|
msgid "Unable to create file"
|
|
msgstr "Failas nesiduoda sukuriamas"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatefile2
|
|
msgid "Unable to create file %s%s%s"
|
|
msgstr "Nepavyko sukurti failą %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatefilename
|
|
msgid "Unable to create file %s%s%s."
|
|
msgstr "Nepavyko sukurti failą %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatefile3
|
|
msgid "Unable to create file%s%s%s%s"
|
|
msgstr "Nepavyko sukurti failą%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
|
|
msgid "Unable to create new method. Please fix the error shown in the message window."
|
|
msgstr "Nepavyko sukurti naująjį metodą. Ištaisykite klaidą, rodomą pranešimų lange."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
|
|
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
|
msgstr "Nepavyko sukurti išvesties katalogą %s%s%s%s, skirtą paketui %s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
|
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
|
msgstr "Nepavyko sukurti katalogą %s%s%s%s paketo %s pradiniam kodui."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
|
msgstr "Nepavyko sukurti Lazarus skirto tikslo katalogo:%s%s%s%s.%sŠis katalogas reikalingas naujam pakeistam IKA su įdiegtais jūsų paketais."
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr "Nepavyko sukurti laikino lfm buferio."
|
|
|
|
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
|
|
msgid "Unable to delete ambiguous file %s%s%s"
|
|
msgstr "Nepavyko ištrinti neaiškųjį failą %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
|
|
msgid "Unable to delete file"
|
|
msgstr "Nepavyko ištrinti failą"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletodeletefile
|
|
msgid "Unable to delete file %s%s%s."
|
|
msgstr "Nepavyko ištrinti failą %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
|
|
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
|
msgstr "Nepavyko ištrinti senąjį būsenos failą %s%s%s%s, priklausantį paketui %s."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindinlfmstream
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr "LFM sraute nepavyko rasti %s."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr "Nepavyko rasti \"ResourceString\" sekcijos šiame ir kituose naudojamuose moduliuose."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
|
|
msgid "Unable to find a valid classname in %s%s%s"
|
|
msgstr "%s%s%s nepavyko rasti klasę tinkamu vardu"
|
|
|
|
#: lazarusidestrconsts:lisunabletofindfile
|
|
msgid "Unable to find file %s%s%s."
|
|
msgstr "Nerastas failas %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
|
msgstr "Neina rasti failo %s%s%s.%sJei jis priklauso jūsų projektui, patikrinkite \"Projektas -> Kompiliatoriaus parinktys... -> Keliai -> Kitų modulių failai\". Jei šis failas priklauso paketui, patikrinkite atitinkamus kompiliatoriaus nustatymus. Jei šis failas priklauso Lazarus, kompiliacija turėtų būti su \"clean\" gaire. Jei failas priklauso FPC, tada tikrinkite \"fpc.cfg\". Jei neaišku, išbandykite \"Projektas -> Kompiliatoriaus parinktys... -> Testas\"."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
|
|
msgid "Unable to find method. Please fix the error shown in the message window."
|
|
msgstr "Nepavyko rasti metodo. Ištaisykite klaidą, rodomą pranešimų lange."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
|
|
msgid "Unable to find the unit of component class %s%s%s."
|
|
msgstr "Nepavyko rasti komponentės klasės %s%s%s modulio."
|
|
|
|
#: lazarusidestrconsts:lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr "Nepavyko susekti pokyčių redaktoriuje."
|
|
|
|
#: lazarusidestrconsts:lisccounabletogetfiledate
|
|
msgid "Unable to get file date of %s."
|
|
msgstr "Nepavyko sužinoti failo \"%s\" datos."
|
|
|
|
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr "Nepavyko gauti pirminio kodo, skirto konstruktoriui."
|
|
|
|
#: lazarusidestrconsts:lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Nepavyko įkelti failą"
|
|
|
|
#: lazarusidestrconsts:lisdebugunabletoloadfile2
|
|
msgid "Unable to load file %s%s%s."
|
|
msgstr "Nepavyko įkelti failą %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
|
|
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
|
msgstr "Nepavyko įkelti senąjį resursų failą.%sResursų failas yra pirmasis įdedamasis failas%s \"initialization\" sekcijoje.%sPavyzdžiui: {$I %s.lrs}.%sKogero tai sintaksės klaida."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
|
|
msgid "Unable to load package"
|
|
msgstr "Įkelti paketą nepavyko"
|
|
|
|
#: lazarusidestrconsts:lisunabletoloadpackage
|
|
msgid "Unable to load package %s%s%s"
|
|
msgstr "Nepavyko įkelti paketą %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
|
msgstr "Įkelti komponentės klasės %s%s%s nepavyks, nes ji turi priklausomybę pačiai sau."
|
|
|
|
#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr "Konstruktorių atverti neis.%s Klasė %s nepaveldi vizualinės klasės, pavyzdžiui tokios kaip TForm ar TDataModule."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
|
|
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
|
msgstr "Nepavyko įkelti paketą %s%s%s.%sŠis paketas paženklintas diegimui."
|
|
|
|
#: lazarusidestrconsts:lisunabletoreadfile
|
|
msgid "Unable to read file"
|
|
msgstr "Nepavyko įkelti failą"
|
|
|
|
#: lazarusidestrconsts:lisunabletoreadfile2
|
|
msgid "Unable to read file %s%s%s!"
|
|
msgstr "Nepavyko skaityti iš failo %s%s%s!"
|
|
|
|
#: lazarusidestrconsts:lisunabletoreadfileerror
|
|
msgid "Unable to read file %s%s%s%sError: %s"
|
|
msgstr "Nepavyko skaityti iš failo %s%s%s%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoreadfilename
|
|
msgid "Unable to read file %s%s%s."
|
|
msgstr "Nepavyko įkelti failą %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
|
|
msgid "Unable to read package file %s%s%s.%sError: %s"
|
|
msgstr "Nepavyko skaityti paketo failą %s%s%s.%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
|
|
msgid "Unable to read state file %s of project %s%sError: %s"
|
|
msgstr "Nepavyko įkelti būsenos failą %s, priklausantį projektui%s.%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
|
|
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
|
msgstr "Nepavyko įkelti būsenos failą %s%s%s%s, priklausantį paketui %s.%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
|
|
msgid "Unable to remove old backup file %s%s%s!"
|
|
msgstr "Nepavyko ištrinti seną atsarginės kopijos failą %s%s%s!"
|
|
|
|
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
|
|
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
|
msgstr "Nepavyko neaiškųjį failą %s%s%s%spervardyti į %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamefile
|
|
msgid "Unable to rename file"
|
|
msgstr "Nepavyko pervardyti failą"
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamefileto
|
|
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
|
msgstr "Nepavyko pervardyti failą %s%s%s į %s%s%s!"
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamefileto2
|
|
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
|
msgstr "Nepavyko pervardyti failą %s%s%s%sį %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Nepavyko pirminiame kode pervardyti formą."
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Nepavyko pervardyti metodą. Ištaisykite klaidą, rodoma pranešimų lange."
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Nepavyko pirminiame kode pervardyti kintamąjį."
|
|
|
|
#: lazarusidestrconsts:lisexttoolunabletorunthetool
|
|
msgid "Unable to run the tool %s%s%s:%s%s"
|
|
msgstr "Nepavyko startuoti įrankį %s%s%s:%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletosavefile
|
|
msgid "Unable to save file %s%s%s"
|
|
msgstr "Nepavyko įrašyti failą %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr "Kraštą pririšti prie komponentės neįmanoma"
|
|
|
|
#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr "Dabartinės klasės abstraktūs metodai nerodomi, nes"
|
|
|
|
#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
|
|
msgid "Unable to show method. Please fix the error shown in the message window."
|
|
msgstr "Nepavyko parodyti metodą. Ištaisykite klaidą, rodomą pranešimų lange."
|
|
|
|
#: lazarusidestrconsts:lisunabletostreamt
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "Nepavyko siųsti srautu %s:T%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr "Pažymėtųjų komponenčių persiųsti srautu nepavyko."
|
|
|
|
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr "Nepavyko pasirinktas komponentes nusiųsti srautu."
|
|
|
|
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "Nepavyko dvejetainį komponento %s:T%s srautą transformuoti į tekstą."
|
|
|
|
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "Nepavyko projekto pirminiame kode atnaujinti sakinį \"CreateStatement\""
|
|
|
|
#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
|
|
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
|
|
msgstr "Neina atnaujinti dvejetainio failo%s%s%spagal tekstinį resursų failą%s%s%s%sGreičiausiai yra sugedęs tekstinis failas."
|
|
|
|
#: lazarusidestrconsts:lisunabletowrite2
|
|
msgid "Unable to write %s%s%s"
|
|
msgstr "Neina rašyti į %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletowrite
|
|
msgid "Unable to write %s%s%s%s%s."
|
|
msgstr "Nepavyko rašyti į %s%s%s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletowritefile
|
|
msgid "Unable to write file"
|
|
msgstr "Nepavyko rašyti į failą"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritefile2
|
|
msgid "Unable to write file %s%s%s"
|
|
msgstr "Nepavyko rašyti į failą %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritefileerror
|
|
msgid "Unable to write file %s%s%s%sError: %s"
|
|
msgstr "Nepavyko rašyti į failą %s%s%s%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritefilename
|
|
msgid "Unable to write file %s%s%s."
|
|
msgstr "Nepavyko rašyti į failą %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lislazbuildunabletowritefile
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr "Nepavyko rašyti į failą \"%s\":%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
|
|
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
|
msgstr "Nepavyko paketą %s%s%s%sįrašyti į failą %s%s%s.%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
|
|
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
|
msgstr "Nepavyko rašyti į failą %s%s%s%s, priklausantį paketui %s.%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
|
|
msgid "Unable to write state file for project %s%sError: %s"
|
|
msgstr "Nepavyko rašyti į projektui %s priklausantį failą.%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritetofile2
|
|
msgid "Unable to write to file %s%s%s"
|
|
msgstr "Neįmanoma rašyti į failą %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritetofile
|
|
msgid "Unable to write to file %s%s%s!"
|
|
msgstr "Nepavyko rašyti į failą %s%s%s!"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
|
|
msgid "Unable to write xml stream to %s%sError: %s"
|
|
msgstr "Neina rašyti xml srauto į %s%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:dlguncertopt
|
|
msgid "Uncertain Optimizations"
|
|
msgstr "Neužtikrinta optimizacija"
|
|
|
|
#: lazarusidestrconsts:lismenuuncommentselection
|
|
msgid "Uncomment selection"
|
|
msgstr "Nuimti komentarą nuo pažymetojo"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "Padaryti neapibrėžtu"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "Visus padaryti neapibrėžtais"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Rekursyviai padaryti neapibrėžtu"
|
|
|
|
#: lazarusidestrconsts:dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Pabraukimas"
|
|
|
|
#: lazarusidestrconsts:lismenuundo
|
|
msgid "Undo"
|
|
msgstr "Grąžinti"
|
|
|
|
#: lazarusidestrconsts:dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Išsaugojus grąžinimas neišvalomas"
|
|
|
|
#: lazarusidestrconsts:dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Grąžinimų riba"
|
|
|
|
#: lazarusidestrconsts:srkmecblockunindent
|
|
msgid "Unindent block"
|
|
msgstr "Naikinti bloko įtrauką"
|
|
|
|
#: lazarusidestrconsts:lismenuunindentselection
|
|
msgid "Unindent selection"
|
|
msgstr "Naikinti įtrauką pažymėjime"
|
|
|
|
#: lazarusidestrconsts:lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "Išdiegti"
|
|
|
|
#: lazarusidestrconsts:lispckexpluninstallonnextstart
|
|
msgid "Uninstall on next start"
|
|
msgstr "Išdiegti kitąkart startuojant"
|
|
|
|
#: lazarusidestrconsts:lispkgmanguninstallpackage2
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Išdiegti paketą %s?"
|
|
|
|
#: lazarusidestrconsts:lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Išdiegti paketą?"
|
|
|
|
#: lazarusidestrconsts:lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "Išdiegti pažymėtą"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypeunit
|
|
msgid "Unit"
|
|
msgstr "Modulis"
|
|
|
|
#: lazarusidestrconsts:lisunithaschangedsave
|
|
msgid "Unit %s%s%s has changed. Save?"
|
|
msgstr "Modulis %s%s%s pakeistas. Įrašyti?"
|
|
|
|
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
|
|
msgid "Unit %s%s%s was removed from package"
|
|
msgstr "Modulis %s%s%s pašalintas iš paketo"
|
|
|
|
#: lazarusidestrconsts:lisa2punitfilename2
|
|
msgid "Unit File Name:"
|
|
msgstr "Modulio failo vardas:"
|
|
|
|
#: lazarusidestrconsts:uemshowunitinfo
|
|
msgid "Unit Info"
|
|
msgstr "Informacija apie modulį"
|
|
|
|
#: lazarusidestrconsts:lisa2punitnameinvalid
|
|
msgid "Unit Name Invalid"
|
|
msgstr "Klaidingas modulio vardas"
|
|
|
|
#: lazarusidestrconsts:lisa2punitname
|
|
msgid "Unit Name:"
|
|
msgstr "Modulio vardas:"
|
|
|
|
#: lazarusidestrconsts:lisaf2punitname
|
|
msgid "Unit Name: "
|
|
msgstr "Modulio vardas: "
|
|
|
|
#: lazarusidestrconsts:lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr "Modulio išvesties katalogas"
|
|
|
|
#: lazarusidestrconsts:lispkgdefsunitpath
|
|
msgid "Unit Path"
|
|
msgstr "Kelias iki modulio"
|
|
|
|
#: lazarusidestrconsts:dlgcounitstyle
|
|
msgid "Unit Style:"
|
|
msgstr "Modulio stilius:"
|
|
|
|
#: lazarusidestrconsts:dlgunitdepcaption
|
|
msgid "Unit dependencies"
|
|
msgstr "Modulio priklausomybės"
|
|
|
|
#: lazarusidestrconsts:lisa2punitfilename
|
|
msgid "Unit file name:"
|
|
msgstr "Modulio failo vardas:"
|
|
|
|
#: lazarusidestrconsts:lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Modulio identifikatorius egzistuoja"
|
|
|
|
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Modulio vardas jau egzistuoja"
|
|
|
|
#: lazarusidestrconsts:lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr "Modulio vardas prasideda..."
|
|
|
|
#: lazarusidestrconsts:lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr "Modulio varde yra..."
|
|
|
|
#: lazarusidestrconsts:lisunitnotfound
|
|
msgid "Unit not found"
|
|
msgstr "Modulis nerastas"
|
|
|
|
#: lazarusidestrconsts:lispkgsysunitnotfound
|
|
msgid "Unit not found: %s%s%s"
|
|
msgstr "Modulis nerastas: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr "Modulio išvesties katalogas (-FU):"
|
|
|
|
#: lazarusidestrconsts:lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Modulių keliai"
|
|
|
|
#: lazarusidestrconsts:lisunitlfmfile
|
|
msgid "Unit: %s%sLFM file: %s"
|
|
msgstr "Modulis: %s%sLFM failas: %s"
|
|
|
|
#: lazarusidestrconsts:lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Modulio vardas egzistuoja"
|
|
|
|
#: lazarusidestrconsts:lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Modulio vardas jau paminėtas projekte"
|
|
|
|
#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr "Modulio ir failo vardai nesutampa.%sPavyzdžiui: jei modulis \"Unit1\" tada failas \"unit1.pas\"."
|
|
|
|
#: lazarusidestrconsts:lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr "Modulio vardas:"
|
|
|
|
#: lazarusidestrconsts:lisunitsnotfound2
|
|
msgid "Units not found"
|
|
msgstr "Moduliai nerasti"
|
|
|
|
#: lazarusidestrconsts:lismenuviewunits
|
|
msgid "Units..."
|
|
msgstr "Moduliai..."
|
|
|
|
#: lazarusidestrconsts:srvk_unknown
|
|
msgid "Unknown"
|
|
msgstr "Nežinomas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Neišsaugotas paketas"
|
|
|
|
#: lazarusidestrconsts:dlgupword
|
|
msgid "Up"
|
|
msgstr "Viršun"
|
|
|
|
#: lazarusidestrconsts:lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Atnaujinimas"
|
|
|
|
#: lazarusidestrconsts:lispckoptsupdaterebuild
|
|
msgid "Update/Rebuild"
|
|
msgstr "Atnaujinti/Daryti"
|
|
|
|
#: lazarusidestrconsts:lismenuuppercaseselection
|
|
msgid "Uppercase selection"
|
|
msgstr "Pažymėjime visas raides didžiosiomis"
|
|
|
|
#: lazarusidestrconsts:lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Naudojimas"
|
|
|
|
#: lazarusidestrconsts:dlgcoansistr
|
|
msgid "Use Ansi Strings"
|
|
msgstr "Naudoti ANSI eilutes"
|
|
|
|
#: lazarusidestrconsts:dlgpouseappbundle
|
|
msgid "Use Application Bundle for running and debugging (darwin only)"
|
|
msgstr "Startui ir derinimui naudoti programą-rišulį (tik dėl Darwin)"
|
|
|
|
#: lazarusidestrconsts:lisuseexcludefilter
|
|
msgid "Use Exclude Filter"
|
|
msgstr "Naudoti neįtraukimo filtrą"
|
|
|
|
#: lazarusidestrconsts:dlgcoheaptrc
|
|
msgid "Use Heaptrc Unit"
|
|
msgstr "Naudoti \"Heaptrc\" modulį"
|
|
|
|
#: lazarusidestrconsts:lisuseincludefilter
|
|
msgid "Use Include Filter"
|
|
msgstr "Naudoti įterpimo filtrą"
|
|
|
|
#: lazarusidestrconsts:dlgusecustomconfig
|
|
msgid "Use addional Compiler Config File"
|
|
msgstr "Naudoti papildomą kompiliatoriaus nustatymų failą"
|
|
|
|
#: lazarusidestrconsts:dlgedusedefcolor
|
|
msgid "Use default color"
|
|
msgstr "Naudoti numatytą spalvą"
|
|
|
|
#: lazarusidestrconsts:dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Dirbti ekrane"
|
|
|
|
#: lazarusidestrconsts:dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Naudoti paleidžiančiąją programą"
|
|
|
|
#: lazarusidestrconsts:dlgpousemanifest
|
|
msgid "Use manifest file to enable themes (windows only)"
|
|
msgstr "Naudoti manifest failą temų įgalinimui (tik dėl Windows)"
|
|
|
|
#: lazarusidestrconsts:dlgusefpccfg
|
|
msgid "Use standard Compiler Config File (fpc.cfg)"
|
|
msgstr "Naudoti standartinį kompiliatoriaus nustatymų failą (fpc.cfg)"
|
|
|
|
#: lazarusidestrconsts:dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Paryškinti sintaksę"
|
|
|
|
#: lazarusidestrconsts:lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Naudoti modulį"
|
|
|
|
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
|
|
msgid "Use windowmanager setting"
|
|
msgstr "Naudoti langų tvarkytuvės nuostatas"
|
|
|
|
#: lazarusidestrconsts:lisplduser
|
|
msgid "User"
|
|
msgstr "Naudotojas"
|
|
|
|
#: lazarusidestrconsts:srkmecuserfirst
|
|
msgid "User First"
|
|
msgstr "Pirma naudotojas"
|
|
|
|
#: lazarusidestrconsts:dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Naudotojo nurodytas prievardis"
|
|
|
|
#: lazarusidestrconsts:dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Naudotojo nurodytas prievardis (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts:dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Naudotojo pakeitimai"
|
|
|
|
#: lazarusidestrconsts:lisceuses
|
|
msgid "Uses"
|
|
msgstr "Naudojamieji"
|
|
|
|
#: lazarusidestrconsts:dlgvaluecolor
|
|
msgid "Value"
|
|
msgstr "Vertė"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr "Vertė failų kelių pavidalu"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Vertė teksto pavidalu"
|
|
|
|
#: lazarusidestrconsts:dlgrunovariable
|
|
msgid "Variable"
|
|
msgstr "Kintamasis"
|
|
|
|
#: lazarusidestrconsts:lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Kintamojo vardas"
|
|
|
|
#: lazarusidestrconsts:dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Kintamojo prefiksas"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Kintamasis:"
|
|
|
|
#: lazarusidestrconsts:lisctdefvariable
|
|
msgid "Variable: %s"
|
|
msgstr "Kintamasis: %s"
|
|
|
|
#: lazarusidestrconsts:liscevariables
|
|
msgid "Variables"
|
|
msgstr "Kintamieji"
|
|
|
|
#: lazarusidestrconsts:dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Pranešimų gausa kompiliuojant:"
|
|
|
|
#: lazarusidestrconsts:lisversion
|
|
msgid "Version"
|
|
msgstr "Versija"
|
|
|
|
#: lazarusidestrconsts:versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Versijos informacija"
|
|
|
|
#: lazarusidestrconsts:rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr "Versijos numeracija"
|
|
|
|
#: lazarusidestrconsts:rsversion
|
|
msgid "Version:"
|
|
msgstr "Versija:"
|
|
|
|
#: lazarusidestrconsts:lisvertical
|
|
msgid "Vertical"
|
|
msgstr "Vertikaliai "
|
|
|
|
#: lazarusidestrconsts:dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Vertikalūs tarpai tarp tinklelio taškų"
|
|
|
|
#: lazarusidestrconsts:lismenuviewanchoreditor
|
|
msgid "View Anchor Editor"
|
|
msgstr "Rodyti prieraišų redaktorių"
|
|
|
|
#: lazarusidestrconsts:uemviewcallstack
|
|
msgid "View Call Stack"
|
|
msgstr "Rodyti kreipčių dėklą"
|
|
|
|
#: lazarusidestrconsts:srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "Rodyti kodo tyrinėtoją"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcomponentpalette
|
|
msgid "View Component Palette"
|
|
msgstr "Rodyti komponenčių paletę"
|
|
|
|
#: lazarusidestrconsts:srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr "Rodyti dokumentacijos redaktorių"
|
|
|
|
#: lazarusidestrconsts:lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Rodyti formas"
|
|
|
|
#: lazarusidestrconsts:lismenuviewidespeedbuttons
|
|
msgid "View IDE speed buttons"
|
|
msgstr "Rodyti IKA sparčiuosius mygtukus"
|
|
|
|
#: lazarusidestrconsts:lismenuviewjumphistory
|
|
msgid "View Jump-History ..."
|
|
msgstr "Rodyti peršokimų istoriją..."
|
|
|
|
#: lazarusidestrconsts:srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Rodyti objektų inspektorių"
|
|
|
|
#: lazarusidestrconsts:lispckeditviewpackgesource
|
|
msgid "View Package Source"
|
|
msgstr "Rodyti paketo pirminį kodą"
|
|
|
|
#: lazarusidestrconsts:lisviewprojectunits
|
|
msgid "View Project Units"
|
|
msgstr "Projekto moduliai"
|
|
|
|
#: lazarusidestrconsts:srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Rodyti ieškos rezultatus"
|
|
|
|
#: lazarusidestrconsts:lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Rodyti pirminį kodą (.lfm)"
|
|
|
|
#: lazarusidestrconsts:srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Rodyti pirminio kodo redaktorių"
|
|
|
|
#: lazarusidestrconsts:lispeviewtodolist
|
|
msgid "View ToDo list"
|
|
msgstr "Rodyti ToDo sąrašą"
|
|
|
|
#: lazarusidestrconsts:lismenuviewunitdependencies
|
|
msgid "View Unit Dependencies"
|
|
msgstr "Rodyti modulio priklausomybes"
|
|
|
|
#: lazarusidestrconsts:liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr "Rodyti informaciją apie modulį"
|
|
|
|
#: lazarusidestrconsts:lismenuviewunitinfo
|
|
msgid "View Unit Information"
|
|
msgstr "Rodyti informaciją apie modulį"
|
|
|
|
#: lazarusidestrconsts:lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Rodyti modulius"
|
|
|
|
#: lazarusidestrconsts:srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Rodyti prieraišų redaktorių"
|
|
|
|
#: lazarusidestrconsts:srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Rodyti stabdos taškus"
|
|
|
|
#: lazarusidestrconsts:srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Rodyti kreipčių dėklą"
|
|
|
|
#: lazarusidestrconsts:srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr "Rodyti kodo naršyklę"
|
|
|
|
#: lazarusidestrconsts:srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Rodyti komponenčių paletę"
|
|
|
|
#: lazarusidestrconsts:srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr "Rodyti komponentes"
|
|
|
|
#: lazarusidestrconsts:srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Rodyti derintuvės išvestį"
|
|
|
|
#: lazarusidestrconsts:srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Rodyti formas"
|
|
|
|
#: lazarusidestrconsts:liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr "Rodyti peršokimų istoriją"
|
|
|
|
#: lazarusidestrconsts:srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Rodyti vietinius kintamuosius"
|
|
|
|
#: lazarusidestrconsts:srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Meniu \"Rodymas\" komandos"
|
|
|
|
#: lazarusidestrconsts:srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Rodyti pranešimus"
|
|
|
|
#: lazarusidestrconsts:dlgmainviewforms
|
|
msgid "View project forms"
|
|
msgstr "Rodyti projekto formas"
|
|
|
|
#: lazarusidestrconsts:liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr "Rodyti projekto parinktis"
|
|
|
|
#: lazarusidestrconsts:liskmviewprojectsource
|
|
msgid "View project source"
|
|
msgstr "Rodyti projekto pirminį kodą"
|
|
|
|
#: lazarusidestrconsts:dlgmainviewunits
|
|
msgid "View project units"
|
|
msgstr "Rodyti projekto modulius"
|
|
|
|
#: lazarusidestrconsts:srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr "Rodyti apribojimų naršyklę"
|
|
|
|
#: lazarusidestrconsts:srkmecviewtodolist
|
|
msgid "View todo list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Rodyti modulio priklausomybes"
|
|
|
|
#: lazarusidestrconsts:srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Rodyti informaciją apie modulį"
|
|
|
|
#: lazarusidestrconsts:srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Rodyti modulius"
|
|
|
|
#: lazarusidestrconsts:srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Rodyti stebimuosius"
|
|
|
|
#: lazarusidestrconsts:lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Žiūriklės"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypevirtualunit
|
|
msgid "Virtual Unit"
|
|
msgstr "Virtualus modulis"
|
|
|
|
#: lazarusidestrconsts:lisaf2pisvirtualunit
|
|
msgid "Virtual unit (source is not in package)"
|
|
msgstr "Virtualus modulis (pakete nėra pirminio kodo)"
|
|
|
|
#: lazarusidestrconsts:dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Kairioji paraštė matoma"
|
|
|
|
#: lazarusidestrconsts:dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Dešinioji paraštė matoma"
|
|
|
|
#: lazarusidestrconsts:lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr "ĮSPĖJIMAS: "
|
|
|
|
#: lazarusidestrconsts:dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Perspėti prieš kompiliuojant"
|
|
|
|
#: lazarusidestrconsts:lisccowarningcaption
|
|
msgid "Warning"
|
|
msgstr "Įspėjimas"
|
|
|
|
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr "Perspėjimas: papildomo kompiliatoriaus nustatymų failo vardas yra toks pat kaip ir FreePascal ieškomo standartinio nustatymų failo. Dėl to, praleidžiant standartinį nustatymų failą, bus analizuojamas TIK papildomas nustatymų failas."
|
|
|
|
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
|
|
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
|
msgstr "Dėmesio: failas %s%s%s%s jau priklauso šiam projektui."
|
|
|
|
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
|
|
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
|
msgstr "Dėmesio: rastas neaiškus failas: %s%s%s. Pirminio kodo failas: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:liswatchpropert
|
|
msgid "Watch Properties"
|
|
msgstr "Stebimųjų savybės"
|
|
|
|
#: lazarusidestrconsts:liswlwatchlist
|
|
msgid "Watch list"
|
|
msgstr "Stebimų sąrašas"
|
|
|
|
#: lazarusidestrconsts:lismenuviewwatches
|
|
msgid "Watches"
|
|
msgstr "Stebimieji"
|
|
|
|
#: lazarusidestrconsts:dlgautocreatenewforms
|
|
msgid "When creating new forms, add them to auto-created forms"
|
|
msgstr "Kuriant nauja formą, ją įdėti į automatiškai kuriamų formų sąrašą"
|
|
|
|
#: lazarusidestrconsts:lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Perjungiant failą kodo redaktoriuje"
|
|
|
|
#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
|
|
msgid "When this file is active in source editor ..."
|
|
msgstr "Kai šis failas pirminio kodo redaktoriuje aktyvus..."
|
|
|
|
#: lazarusidestrconsts:lisfindfilewhere
|
|
msgid "Where"
|
|
msgstr "Kur"
|
|
|
|
#: lazarusidestrconsts:dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Plotis:"
|
|
|
|
#: lazarusidestrconsts:dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr "Win32 grafinės sąsajos programa"
|
|
|
|
#: lazarusidestrconsts:dlgwindow
|
|
msgid "Window"
|
|
msgstr "Langas"
|
|
|
|
#: lazarusidestrconsts:dlgwinpos
|
|
msgid "Window Positions"
|
|
msgstr "Langų pozicijos"
|
|
|
|
#: lazarusidestrconsts:lislazbuildwithstaticpackages
|
|
msgid "With packages"
|
|
msgstr "Su paketais"
|
|
|
|
#: lazarusidestrconsts:liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "Su reikiamais paketais"
|
|
|
|
#: lazarusidestrconsts:liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Žodis ties žymekliu veikiamąjame redaktoriuje"
|
|
|
|
#: lazarusidestrconsts:srkmecwordcompletion
|
|
msgid "Word completion"
|
|
msgstr "Užbaigti žodį"
|
|
|
|
#: lazarusidestrconsts:dlgwordspolicies
|
|
msgid "Words"
|
|
msgstr "Žodžiai"
|
|
|
|
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
|
|
msgid "Working Directory (Leave empty for file path)"
|
|
msgstr "Darbinis katalogas (palikite tuščią failo keliui)"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Darbinis katalogas:"
|
|
|
|
#: lazarusidestrconsts:dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Darbinis katalogas"
|
|
|
|
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
|
|
msgid "Working directory (Leave empty for file path)"
|
|
msgstr "Darbinis katalogas (palikite tuščią failo keliui)"
|
|
|
|
#: lazarusidestrconsts:lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr "Darbinis katalogas darant"
|
|
|
|
#: lazarusidestrconsts:lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr "Darbinis katalogas startuojant"
|
|
|
|
#: lazarusidestrconsts:liswriteerror
|
|
msgid "Write Error"
|
|
msgstr "Rašymo klaida"
|
|
|
|
#: lazarusidestrconsts:dlgwritefpclogo
|
|
msgid "Write an FPC logo"
|
|
msgstr "Įrašyti FPC logotipą"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefswriteerror
|
|
msgid "Write error"
|
|
msgstr "Klaida rašant"
|
|
|
|
#: lazarusidestrconsts:liswriteerrorfile
|
|
msgid "Write error: %s%sFile: %s%s%s"
|
|
msgstr "Klaida rašant: %s%sFailas: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "\"Write\" prefiksas"
|
|
|
|
#: lazarusidestrconsts:lisxmlerror
|
|
msgid "XML Error"
|
|
msgstr "XML klaida"
|
|
|
|
#: lazarusidestrconsts:lisxmlfiles
|
|
msgid "XML files"
|
|
msgstr "XML failai"
|
|
|
|
#: lazarusidestrconsts:lisxmlparsererrorinfileerror
|
|
msgid "XML parser error in file %s%sError: %s"
|
|
msgstr "XML analizatorius klaida, failas: %s%sKlaida: %s"
|
|
|
|
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
msgid "You can not build lazarus while debugging or compiling."
|
|
msgstr "Derinimo ar kompiliavimo metu negalima daryti Lazarus."
|
|
|
|
#: lazarusidestrconsts:dlgdoesnotexist
|
|
msgid "\" does not exist."
|
|
msgstr "\" neegzistuoja."
|
|
|
|
#: lazarusidestrconsts:uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "\" nėra skirtas rašymui."
|
|
|
|
#: lazarusidestrconsts:lisexttooltitlecompleted
|
|
msgid "\"%s\" completed"
|
|
msgstr "\"%s\" baigta"
|
|
|
|
#: lazarusidestrconsts:srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "nutraukti darymą"
|
|
|
|
#: lazarusidestrconsts:srkmecaddbreakpoint
|
|
msgid "add break point"
|
|
msgstr "padėti stabdos tašką"
|
|
|
|
#: lazarusidestrconsts:srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "stebėti"
|
|
|
|
#: lazarusidestrconsts:srvk_apps
|
|
msgid "application key"
|
|
msgstr "programos klavišas"
|
|
|
|
#: lazarusidestrconsts:lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "automatiškai diegti kaip dinamišką"
|
|
|
|
#: lazarusidestrconsts:lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "automatiškai diegti kaip statišką"
|
|
|
|
#: lazarusidestrconsts:lisbegins
|
|
msgid "begins"
|
|
msgstr "prasideda"
|
|
|
|
#: lazarusidestrconsts:srkmecbuildall
|
|
msgid "build all files of program/project"
|
|
msgstr "daryti visus programos/projekto failus"
|
|
|
|
#: lazarusidestrconsts:srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "daryti failą"
|
|
|
|
#: lazarusidestrconsts:srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "daryti programą/projektą"
|
|
|
|
#: lazarusidestrconsts:dlglefttopclr
|
|
msgid "color for left, top"
|
|
msgstr "Apatinės bei viršutinės spalva"
|
|
|
|
#: lazarusidestrconsts:dlgrightbottomclr
|
|
msgid "color for right, bottom"
|
|
msgstr "Kairiosios bei dešiniosios spalva"
|
|
|
|
#: lazarusidestrconsts:lisccomsgppunotfound
|
|
msgid "compiled FPC unit not found: %s.ppu"
|
|
msgstr "Nerastas sukompiliuotas FPC modulis: %s.ppu"
|
|
|
|
#: lazarusidestrconsts:srkmeccompileroptions
|
|
msgid "compiler options"
|
|
msgstr "kompiliatoriaus parinktys"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
|
|
msgid "compiler path"
|
|
msgstr "Kompiliatoriaus programa"
|
|
|
|
#: lazarusidestrconsts:srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "Derinti failo darytuvę"
|
|
|
|
#: lazarusidestrconsts:liscontains
|
|
msgid "contains"
|
|
msgstr "yra"
|
|
|
|
#: lazarusidestrconsts:lisccocontains
|
|
msgid "contains "
|
|
msgstr "yra "
|
|
|
|
#: lazarusidestrconsts:liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "naudotojo parinktys"
|
|
|
|
#: lazarusidestrconsts:liscodefault
|
|
msgid "default (%s)"
|
|
msgstr "numatytas (%s)"
|
|
|
|
#: lazarusidestrconsts:lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr "nepridemas simbolis"
|
|
|
|
#: lazarusidestrconsts:lisccoenglishmessagefilemissing
|
|
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
|
msgstr "trūksta FPC angliškų pranešimų failo:components/codetools/fpc.errore.msg"
|
|
|
|
#: lazarusidestrconsts:srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr "įvertinti/modifikuoti"
|
|
|
|
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
|
|
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgstr "Failas, į kurį bus rašoma derinimo išvestis. Jei jis nenurodytas, tai derinimo išvestis bus spauzdinama konsolėje."
|
|
|
|
#: lazarusidestrconsts:lisfpcmakefailed
|
|
msgid "fpcmake failed"
|
|
msgstr "\"fpcmake\" nepavyko"
|
|
|
|
#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
|
|
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
|
msgstr "FreePascal programa, naudojanti TCustomApplication, skirta lengvam komandinės eilutės parinkčių tikrinimui, išskirtinių situacijų apdorojimui ir kt. Programos failu automatiškai rūpinsis Lazarus."
|
|
|
|
#: lazarusidestrconsts:lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
|
|
#: lazarusidestrconsts:dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr "Internacionalizacija"
|
|
|
|
#: lazarusidestrconsts:rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr "Internacionalizacijos nuostatos"
|
|
|
|
#: lazarusidestrconsts:lisuidinproject
|
|
msgid "in Project:"
|
|
msgstr "Projekte:"
|
|
|
|
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr "visuose atvertuose paketuose ir projektuose"
|
|
|
|
#: lazarusidestrconsts:lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "šiame modulyje"
|
|
|
|
#: lazarusidestrconsts:lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "pagrindiniame projekte"
|
|
|
|
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr "projekte/pakete, kuriam priklauso šis modulis"
|
|
|
|
#: lazarusidestrconsts:lisincludepath
|
|
msgid "include path"
|
|
msgstr "kelias iki įterpinių"
|
|
|
|
#: lazarusidestrconsts:srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "inspektuoti"
|
|
|
|
#: lazarusidestrconsts:lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "įdiektas kaip dinaminis"
|
|
|
|
#: lazarusidestrconsts:lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "įdiegtas kaip statinis"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
|
|
msgid "invalid Compiler filename"
|
|
msgstr "Klaidingas kompiliatoriaus failo vardas"
|
|
|
|
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [parinktys] <projekto_failo_vardas>"
|
|
|
|
#: lazarusidestrconsts:srvk_lwin
|
|
msgid "left windows key"
|
|
msgstr "kairysis windows klavišas"
|
|
|
|
#: lazarusidestrconsts:lislibrarypath
|
|
msgid "library path"
|
|
msgstr "kelias iki bibliotekos"
|
|
|
|
#: lazarusidestrconsts:lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr "laužiama eilutė"
|
|
|
|
#: lazarusidestrconsts:lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr "saistyklės parinktys"
|
|
|
|
#: lazarusidestrconsts:dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "Mažosiomis raidėmis"
|
|
|
|
#: lazarusidestrconsts:lisprojectmacrounitpath
|
|
msgid "macro ProjectUnitPath"
|
|
msgstr "makrokomanda ProjectUnitPath"
|
|
|
|
#: lazarusidestrconsts:lisoipmissing
|
|
msgid "missing"
|
|
msgstr "trūksta"
|
|
|
|
#: lazarusidestrconsts:lisoipmodified
|
|
msgid "modified"
|
|
msgstr "pakeistas"
|
|
|
|
#: lazarusidestrconsts:lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr "rasti keli kompiliatoriaus nustatymų failai: "
|
|
|
|
#: lazarusidestrconsts:lisnew
|
|
msgid "new"
|
|
msgstr "naujas"
|
|
|
|
#: lazarusidestrconsts:lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr "naujos eilutės simboliai"
|
|
|
|
#: lazarusidestrconsts:lisuidno
|
|
msgid "no"
|
|
msgstr "ne"
|
|
|
|
#: lazarusidestrconsts:dlgnoautomaticrenaming
|
|
msgid "no automatic renaming"
|
|
msgstr "Automatiškai nepervardyti"
|
|
|
|
#: lazarusidestrconsts:lisccdnoclass
|
|
msgid "no class"
|
|
msgstr "jokia klasė"
|
|
|
|
#: lazarusidestrconsts:liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr "nerastas \"fpc.cfg\""
|
|
|
|
#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
|
|
msgid "no inherited description found"
|
|
msgstr "paveldėtas aprašymas nerastas"
|
|
|
|
#: lazarusidestrconsts:lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr "ne ASCII"
|
|
|
|
#: lazarusidestrconsts:lisnoname
|
|
msgid "noname"
|
|
msgstr "bevardis"
|
|
|
|
#: lazarusidestrconsts:lisnone2
|
|
msgid "none"
|
|
msgstr "nieks"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "nėra pažymėtų elementų"
|
|
|
|
#: lazarusidestrconsts:lisobjectpath
|
|
msgid "object path"
|
|
msgstr "kelias iki objekto"
|
|
|
|
#: lazarusidestrconsts:lisold
|
|
msgid "old"
|
|
msgstr "senas"
|
|
|
|
#: lazarusidestrconsts:lisor
|
|
msgid "or"
|
|
msgstr "arba"
|
|
|
|
#: lazarusidestrconsts:lispckeditpackagenotsaved
|
|
msgid "package %s not saved"
|
|
msgstr "paketas %s neišsaugotas"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
|
|
msgid "package main source file"
|
|
msgstr "paketo pagrindinis pirminio kodo failas"
|
|
|
|
#: lazarusidestrconsts:srkmecpause
|
|
msgid "pause program"
|
|
msgstr "pristabdyti programos veiką"
|
|
|
|
#: lazarusidestrconsts:lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr "pažymėkite makrokomandą"
|
|
|
|
#: lazarusidestrconsts:lisccoppuexiststwice
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr "ppu dubliuojasi: %s, %s"
|
|
|
|
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
|
msgstr "Pirminis katalogas nustatymamų failams, kuriame Lazarus laikys savo nustatymų failus. Numatytasis yra"
|
|
|
|
#: lazarusidestrconsts:srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "kompiliuoti greitai, nesaistyti"
|
|
|
|
#: lazarusidestrconsts:lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "tik skaitymui"
|
|
|
|
#: lazarusidestrconsts:lisccorelunitpathfoundincfg
|
|
msgid "relative unit path found in fpc cfg: %s"
|
|
msgstr "\"fpc.cfg\" faile rastas reliatyvus modulio kelias: %s"
|
|
|
|
#: lazarusidestrconsts:lisremove
|
|
msgid "remove"
|
|
msgstr "pašalinti"
|
|
|
|
#: lazarusidestrconsts:srkmecremovebreakpoint
|
|
msgid "remove break point"
|
|
msgstr "pašalinti stabdos tašką"
|
|
|
|
#: lazarusidestrconsts:srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "atstatyti derintuvę"
|
|
|
|
#: lazarusidestrconsts:srvk_rwin
|
|
msgid "right windows key"
|
|
msgstr "dešinysis windows klavišas"
|
|
|
|
#: lazarusidestrconsts:srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "startuoti failą"
|
|
|
|
#: lazarusidestrconsts:srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "starto parametrai"
|
|
|
|
#: lazarusidestrconsts:srkmecrun
|
|
msgid "run program"
|
|
msgstr "startuoti programą"
|
|
|
|
#: lazarusidestrconsts:lissaveallmodified
|
|
msgid "save all modified files"
|
|
msgstr "Įrašyti visus pakeistus failus"
|
|
|
|
#: lazarusidestrconsts:lissavecurrenteditorfile
|
|
msgid "save current editor file"
|
|
msgstr "Įrašyti dabartinį redaktoriaus failą"
|
|
|
|
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
|
|
msgid "search all &open files"
|
|
msgstr "Visuose &atvertuose failuose"
|
|
|
|
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
|
|
msgid "search all files in &project"
|
|
msgstr "Visuose &projekto failuose"
|
|
|
|
#: lazarusidestrconsts:lisfindfilesearchindirectories
|
|
msgid "search in &directories"
|
|
msgstr "&Kataloguose"
|
|
|
|
#: lazarusidestrconsts:dlgtimesecondunit
|
|
msgid "sec"
|
|
msgstr "s."
|
|
|
|
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
|
|
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
|
msgstr "Antrinis katalogas nustatymų failams, kuriame Lazarus ieškos nustatymų šablonų failų. Numatytasis yra"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
|
|
msgid "set FPC mode to DELPHI"
|
|
msgstr "perjungti FPC veikseną į DELPHI"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
|
|
msgid "set FPC mode to GPC"
|
|
msgstr "perjungti FPC veikseną į GPC"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
|
|
msgid "set FPC mode to TP"
|
|
msgstr "perjungti FPC veikseną į TP"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetiocheckson
|
|
msgid "set IOCHECKS on"
|
|
msgstr "Įjungti IOCHECKS"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
|
|
msgid "set OVERFLOWCHECKS on"
|
|
msgstr "Įjungti OVERFLOWCHECKS"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetrangecheckson
|
|
msgid "set RANGECHECKS on"
|
|
msgstr "Įjungti RANGECHECKS"
|
|
|
|
#: lazarusidestrconsts:lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr "padedamas tarpo simbolis"
|
|
|
|
#: lazarusidestrconsts:lisccospaces
|
|
msgid "spaces"
|
|
msgstr "tarpo simboliai"
|
|
|
|
#: lazarusidestrconsts:lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr "specialūs simboliai"
|
|
|
|
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
|
|
msgid "static packages config file"
|
|
msgstr "statinio paketo nustatymų failas"
|
|
|
|
#: lazarusidestrconsts:srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "sustabdyti programos veiką"
|
|
|
|
#: lazarusidestrconsts:listhishelpmessage
|
|
msgid "this help message"
|
|
msgstr "Tai žinyno pranešimas"
|
|
|
|
#: lazarusidestrconsts:lisunitpath
|
|
msgid "unit path"
|
|
msgstr "kelias iki modulio"
|
|
|
|
#: lazarusidestrconsts:srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "nežinoma redaktoriaus komana"
|
|
|
|
#: lazarusidestrconsts:lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr "bereikšmiai simboliai"
|
|
|
|
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
|
|
msgid "use HeapTrc unit"
|
|
msgstr "naudoti HeapTrc modulį"
|
|
|
|
#: lazarusidestrconsts:lisedtdefuselineinfounit
|
|
msgid "use LineInfo unit"
|
|
msgstr "naudoti LineInfo modulį"
|
|
|
|
#: lazarusidestrconsts:lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr "baigiamas žodis"
|
|
|
|
#: lazarusidestrconsts:lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr "klaidingas kelio skirtukas"
|
|
|
|
#: lazarusidestrconsts:lisuidyes
|
|
msgid "yes"
|
|
msgstr "taip"
|
|
|