mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-12-16 01:40:37 +01:00
11043 lines
375 KiB
Plaintext
11043 lines
375 KiB
Plaintext
msgid ""
|
||
msgstr ""
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
|
||
#: lazarusidestrconsts:srkmcommand1
|
||
msgid " command1 \""
|
||
msgstr " команда1 \""
|
||
|
||
#: lazarusidestrconsts:srkmcommand2
|
||
msgid " command2 \""
|
||
msgstr " команда2 \""
|
||
|
||
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
|
||
msgid " A token %s%s%s already exists! "
|
||
msgstr "Елемент %s%s%s вже існує! "
|
||
|
||
#: lazarusidestrconsts:srkmalreadyconnected
|
||
msgid " The key \"%s\" is already connected to \"%s\"."
|
||
msgstr "Клавіша \"%s\" вже приєднана до \"%s\"."
|
||
|
||
#: lazarusidestrconsts:srkmconflicw
|
||
msgid " conflicts with "
|
||
msgstr " конфліктує з "
|
||
|
||
#: lazarusidestrconsts:liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%s (компілюю ...)"
|
||
|
||
#: lazarusidestrconsts:lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%s (йде налагодження ...)"
|
||
|
||
#: lazarusidestrconsts:liscovarious
|
||
msgid "%s (various)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewproject
|
||
msgid "%s - (new project)"
|
||
msgstr "%s - (новий проект)"
|
||
|
||
#: lazarusidestrconsts:lislazarusversionstring
|
||
msgid "%s beta"
|
||
msgstr "%s бета"
|
||
|
||
#: lazarusidestrconsts:lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "%s байтів"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "тека %s"
|
||
|
||
#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
||
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s вже є частиною проекту."
|
||
|
||
#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "Тека проекту %s"
|
||
|
||
#: lazarusidestrconsts:lisunitinpackage
|
||
msgid "%s unit %s in package %s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "%s%s%s є некоректною назвою проекту.%s Виберіть іншу (напр., project1.lpi)"
|
||
|
||
#: lazarusidestrconsts:lissvuoisnotavalididentifier
|
||
msgid "%s%s%s is not a valid identifier."
|
||
msgstr "%s%s%s є некоректним ідентифікатором."
|
||
|
||
#: lazarusidestrconsts:lisa2pisnotavalidunitname
|
||
msgid "%s%s%s is not a valid unit name."
|
||
msgstr "%s%s%s є некоректною назвою модуля"
|
||
|
||
#: lazarusidestrconsts:liscoclickokifaresuretodothat
|
||
msgid "%s%sClick OK if you are sure to do that."
|
||
msgstr "%s%sКлацніть ОК, ящко Ви впевнені це зробити"
|
||
|
||
#: lazarusidestrconsts:lispkgsysfilename
|
||
msgid "%s%sFile Name: %s%s%s"
|
||
msgstr "%s%sНазва файлу: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr "%s%sНеможливо змінити клас %s на %s"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitname
|
||
msgid "%s%sUnit Name: %s%s%s"
|
||
msgstr "%s%sНазва модуля: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s, Сторінка: %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "%s, автоматично створене"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
|
||
msgid "%s, project specific"
|
||
msgstr "%s, пов'язаний з проектом"
|
||
|
||
#: lazarusidestrconsts:lisuereadonly
|
||
msgid "%s/ReadOnly"
|
||
msgstr "%s/тільки для читання"
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s%s"
|
||
msgstr "%sДодавання нової залежності до пакунку %s: пакунку %s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s%s"
|
||
msgstr "%sДодавання нової залежності до проекту %s: пакунок %s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr "%sОбидва пакунки є пов'язаними. Це означає, що або один із них використовує інший, або обидва вони використовуються третім пакунком."
|
||
|
||
#: lazarusidestrconsts:lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%sОпис: %s"
|
||
|
||
#: lazarusidestrconsts:lisa2pexistingfile
|
||
msgid "%sExisting file: %s%s%s"
|
||
msgstr "%sІснуючий файл: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr "%sДив.. Проект -> Інспектор проекту"
|
||
|
||
#: lazarusidestrconsts:lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr "%sСтан: "
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
||
msgstr "%sНаступні модулі будуть додані до розділу uses %s%s:%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "%sЦей пакунок вже встановлений, але файлу lpk не знайдено"
|
||
|
||
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
|
||
msgid "%sThis package was automatically created"
|
||
msgstr "%sЦей пакунок створений автоматично"
|
||
|
||
#: lazarusidestrconsts:lisnone
|
||
msgid "%snone"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswladd
|
||
msgid "&Add"
|
||
msgstr "&Додати"
|
||
|
||
#: lazarusidestrconsts:uemaddbreakpoint
|
||
msgid "&Add Breakpoint"
|
||
msgstr "&Додати точку зупину"
|
||
|
||
#: lazarusidestrconsts:lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcasesensitive
|
||
msgid "&Case Sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilecasesensitive
|
||
msgid "&Case sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisclose
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: lazarusidestrconsts:uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "&Закрити сторінку"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "&Компоненти"
|
||
|
||
#: lazarusidestrconsts:liswldelete
|
||
msgid "&Delete"
|
||
msgstr "&Видалити"
|
||
|
||
#: lazarusidestrconsts:lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "&Правка"
|
||
|
||
#: lazarusidestrconsts:lisenableall
|
||
msgid "&Enable All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlenabled
|
||
msgid "&Enabled"
|
||
msgstr "&Доступний"
|
||
|
||
#: lazarusidestrconsts:dlgentirescope
|
||
msgid "&Entire Scope"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufile
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: lazarusidestrconsts:lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "&Знайти опис"
|
||
|
||
#: lazarusidestrconsts:dlgfromcursor
|
||
msgid "&From Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgglobal
|
||
msgid "&Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "&Перехід на закладку"
|
||
|
||
#: lazarusidestrconsts:lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "&Довідка"
|
||
|
||
#: lazarusidestrconsts:lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr "&Об'єкти"
|
||
|
||
#: lazarusidestrconsts:lisok
|
||
msgid "&Ok"
|
||
msgstr "&Гаразд"
|
||
|
||
#: lazarusidestrconsts:uemopenfileatcursor
|
||
msgid "&Open file at cursor"
|
||
msgstr "&Відкрити файл біля курсора"
|
||
|
||
#: lazarusidestrconsts:lismenupackage
|
||
msgid "&Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuproject
|
||
msgid "&Project"
|
||
msgstr "&Проект"
|
||
|
||
#: lazarusidestrconsts:dlgpromptonreplace
|
||
msgid "&Prompt On Replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlproperties
|
||
msgid "&Properties"
|
||
msgstr "&Властивості"
|
||
|
||
#: lazarusidestrconsts:dlgregularexpressions
|
||
msgid "&Regular Expressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfileregularexpressions
|
||
msgid "&Regular expressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsremove
|
||
msgid "&Remove"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenureplace2
|
||
msgid "&Replace ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgreplacewith
|
||
msgid "&Replace With"
|
||
msgstr "&Замінити на"
|
||
|
||
#: lazarusidestrconsts:lismenurun
|
||
msgid "&Run"
|
||
msgstr "&Виконати"
|
||
|
||
#: lazarusidestrconsts:uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "&Виконувати до курсора"
|
||
|
||
#: lazarusidestrconsts:lismenusearch
|
||
msgid "&Search"
|
||
msgstr "П&ошук"
|
||
|
||
#: lazarusidestrconsts:dlgselectedtext
|
||
msgid "&Selected Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemsetbookmark
|
||
msgid "&Set Bookmark"
|
||
msgstr "&Встановити закладку"
|
||
|
||
#: lazarusidestrconsts:lissourcebreakpoint
|
||
msgid "&Source breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtexttofing
|
||
msgid "&Text to Find"
|
||
msgstr "&Текст не знайдено"
|
||
|
||
#: lazarusidestrconsts:lismenutools
|
||
msgid "&Tools"
|
||
msgstr "&Інструменти"
|
||
|
||
#: lazarusidestrconsts:lismenuview
|
||
msgid "&View"
|
||
msgstr "&Вигляд"
|
||
|
||
#: lazarusidestrconsts:lismenuviewsource
|
||
msgid "&View Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwholewordsonly
|
||
msgid "&Whole Words Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilewholewordsonly
|
||
msgid "&Whole words only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuwindow
|
||
msgid "&Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscefilter
|
||
msgid "(Filter)"
|
||
msgstr "(Фільтр)"
|
||
|
||
#: lazarusidestrconsts:dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(немає підтеки)"
|
||
|
||
#: lazarusidestrconsts:listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(невідомий макрос: %s)"
|
||
|
||
#: lazarusidestrconsts:lisplistall
|
||
msgid "<All>"
|
||
msgstr "<Всі>"
|
||
|
||
#: lazarusidestrconsts:liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<НІЧОГО>"
|
||
|
||
#: lazarusidestrconsts:lisplistnone
|
||
msgid "<None>"
|
||
msgstr "<нічого>"
|
||
|
||
#: lazarusidestrconsts:lisa2pchooseanexistingfile
|
||
msgid "<choose an existing file>"
|
||
msgstr "<виберіть існуючий файл>"
|
||
|
||
#: lazarusidestrconsts:lismodifiedlgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<Не вибрано змінних>"
|
||
|
||
#: lazarusidestrconsts:lisoff
|
||
msgid "? (Off)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lison
|
||
msgid "? (On)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
||
msgstr "%s не може вміщувати компоненти TControl.%sВ ньому можна розміщувати тільки невізуальні компоненти."
|
||
|
||
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
|
||
msgid "A file %s%s%s already exists.%sReplace it?"
|
||
msgstr "Файл %s%s%s вже існує.%s Замінити?"
|
||
|
||
#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Модуль паскаля має мати розширення .pp або .pas"
|
||
|
||
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
|
||
msgid "A required packages was not found. See package graph."
|
||
msgstr "Необхідний пакунок не знайдений. Див. діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
||
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
||
msgstr "Простий програманий файл на Паскалі.%sМоже бути використаний для швидкого і чорнового тестування.%sА краще створіть новий проект."
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr "Нормальний інструмент обов'язково має мати заголовок і назву файлу."
|
||
|
||
#: lazarusidestrconsts:lispdabort
|
||
msgid "Abort"
|
||
msgstr "Перервати"
|
||
|
||
#: lazarusidestrconsts:lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "Перервати збирання"
|
||
|
||
#: lazarusidestrconsts:lisabortall
|
||
msgid "Abort all"
|
||
msgstr "Прервати все"
|
||
|
||
#: lazarusidestrconsts:lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "Прервати всі завантаження"
|
||
|
||
#: lazarusidestrconsts:liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "Перервати побудову"
|
||
|
||
#: lazarusidestrconsts:lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "Перервати завантаження проекту"
|
||
|
||
#: lazarusidestrconsts:lisabortwholeloading
|
||
msgid "Abort whole loading"
|
||
msgstr "Повністю перевати завантаження"
|
||
|
||
#: lazarusidestrconsts:lismenutemplateabout
|
||
msgid "About"
|
||
msgstr "Про"
|
||
|
||
#: lazarusidestrconsts:lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "Про проект Lazarus"
|
||
|
||
#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
|
||
msgid "Abstract methods - not yet overridden"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissamabstractmethodsof
|
||
msgid "Abstract methods of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_accept
|
||
msgid "Accept"
|
||
msgstr "Прийняти"
|
||
|
||
#: lazarusidestrconsts:lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildaboaction
|
||
msgid "Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "Дія: %s"
|
||
|
||
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr "Активувати синтаксис регулярних виразів для тексту і заміни (майже як в perl)"
|
||
|
||
#: lazarusidestrconsts:liscodetempladd
|
||
msgid "Add"
|
||
msgstr "Додати"
|
||
|
||
#: lazarusidestrconsts:lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "Додати %s до проекту?"
|
||
|
||
#: lazarusidestrconsts:uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "Додати спостереження біля курсора"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfile
|
||
msgid "Add File"
|
||
msgstr "Додати файл"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "Додати файли"
|
||
|
||
#: lazarusidestrconsts:rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
|
||
msgid "Add LFM, LRS files, if they exist"
|
||
msgstr "Додати LFM, LRS файли, якщо вони існують"
|
||
|
||
#: lazarusidestrconsts:lisa2paddunit
|
||
msgid "Add Unit"
|
||
msgstr "Додати модуль"
|
||
|
||
#: lazarusidestrconsts:lismenuaddcurunittopkg
|
||
msgid "Add active unit to a package"
|
||
msgstr "Додати активний модуль до проекту"
|
||
|
||
#: lazarusidestrconsts:liskmaddactiveunittoproject
|
||
msgid "Add active unit to project"
|
||
msgstr "Додати активний модуль до проекту"
|
||
|
||
#: lazarusidestrconsts:lispckeditaddanitem
|
||
msgid "Add an item"
|
||
msgstr "Додати пункт"
|
||
|
||
#: lazarusidestrconsts:dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmaddbreakpoint
|
||
msgid "Add break point"
|
||
msgstr "Додати точку зупину"
|
||
|
||
#: lazarusidestrconsts:lismenuaddbreakpoint
|
||
msgid "Add breakpoint"
|
||
msgstr "Додати точку зупину"
|
||
|
||
#: lazarusidestrconsts:liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "Додати шаблон коду"
|
||
|
||
#: lazarusidestrconsts:lismenuaddtoproject
|
||
msgid "Add editor file to Project"
|
||
msgstr "Додати файл редактора до проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojaddeditorfile
|
||
msgid "Add editor files"
|
||
msgstr "Додати файли редактора"
|
||
|
||
#: lazarusidestrconsts:lisaf2paddfiletoapackage
|
||
msgid "Add file to a package"
|
||
msgstr "Додати файл до пакунку"
|
||
|
||
#: lazarusidestrconsts:lisprojaddaddfiletoproject
|
||
msgid "Add file to project:"
|
||
msgstr "Додати файл до проекту:"
|
||
|
||
#: lazarusidestrconsts:lisprojaddfiles
|
||
msgid "Add files"
|
||
msgstr "Додати файли"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfilestopackage
|
||
msgid "Add files to package"
|
||
msgstr "Додати файли до пакунку"
|
||
|
||
#: lazarusidestrconsts:srkmecaddjumppoint
|
||
msgid "Add jump point"
|
||
msgstr "Додати точку переходу"
|
||
|
||
#: lazarusidestrconsts:lismenuaddjumppointtohistory
|
||
msgid "Add jump point to history"
|
||
msgstr "Додати точку переходу до історії"
|
||
|
||
#: lazarusidestrconsts:liscodehelpaddlinkbutton
|
||
msgid "Add link"
|
||
msgstr "Додати зв'язок"
|
||
|
||
#: lazarusidestrconsts:lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "Додати параметри до підпорядкованих пакунків і проектів"
|
||
|
||
#: lazarusidestrconsts:liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "Додати шлях"
|
||
|
||
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "Додати шляхи до залежних пакунків/проектів"
|
||
|
||
#: lazarusidestrconsts:dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "Додавати символ 'крапка з комою'"
|
||
|
||
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
|
||
msgid "Add to favourite properties"
|
||
msgstr "Додати до улюблених властивостей"
|
||
|
||
#: lazarusidestrconsts:lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "Додати до пакунку"
|
||
|
||
#: lazarusidestrconsts:lisprojaddtoproject
|
||
msgid "Add to project"
|
||
msgstr "Додати до проекту"
|
||
|
||
#: lazarusidestrconsts:lisaddtounitsearchpath
|
||
msgid "Add to unit search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr "Додати модуль до операторної частини uses пакунку. Унеможливити це тільки для модулів, які в жодному випадку не треба компілювати"
|
||
|
||
#: lazarusidestrconsts:liskmaddwatch
|
||
msgid "Add watch"
|
||
msgstr "Додати спостереження"
|
||
|
||
#: lazarusidestrconsts:lismenuaddwatch
|
||
msgid "Add watch ..."
|
||
msgstr "Додати спостереження..."
|
||
|
||
#: lazarusidestrconsts:dlgedadd
|
||
msgid "Add..."
|
||
msgstr "Додати..."
|
||
|
||
#: lazarusidestrconsts:dlgadditionalsrcpath
|
||
msgid "Additional Source search path for all projects (.pp;.pas)"
|
||
msgstr "Додаткові шляхи до коду для всіх проектів (.pp;.pas)"
|
||
|
||
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
|
||
msgid "Additional compiler options inherited from packages"
|
||
msgstr "Додаткові параметри компілятора, наслідувані від пакунків"
|
||
|
||
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr "Додаткові файли для пошуку (напр. /path/*.pas;/path2/*.pp)"
|
||
|
||
#: lazarusidestrconsts:rsadditionalinfo
|
||
msgid "Additional info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr "Додатковий пошуковий шлях"
|
||
|
||
#: lazarusidestrconsts:dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "Вирівняти верхній рядок за рахунок коментаря попереду"
|
||
|
||
#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
|
||
msgid "Advanced Build Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr "Африканський"
|
||
|
||
#: lazarusidestrconsts:fdmalignword
|
||
msgid "Align"
|
||
msgstr "Вирівняти"
|
||
|
||
#: lazarusidestrconsts:lisalignment
|
||
msgid "Alignment"
|
||
msgstr "Вирівнювання"
|
||
|
||
#: lazarusidestrconsts:lisemdall
|
||
msgid "All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisallfiles
|
||
msgid "All Files"
|
||
msgstr "Всі файли"
|
||
|
||
#: lazarusidestrconsts:lisallblockslooksok
|
||
msgid "All blocks looks ok."
|
||
msgstr "Додати блоки, що виглядають правильними"
|
||
|
||
#: lazarusidestrconsts:dlgallfiles
|
||
msgid "All files"
|
||
msgstr "Всі файли"
|
||
|
||
#: lazarusidestrconsts:lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "Всі пакунки"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr "Всі проекти"
|
||
|
||
#: lazarusidestrconsts:lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisallowfunctio
|
||
msgid "Allow Function Calls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "Дозволити LABEL і GOTO"
|
||
|
||
#: lazarusidestrconsts:lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr "Дозволити пошук для декількох рядків"
|
||
|
||
#: lazarusidestrconsts:dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "За алфавітом"
|
||
|
||
#: lazarusidestrconsts:srkm_alt
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts:dlgaltsetclmode
|
||
msgid "Alt-Key sets column mode"
|
||
msgstr "Alt-клавіша встан. реж. колонки"
|
||
|
||
#: lazarusidestrconsts:srkmalternkey
|
||
msgid "Alternative key (or 2 keys combination)"
|
||
msgstr "Альтернативна клавіша (або комбінація з 2 клавіш)"
|
||
|
||
#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
|
||
msgid "Always Build before Run"
|
||
msgstr "Завжди Будувати перед Виконанням"
|
||
|
||
#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr "Завжди будувати (навіть якщо нічого не мінялось)"
|
||
|
||
#: lazarusidestrconsts:dlgalwaysvisiblecaret
|
||
msgid "Always visible caret"
|
||
msgstr "Завжди видимий симвок CR"
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr "Двозначний тип предка"
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr "Двозначна назва класу"
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr "Двозначна назва модуля"
|
||
|
||
#: lazarusidestrconsts:lisambiguousunitfound
|
||
msgid "Ambiguous Unit found"
|
||
msgstr "Знайдено двозначний модуль"
|
||
|
||
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr "Знайдено двозначний файл налаштування компілятора"
|
||
|
||
#: lazarusidestrconsts:lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr "Двозначна дія з файлом:"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr "Знайдено двозначний файл"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
||
msgstr "Знайдено двозначний файл: %s%s%s%sЙого може бути переплутано з %s%s%s%s%sВидалити цей файл?"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr "Знайдено двозначні файли"
|
||
|
||
#: lazarusidestrconsts:lisambiguousunitfound2
|
||
msgid "Ambiguous unit found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr "Знайдено модулі з однаково розпізнаними назвами"
|
||
|
||
#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
||
msgstr "При останньому запуску виникла помилка при завантаженні %s!%s%sЗавантажити цей проект знову?"
|
||
|
||
#: lazarusidestrconsts:lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "Тип Предок"
|
||
|
||
#: lazarusidestrconsts:lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
|
||
msgid "Anchor to bottom side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
|
||
msgid "Anchor to left side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
|
||
msgid "Anchor to right side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
|
||
msgid "Anchor to top side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "Додати до розділу"
|
||
|
||
#: lazarusidestrconsts:dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "Програма"
|
||
|
||
#: lazarusidestrconsts:dlgapplicationsettings
|
||
msgid "Application Settings"
|
||
msgstr "Параметри додатку"
|
||
|
||
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
|
||
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Програма%sГрафічна програма на lcl/freepascal. Програмний файл автоматично підтримується lazarus."
|
||
|
||
#: lazarusidestrconsts:dlgbutapply
|
||
msgid "Apply"
|
||
msgstr "Застосувати"
|
||
|
||
#: lazarusidestrconsts:lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "Застосувати зміни"
|
||
|
||
#: lazarusidestrconsts:rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr "Арабська"
|
||
|
||
#: lazarusidestrconsts:dlgcoasis
|
||
msgid "As-Is"
|
||
msgstr "Як є"
|
||
|
||
#: lazarusidestrconsts:lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "За зростанням"
|
||
|
||
#: lazarusidestrconsts:dlgenvask
|
||
msgid "Ask"
|
||
msgstr "Запитати"
|
||
|
||
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr "Запитати перед заміною кожного фрагменту"
|
||
|
||
#: lazarusidestrconsts:dlgcoasmstyle
|
||
msgid "Assembler style:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "Біля"
|
||
|
||
#: lazarusidestrconsts:lispckoptsauthor
|
||
msgid "Author:"
|
||
msgstr "Автор:"
|
||
|
||
#: lazarusidestrconsts:liscodetemplautocompleteon
|
||
msgid "Auto complete on ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgautoform
|
||
msgid "Auto create form when opening unit"
|
||
msgstr "Автостворювання форми при відкритті модуля"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
|
||
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
||
msgstr "Автостворювані елементи не можуть ані редагуватись,%s ані вміщувати неавтостворювані дочірні елементи"
|
||
|
||
#: lazarusidestrconsts:dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "Автовидалення файлу"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes can not be edited."
|
||
msgstr "Автостворювані елементи не можуть редагуватись."
|
||
|
||
#: lazarusidestrconsts:dlgautoident
|
||
msgid "Auto indent"
|
||
msgstr "Автомат. відступ"
|
||
|
||
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "перебудувати при перезбиранні всіх"
|
||
|
||
#: lazarusidestrconsts:dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr "Автоперейменування в нижній регістр"
|
||
|
||
#: lazarusidestrconsts:dlgautosave
|
||
msgid "Auto save"
|
||
msgstr "Автозбереження"
|
||
|
||
#: lazarusidestrconsts:dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr "Автостворювані форми:"
|
||
|
||
#: lazarusidestrconsts:lispckexplautocreated
|
||
msgid "AutoCreated"
|
||
msgstr "Автостворення"
|
||
|
||
#: lazarusidestrconsts:rslanguageautomatic
|
||
msgid "Automatic (or english)"
|
||
msgstr "Автоматично (або англійською)"
|
||
|
||
#: lazarusidestrconsts:lisautomaticfeatures
|
||
msgid "Automatic features"
|
||
msgstr "Автоматичні ознаки"
|
||
|
||
#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
|
||
msgid "Automatically increment version on build"
|
||
msgstr "Автоматично збільшити версію при побудові"
|
||
|
||
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr "Автом. встановлені пакунки"
|
||
|
||
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "Перебудувати за необхідністю автоматично"
|
||
|
||
#: lazarusidestrconsts:dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr "Доступні форми:"
|
||
|
||
#: lazarusidestrconsts:lisavailablepackages
|
||
msgid "Available packages"
|
||
msgstr "Доступні пакунки"
|
||
|
||
#: lazarusidestrconsts:dlgedback
|
||
msgid "Back"
|
||
msgstr "Назад"
|
||
|
||
#: lazarusidestrconsts:fdmorderbackone
|
||
msgid "Back one"
|
||
msgstr "Назад на один"
|
||
|
||
#: lazarusidestrconsts:dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "Тло"
|
||
|
||
#: lazarusidestrconsts:srvk_back
|
||
msgid "Backspace"
|
||
msgstr "Забій"
|
||
|
||
#: lazarusidestrconsts:dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "Резервування"
|
||
|
||
#: lazarusidestrconsts:lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "Резервування не вдалося"
|
||
|
||
#: lazarusidestrconsts:dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr "Після методів"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypebinary
|
||
msgid "Binary"
|
||
msgstr "Бінарне"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "Заблокувати"
|
||
|
||
#: lazarusidestrconsts:dlgblockindent
|
||
msgid "Block indent"
|
||
msgstr "Зсунути блок вправо"
|
||
|
||
#: lazarusidestrconsts:dlgedbold
|
||
msgid "Bold"
|
||
msgstr "Жирний"
|
||
|
||
#: lazarusidestrconsts:uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "Закладки"
|
||
|
||
#: lazarusidestrconsts:lisborderspace
|
||
msgid "BorderSpace"
|
||
msgstr "Ширина бордюру"
|
||
|
||
#: lazarusidestrconsts:lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr "Ширина бордюру навколо контролу. Інші чотири бордюри додані до цієї величини."
|
||
|
||
#: lazarusidestrconsts:lisbottom
|
||
msgid "Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr "Зафіксувати кнопку"
|
||
|
||
#: lazarusidestrconsts:lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr "Ширина бордюру навколо кнопки. Ця величина додана до базової ширини бордюру і використовується для відступів навколо контролу."
|
||
|
||
#: lazarusidestrconsts:lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr "Вниз з еквівалентим відступом"
|
||
|
||
#: lazarusidestrconsts:lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbrachighlight
|
||
msgid "Bracket highlighting"
|
||
msgstr "Підсвітка дужок"
|
||
|
||
#: lazarusidestrconsts:lisbreak
|
||
msgid "Break"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubeaklinesinselection
|
||
msgid "Break Lines in selection"
|
||
msgstr "Розрив рядків у виділеному"
|
||
|
||
#: lazarusidestrconsts:srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "Розірвати рядок і зсунути курсор"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "Розірвати рядок, залишити курсор"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
|
||
msgid "Break on Lazarus Exceptions"
|
||
msgstr "Зупинити на Виключеннях Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "Точки зупину"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr "Точка зупину"
|
||
|
||
#: lazarusidestrconsts:lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr "Порушення залежностей"
|
||
|
||
#: lazarusidestrconsts:lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr "Залежність порушена"
|
||
|
||
#: lazarusidestrconsts:lispatheditbrowse
|
||
msgid "Browse"
|
||
msgstr "Переглянути"
|
||
|
||
#: lazarusidestrconsts:lisbrowseforcompiler
|
||
msgid "Browse for Compiler (%s)"
|
||
msgstr "Перегляд (пошук компілятора) (%s)"
|
||
|
||
#: lazarusidestrconsts:lismenubuild
|
||
msgid "Build"
|
||
msgstr "Побудувати"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildall
|
||
msgid "Build All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildcodetools
|
||
msgid "Build CodeTools"
|
||
msgstr "Побудувати CodeTools"
|
||
|
||
#: lazarusidestrconsts:lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr "Побудувати Команду"
|
||
|
||
#: lazarusidestrconsts:lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "Побудувати файл"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildide
|
||
msgid "Build IDE"
|
||
msgstr "Побудувати IDE"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
|
||
msgid "Build IDE with Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
|
||
msgid "Build IDE without Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildjitform
|
||
msgid "Build JITForm"
|
||
msgstr "Побудувати JITForm"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildlcl
|
||
msgid "Build LCL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubuildlazarus
|
||
msgid "Build Lazarus"
|
||
msgstr "Побудувати Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisbuildnumber
|
||
msgid "Build Number"
|
||
msgstr "Номер побудови"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildoptions
|
||
msgid "Build Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildsynedit
|
||
msgid "Build SynEdit"
|
||
msgstr "Побудувати SynEdit"
|
||
|
||
#: lazarusidestrconsts:lismenubuildall
|
||
msgid "Build all"
|
||
msgstr "Побудувати всі"
|
||
|
||
#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
|
||
msgid "Build all files of project/program"
|
||
msgstr "Побудувати всі файли проекту/програми"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
|
||
msgid "Build components (SynEdit, CodeTools)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildexamples
|
||
msgid "Build examples"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecbuildlazarus
|
||
msgid "Build lazarus"
|
||
msgstr "Побудувати lazarus"
|
||
|
||
#: lazarusidestrconsts:lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "Побудувати новий проект"
|
||
|
||
#: lazarusidestrconsts:liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr "Побудувати проект/програму"
|
||
|
||
#: lazarusidestrconsts:rsbuild
|
||
msgid "Build:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcmacro
|
||
msgid "C Style Macros (global)"
|
||
msgstr "Макроси стилю C (глобально)"
|
||
|
||
#: lazarusidestrconsts:dlgcocops
|
||
msgid "C Style Operators (*=, +=, /= and -=)"
|
||
msgstr "Оператори стилю C (*=, +=, /= and -=)"
|
||
|
||
#: lazarusidestrconsts:dlgcppinline
|
||
msgid "C++ Styled INLINE"
|
||
msgstr "INLINE стилю C++"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertcvskeyword
|
||
msgid "CVS keyword"
|
||
msgstr "Ключ CVS"
|
||
|
||
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr "Викликати процедуру %sRegister%s вибраного модуля"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr "Стек викликів"
|
||
|
||
#: lazarusidestrconsts:liscocallon
|
||
msgid "Call on:"
|
||
msgstr "Виклик:"
|
||
|
||
#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
|
||
msgid "Calling %s to create Makefile from %s failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
|
||
msgid "Can not copy top level component."
|
||
msgstr "Не можу скопіювати компонент верхнього рівня."
|
||
|
||
#: lazarusidestrconsts:liscannotcreatefile
|
||
msgid "Can not create file %s%s%s"
|
||
msgstr "Не можу створити файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Can not register components without unit"
|
||
msgstr "Не можу зареєструвати компоненти без модуля"
|
||
|
||
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr "Можу змінити тільки клас TComponetns"
|
||
|
||
#: lazarusidestrconsts:dlgcancel
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: lazarusidestrconsts:liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr "Скасувати завантаження цього компонету"
|
||
|
||
#: lazarusidestrconsts:liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr "Скасувати завантаження модуля"
|
||
|
||
#: lazarusidestrconsts:liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr "Скасувати зміну назви"
|
||
|
||
#: lazarusidestrconsts:lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr "Не можу знайти список авторів"
|
||
|
||
#: lazarusidestrconsts:liscannotfindlazarusstarter
|
||
msgid "Cannot find lazarus starter:%s%s"
|
||
msgstr "Не можу знайти пускач lazarus:%s%s"
|
||
|
||
#: lazarusidestrconsts:srvk_capital
|
||
msgid "Capital"
|
||
msgstr "Заголовний"
|
||
|
||
#: lazarusidestrconsts:dlgcaretskipsselection
|
||
msgid "Caret skips selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr "Без урахування регістру"
|
||
|
||
#: lazarusidestrconsts:rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr "Каталонська"
|
||
|
||
#: lazarusidestrconsts:liscecategories
|
||
msgid "Categories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listtodolcategory
|
||
msgid "Category"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcentercursorline
|
||
msgid "Center Cursor Line"
|
||
msgstr "Курсор в центрі"
|
||
|
||
#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling"
|
||
msgstr "Відцентрувати контрол по горизонталі відносно заданого рівня"
|
||
|
||
#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling"
|
||
msgstr "Відцентрувати контрол по вертикалі відносно заданого рівня"
|
||
|
||
#: lazarusidestrconsts:liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "Центр вікна"
|
||
|
||
#: lazarusidestrconsts:liscenters
|
||
msgid "Centers"
|
||
msgstr "Центри"
|
||
|
||
#: lazarusidestrconsts:liscodetemplchange
|
||
msgid "Change"
|
||
msgstr "Змінити"
|
||
|
||
#: lazarusidestrconsts:lischangeclass
|
||
msgid "Change Class"
|
||
msgstr "Змінити клас"
|
||
|
||
#: lazarusidestrconsts:lisccdchangeclassof
|
||
msgid "Change Class of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr "Змінити Шрифт"
|
||
|
||
#: lazarusidestrconsts:lischangeparent
|
||
msgid "Change parent ..."
|
||
msgstr "Змінити предка ..."
|
||
|
||
#: lazarusidestrconsts:lismenuinsertchangelogentry
|
||
msgid "ChangeLog entry"
|
||
msgstr "Елемент ChangeLog"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffchangedfiles
|
||
msgid "Changed files:"
|
||
msgstr "Змінені файли:"
|
||
|
||
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr "Зміна назви пакунку або версії порушить залежності. Змінити ці залежності як правило?%sВиберіть Так для заміни всіх перерахованих залежностей.%sВиберіть Ігнорувати для розриву залежностей і продовження."
|
||
|
||
#: lazarusidestrconsts:srkmecchar
|
||
msgid "Char"
|
||
msgstr "Символ"
|
||
|
||
#: lazarusidestrconsts:lischaracter
|
||
msgid "Character"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischaractermap
|
||
msgid "Character Map"
|
||
msgstr "Таблиця символів"
|
||
|
||
#: lazarusidestrconsts:rscharacterset
|
||
msgid "Character set:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuchecklfm
|
||
msgid "Check LFM file in editor"
|
||
msgstr "Перевірити файл LFM в редакторі"
|
||
|
||
#: lazarusidestrconsts:lischeckchangesondiskwithloading
|
||
msgid "Check changes on disk with loading"
|
||
msgstr "Перевірити зміни на диску із завантаженням"
|
||
|
||
#: lazarusidestrconsts:dlgcheckconsistency
|
||
msgid "Check consistency"
|
||
msgstr "Перевірити сумісність"
|
||
|
||
#: lazarusidestrconsts:dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcochecks
|
||
msgid "Checks:"
|
||
msgstr "Перевірки:"
|
||
|
||
#: lazarusidestrconsts:rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "Китайська"
|
||
|
||
#: lazarusidestrconsts:lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr "Змінити теку .po файла"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr "Вибрати пакет Delphi (*.dpk)"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr "Виберіть проект Delphi (*.dpr)"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr "Виберіть модуль Delphi (*.pas)"
|
||
|
||
#: lazarusidestrconsts:lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr "Виберіть теку"
|
||
|
||
#: lazarusidestrconsts:lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr "Виберіть теку коду FPC"
|
||
|
||
#: lazarusidestrconsts:liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr "Вибрати клавішну схему"
|
||
|
||
#: lazarusidestrconsts:lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr "Виберіть теку Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisedoptschoosescheme
|
||
msgid "Choose Scheme"
|
||
msgstr "Вибрати схему"
|
||
|
||
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
|
||
msgid "Choose a base class for the favourite property %s%s%s."
|
||
msgstr "Вибрати базовий клас для улюбленої властивості %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr "Виберіть іншу назву"
|
||
|
||
#: lazarusidestrconsts:dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr "Виберіть файл шаблонів коду (*.dci)"
|
||
|
||
#: lazarusidestrconsts:lischoosecompilerpath
|
||
msgid "Choose compiler filename (%s)"
|
||
msgstr "Виберіть файл компілятора (%s)"
|
||
|
||
#: lazarusidestrconsts:lischoosedebuggerpath
|
||
msgid "Choose debugger filename"
|
||
msgstr "Виберіть файл налагоджувача"
|
||
|
||
#: lazarusidestrconsts:lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr "Виберіть теку"
|
||
|
||
#: lazarusidestrconsts:lischoosemakepath
|
||
msgid "Choose make path"
|
||
msgstr "Виберіть шлях make"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr "Виберіть один із цих пунктів для створення нового файлу"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr "Виберіть один із цих пунктів для створення нового пакунку"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr "Виберіть один із цих пунктів для створення нового проекту"
|
||
|
||
#: lazarusidestrconsts:lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr "Виберіть код програми (*.pp,*.pas,*.lpr)"
|
||
|
||
#: lazarusidestrconsts:lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr "Виберіть структуру для включення в неї виділення"
|
||
|
||
#: lazarusidestrconsts:lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr "Виберіть теку для проб"
|
||
|
||
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
|
||
msgid "Circle in package dependencies"
|
||
msgstr "Циклічна залежність пакунків"
|
||
|
||
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
||
msgstr "Клас %s%s%s не є зареєстрованим класом компонента.%sНе можу вставити."
|
||
|
||
#: lazarusidestrconsts:lisoifclassnotfound
|
||
msgid "Class %s%s%s not found."
|
||
msgstr "Клас %s%s%s не знайдений"
|
||
|
||
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr "Назва класу вже існує"
|
||
|
||
#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic
|
||
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr "Клас не знайдено"
|
||
|
||
#: lazarusidestrconsts:dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr "Порядок класів"
|
||
|
||
#: lazarusidestrconsts:dlgclassinsertpolicy
|
||
msgid "Class part insert policy"
|
||
msgstr "Політика вставки частин класу"
|
||
|
||
#: lazarusidestrconsts:liskmclassic
|
||
msgid "Classic"
|
||
msgstr "Класичний"
|
||
|
||
#: lazarusidestrconsts:liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "Очистити теку"
|
||
|
||
#: lazarusidestrconsts:liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr "Очистити коди Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
|
||
msgid "Clean Up + Build all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildcleanall
|
||
msgid "Clean all"
|
||
msgstr "Очистити всі"
|
||
|
||
#: lazarusidestrconsts:lismenucleandirectory
|
||
msgid "Clean directory ..."
|
||
msgstr "Очистити теку ..."
|
||
|
||
#: lazarusidestrconsts:liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "Очистити підтеки"
|
||
|
||
#: lazarusidestrconsts:liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr "Очистити шлях до модулів?"
|
||
|
||
#: lazarusidestrconsts:lislazbuildcleanbuild
|
||
msgid "Clean+Build"
|
||
msgstr "Очистити+Побудувати"
|
||
|
||
#: lazarusidestrconsts:srvk_clear
|
||
msgid "Clear"
|
||
msgstr "Очистити"
|
||
|
||
#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
|
||
msgid "Clear dependency filename"
|
||
msgstr "Очистити залежності до газви файла"
|
||
|
||
#: lazarusidestrconsts:lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr "Очистити кеш включень (includes)"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr "Очищувати log при виконанні"
|
||
|
||
#: lazarusidestrconsts:lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr "Виберіть один з елементів вище, щоб побачити різницю"
|
||
|
||
#: lazarusidestrconsts:lismenuclose
|
||
msgid "Close"
|
||
msgstr "Закрити"
|
||
|
||
#: lazarusidestrconsts:liskmcloseall
|
||
msgid "Close All"
|
||
msgstr "Очистити Все"
|
||
|
||
#: lazarusidestrconsts:lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "Закрити Проект"
|
||
|
||
#: lazarusidestrconsts:lismenucloseall
|
||
msgid "Close all editor files"
|
||
msgstr "Закрити всі файли редактора"
|
||
|
||
#: lazarusidestrconsts:lissrclosepage
|
||
msgid "Close page"
|
||
msgstr "Закрити сторінку"
|
||
|
||
#: lazarusidestrconsts:liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "Закрити проект"
|
||
|
||
#: lazarusidestrconsts:dlgcodegeneration
|
||
msgid "Code"
|
||
msgstr "Код"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcodebrowser
|
||
msgid "Code Browser"
|
||
msgstr "Браузер Коду"
|
||
|
||
#: lazarusidestrconsts:dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr "Створення коду"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcodeexplorer
|
||
msgid "Code Explorer"
|
||
msgstr "Оглядач коду"
|
||
|
||
#: lazarusidestrconsts:lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr "Кодові шаблони ..."
|
||
|
||
#: lazarusidestrconsts:dlgcodetoolstab
|
||
msgid "Code Tools"
|
||
msgstr "Інструменти коду"
|
||
|
||
#: lazarusidestrconsts:liscodebrowser
|
||
msgid "Code browser"
|
||
msgstr "Браузер коду"
|
||
|
||
#: lazarusidestrconsts:dlgusecodefolding
|
||
msgid "Code folding"
|
||
msgstr "Згортання коду"
|
||
|
||
#: lazarusidestrconsts:dlgedcodeparams
|
||
msgid "Code parameters"
|
||
msgstr "Параметри коду"
|
||
|
||
#: lazarusidestrconsts:srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr "Завершення шаблонів коду"
|
||
|
||
#: lazarusidestrconsts:dlgedcodetempl
|
||
msgid "Code templates"
|
||
msgstr "Кодові шаблони"
|
||
|
||
#: lazarusidestrconsts:lisceocodeexplorer
|
||
msgid "CodeExplorer Options"
|
||
msgstr "Параметри CodeExplorer"
|
||
|
||
#: lazarusidestrconsts:liscodetools
|
||
msgid "CodeTools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
||
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
||
msgstr "CodeTools - це інструменти для синтаксичного аналізу, переглядання і редагування текстів на pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr "Редактор Визначень Інструменів Коду"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
|
||
msgid "CodeTools Defines Preview"
|
||
msgstr "Перегляд налаштувань Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr "Параметри тек Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts:dlgcodetoolsopts
|
||
msgid "CodeTools Options"
|
||
msgstr "Параметри Інструметів Коду"
|
||
|
||
#: lazarusidestrconsts:lismenucodetoolsoptions
|
||
msgid "CodeTools Options ..."
|
||
msgstr "Параметри Інструметів Коду ..."
|
||
|
||
#: lazarusidestrconsts:srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr "Команди Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts:liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr "Редактор визначень інструментів коду"
|
||
|
||
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
|
||
msgid "CodeTools defines editor ..."
|
||
msgstr "Редактор визначень Інструментів Коду ..."
|
||
|
||
#: lazarusidestrconsts:liskmcodetoolsoptions
|
||
msgid "CodeTools options"
|
||
msgstr "Опції інструментів коду"
|
||
|
||
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
|
||
msgid "Codetools defines editor"
|
||
msgstr "Редактор визначень Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts:srkmeccodetoolsoptions
|
||
msgid "Codetools options"
|
||
msgstr "Параметри Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts:liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr "Колапс всіх класів"
|
||
|
||
#: lazarusidestrconsts:liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr "Колапс всіх пакетів"
|
||
|
||
#: lazarusidestrconsts:liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr "Колапс всіх модулів"
|
||
|
||
#: lazarusidestrconsts:lismenucollectpofil
|
||
msgid "Collect .po files"
|
||
msgstr "Зібрати .po файли"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr "Колонка"
|
||
|
||
#: lazarusidestrconsts:dlgedcolor
|
||
msgid "Color"
|
||
msgstr "Колір"
|
||
|
||
#: lazarusidestrconsts:dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr "Кольорова схема"
|
||
|
||
#: lazarusidestrconsts:dlgenvcolors
|
||
msgid "Colors"
|
||
msgstr "Кольори"
|
||
|
||
#: lazarusidestrconsts:srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr "Режим вибирання колонки"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr "Кома"
|
||
|
||
#: lazarusidestrconsts:liscommandafter
|
||
msgid "Command after"
|
||
msgstr "Команда після"
|
||
|
||
#: lazarusidestrconsts:liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr "Некоректна команда \"після\" "
|
||
|
||
#: lazarusidestrconsts:liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr "Команда після установки модуля"
|
||
|
||
#: lazarusidestrconsts:srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr "Команда команди"
|
||
|
||
#: lazarusidestrconsts:dlgcommandlineparameters
|
||
msgid "Command line parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr "Параметри командного рядка (без назви програми)"
|
||
|
||
#: lazarusidestrconsts:liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr "Параметри командного рядка програми"
|
||
|
||
#: lazarusidestrconsts:liscocommand
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: lazarusidestrconsts:lismenucommentselection
|
||
msgid "Comment selection"
|
||
msgstr "Перевести в коментар"
|
||
|
||
#: lazarusidestrconsts:liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "Коментар:"
|
||
|
||
#: lazarusidestrconsts:dlgcocompilation
|
||
msgid "Compilation"
|
||
msgstr "Компіляція"
|
||
|
||
#: lazarusidestrconsts:liscocalloncompile
|
||
msgid "Compile"
|
||
msgstr "Компіл."
|
||
|
||
#: lazarusidestrconsts:liscompileidewithoutlinking
|
||
msgid "Compile IDE (without linking)"
|
||
msgstr "Компіляція IDE (без побудови)"
|
||
|
||
#: lazarusidestrconsts:lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr "Побудувати всі?"
|
||
|
||
#: lazarusidestrconsts:lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr "Побудувати пакунок"
|
||
|
||
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr "Додавання CompiledSrcPath"
|
||
|
||
#: lazarusidestrconsts:liscompiler
|
||
msgid "Compiler"
|
||
msgstr "Компілятор"
|
||
|
||
#: lazarusidestrconsts:dlgcompileroptions
|
||
msgid "Compiler Options"
|
||
msgstr "Параметри компілятора"
|
||
|
||
#: lazarusidestrconsts:lismenucompileroptions
|
||
msgid "Compiler Options ..."
|
||
msgstr "Параметри компілятора ..."
|
||
|
||
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr "Параметри компілятора для пакунку %s"
|
||
|
||
#: lazarusidestrconsts:liscompileroptionsforproject
|
||
msgid "Compiler Options for Project: %s"
|
||
msgstr "Параметри компілятора для проекту: %s"
|
||
|
||
#: lazarusidestrconsts:liscompilererror
|
||
msgid "Compiler error"
|
||
msgstr "Помилка компілятора"
|
||
|
||
#: lazarusidestrconsts:liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr "Назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts:liskmcompileroptions
|
||
msgid "Compiler options"
|
||
msgstr "Опції компілятора"
|
||
|
||
#: lazarusidestrconsts:dlgfpcpath
|
||
msgid "Compiler path (e.g. %s)"
|
||
msgstr "Шлях до компілятора (%s)"
|
||
|
||
#: lazarusidestrconsts:lismenucompletecode
|
||
msgid "Complete Code"
|
||
msgstr "Завершити код"
|
||
|
||
#: lazarusidestrconsts:srkmeccompletecode
|
||
msgid "Complete code"
|
||
msgstr "Завершити код"
|
||
|
||
#: lazarusidestrconsts:dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr "Завершити властивості"
|
||
|
||
#: lazarusidestrconsts:liscomponent
|
||
msgid "Component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class %s%s%s already defined"
|
||
msgstr "Клас компонента %s%s%s вже визначений"
|
||
|
||
#: lazarusidestrconsts:liscomponentnameiskeyword
|
||
msgid "Component name %s%s%s is keyword"
|
||
msgstr "Назву компонента %s%s%s зарезервовано"
|
||
|
||
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
|
||
msgid "Component name %s%s%s is not a valid identifier"
|
||
msgstr "Назва компонента %s%s%s є некоректним ідентифікатором"
|
||
|
||
#: lazarusidestrconsts:lisfpcomponents
|
||
msgid "Components"
|
||
msgstr "Коментарі"
|
||
|
||
#: lazarusidestrconsts:liscondition
|
||
msgid "Condition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmconfigbuildfile
|
||
msgid "Config %sBuild File%s"
|
||
msgstr "Налаштувати %sBuild File%s"
|
||
|
||
#: lazarusidestrconsts:dlgconfigfiles
|
||
msgid "Config Files:"
|
||
msgstr "Файли налаштувань:"
|
||
|
||
#: lazarusidestrconsts:lisconfigurebuildlazarus
|
||
msgid "Configure %sBuild Lazarus%s"
|
||
msgstr "Налаштувати %sПобудувати Lazarus%s"
|
||
|
||
#: lazarusidestrconsts:lisconfigurebuild
|
||
msgid "Configure Build %s"
|
||
msgstr "Налаштувати Побудову %s"
|
||
|
||
#: lazarusidestrconsts:lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr "Налаштувати Побудову+Виконання Файлу ..."
|
||
|
||
#: lazarusidestrconsts:liskmconfigurehelp
|
||
msgid "Configure Help"
|
||
msgstr "Налаштувати Поміч"
|
||
|
||
#: lazarusidestrconsts:lismenuconfigurehelp
|
||
msgid "Configure Help ..."
|
||
msgstr "Налаштувати Довідку ..."
|
||
|
||
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr "Налаштувати \"Побудову Lazarus\" ..."
|
||
|
||
#: lazarusidestrconsts:liskmconfigurecustomcomponents
|
||
msgid "Configure custom components"
|
||
msgstr "Налаштувати нетипові компонети"
|
||
|
||
#: lazarusidestrconsts:lismenuconfigcustomcomps
|
||
msgid "Configure custom components ..."
|
||
msgstr "Налаштувати компоненти користувача ..."
|
||
|
||
#: lazarusidestrconsts:lismenusettings
|
||
msgid "Configure custom tools ..."
|
||
msgstr "Налаштувати інструменти користувача"
|
||
|
||
#: lazarusidestrconsts:liskmconfigureinstalledpackages
|
||
msgid "Configure installed packages"
|
||
msgstr "Налаштувати встановлені пакети"
|
||
|
||
#: lazarusidestrconsts:lismenueditinstallpkgs
|
||
msgid "Configure installed packages ..."
|
||
msgstr "Налаштувати встановлені пакунки ..."
|
||
|
||
#: lazarusidestrconsts:lislazbuildconfirmbuild
|
||
msgid "Confirm before rebuilding Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr "Підтвердити зміни"
|
||
|
||
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr "Підтвердити видалення залежності"
|
||
|
||
#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr "Підтвердити видалення файлу"
|
||
|
||
#: lazarusidestrconsts:liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Конфлікт "
|
||
|
||
#: lazarusidestrconsts:lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr "Знайдений конфлікт"
|
||
|
||
#: lazarusidestrconsts:lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceconstants
|
||
msgid "Constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr "Конструктор має бути 'init' (деструктор має бути 'done')"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr "Зміст"
|
||
|
||
#: lazarusidestrconsts:lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr "Довідка, що залежить від контексту"
|
||
|
||
#: lazarusidestrconsts:liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr "Чутліва до тексту допомога"
|
||
|
||
#: lazarusidestrconsts:liscontinue
|
||
msgid "Continue"
|
||
msgstr "Продовжити"
|
||
|
||
#: lazarusidestrconsts:liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr "Продовжити без завантаження форми"
|
||
|
||
#: lazarusidestrconsts:liscontributors
|
||
msgid "Contributors"
|
||
msgstr "Учасники"
|
||
|
||
#: lazarusidestrconsts:srvk_control
|
||
msgid "Control"
|
||
msgstr "Керування"
|
||
|
||
#: lazarusidestrconsts:liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr "Елемент управління вимагає \"предка\""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr "Параметри перетворення"
|
||
|
||
#: lazarusidestrconsts:lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr "Помилка перетворення"
|
||
|
||
#: lazarusidestrconsts:srvk_convert
|
||
msgid "Convert"
|
||
msgstr "Перетворення"
|
||
|
||
#: lazarusidestrconsts:liskmconvertdfmfiletolfm
|
||
msgid "Convert DFM file to LFM"
|
||
msgstr "Перетворення файлу DFM в LFM"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdfmtolfm
|
||
msgid "Convert DFM file to LFM ..."
|
||
msgstr "Перетворення DFM в LFM ..."
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr "Перетворення пакунку Delphi в пакунок Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphipackage
|
||
msgid "Convert Delphi package to Lazarus package ..."
|
||
msgstr "Перетворення пакунку Delphi в пакунок Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
|
||
msgid "Convert Delphi project to Lazarus project"
|
||
msgstr "Перетворення проекту Delphi в проект Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphiproject
|
||
msgid "Convert Delphi project to Lazarus project ..."
|
||
msgstr "Перетворення проекту Delphi в проект Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
|
||
msgid "Convert Delphi unit to Lazarus unit"
|
||
msgstr "Перетворення модуля Delphi в модуль Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphiunit
|
||
msgid "Convert Delphi unit to Lazarus unit ..."
|
||
msgstr "Перетворення модуля Delphi в модуль Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "Перетворення елементу"
|
||
|
||
#: lazarusidestrconsts:srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr "Перетворення ТАБ в пробіли в виділеному"
|
||
|
||
#: lazarusidestrconsts:lismenucopy
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: lazarusidestrconsts:liscopyall
|
||
msgid "Copy All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr "Помилка при копіюванні"
|
||
|
||
#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
|
||
msgid "Copy all and hidden messages to clipboard"
|
||
msgstr "Копіювати всі і приховані повідомлення в буфер обміну"
|
||
|
||
#: lazarusidestrconsts:liscopyallmessagestoclipboard
|
||
msgid "Copy all messages to clipboard"
|
||
msgstr "Копіювати всі повідомлення в буфер"
|
||
|
||
#: lazarusidestrconsts:liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "Помилка копіювання"
|
||
|
||
#: lazarusidestrconsts:uemcopyfilename
|
||
msgid "Copy filename"
|
||
msgstr "Копіювати назву файлу"
|
||
|
||
#: lazarusidestrconsts:lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr "Копіювати з усадкованого"
|
||
|
||
#: lazarusidestrconsts:lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr "Копіювати назву методу з буферу обміну"
|
||
|
||
#: lazarusidestrconsts:lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
|
||
msgid "Copy selected Components to clipboard"
|
||
msgstr "Копіювати обрані Компоненти в буфер обміну"
|
||
|
||
#: lazarusidestrconsts:lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr "Копіювати вибрані компоненти в буфер"
|
||
|
||
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
|
||
msgid "Copy selected messages to clipboard"
|
||
msgstr "Копіювати"
|
||
|
||
#: lazarusidestrconsts:srkmeccopy
|
||
msgid "Copy selection to clipboard"
|
||
msgstr "Копіювати вибране у буфер обміну"
|
||
|
||
#: lazarusidestrconsts:lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr "Копіювати слово при порожньому"
|
||
|
||
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr "Копіювання всієї форми не реалізоване."
|
||
|
||
#: lazarusidestrconsts:rscopyright
|
||
msgid "Copyright:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr "Лічильник (.pp;1)"
|
||
|
||
#: lazarusidestrconsts:lisnpcreate
|
||
msgid "Create"
|
||
msgstr "Створити"
|
||
|
||
#: lazarusidestrconsts:lismenucreatepofile
|
||
msgid "Create .po files"
|
||
msgstr "Створити файли .po"
|
||
|
||
#: lazarusidestrconsts:dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr "Створити означення для %s Теки"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr "Створити означення для %s Проекту"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr "Створити означення для компілятора FreePascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr "Створити визначення для текстів програми Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
|
||
msgid "Create Defines for Lazarus Directory"
|
||
msgstr "Створити означення для теки Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr "Створити макроси FPC і шляхи до тек проекту FPC"
|
||
|
||
#: lazarusidestrconsts:lismenucreatefpdocfiles
|
||
msgid "Create FPDoc files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcocreatemakefile
|
||
msgid "Create Makefile"
|
||
msgstr "Створити Makefile"
|
||
|
||
#: lazarusidestrconsts:lismenueditorcreatesubmenu
|
||
msgid "Create Submenu"
|
||
msgstr "Створити підменю"
|
||
|
||
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
||
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Створити нову програму cgi.%sФайл програми підтримується Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr "Створити новий файл редактора.%s Виберіть тип."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr "Створити новий порожній текстовий файл."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
|
||
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Створити нову графічну програму.%sЦя програма підтримується Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
|
||
msgid "Create a new pascal unit."
|
||
msgstr "Створити новий модуль паскаля."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
|
||
msgid "Create a new program."
|
||
msgstr "Створити нову програму."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
|
||
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
||
msgstr "Створити нову програму.%sФайл програми підтримується Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr "Створити новий проект"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr "Створити новий проект.%sВиберіть тип."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr "Створити новий стандартний пакунок%sПакунок - це набір модулів і компонентів."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr "Створити новий модуль з формою LCL."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr "Створити новий модуль з модулем даних."
|
||
|
||
#: lazarusidestrconsts:liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr "Спочатку створіть проект!"
|
||
|
||
#: lazarusidestrconsts:liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pcreatenewfile
|
||
msgid "Create new file"
|
||
msgstr "Створити новий файл"
|
||
|
||
#: lazarusidestrconsts:liscreatenewproject
|
||
msgid "Create new project"
|
||
msgstr "Створити новий проект"
|
||
|
||
#: lazarusidestrconsts:dlgruberbandcreationcolor
|
||
msgid "Creation"
|
||
msgstr "Створення"
|
||
|
||
#: lazarusidestrconsts:srkm_ctrl
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts:liscurrent
|
||
msgid "Current"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr "Поточний проект"
|
||
|
||
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
|
||
msgid "Current Project Directory"
|
||
msgstr "Тека поточного проекту"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertdatetime
|
||
msgid "Current date and time"
|
||
msgstr "Поточні дата і час"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertusername
|
||
msgid "Current username"
|
||
msgstr "Поточне ім'я користувача"
|
||
|
||
#: lazarusidestrconsts:dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr "Курсор за межею рядка"
|
||
|
||
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr "Колонка курсора в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr "Команди переміщення курсора"
|
||
|
||
#: lazarusidestrconsts:liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr "Рядок курсора в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts:lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr "Спеціальний"
|
||
|
||
#: lazarusidestrconsts:liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr "Спеціальна програма"
|
||
|
||
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
|
||
msgid "Custom Program%sA freepascal program."
|
||
msgstr "Спеціальна програма%sПрограма мовою FreePascal"
|
||
|
||
#: lazarusidestrconsts:liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr "Спеціальні команди"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr "Спеціальний індентифікатор"
|
||
|
||
#: lazarusidestrconsts:liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr "Спеціальні параметри"
|
||
|
||
#: lazarusidestrconsts:rsiwpcustomposition
|
||
msgid "Custom position"
|
||
msgstr "Спеціальна позиція"
|
||
|
||
#: lazarusidestrconsts:srkmeccustomtool
|
||
msgid "Custom tool %d"
|
||
msgstr "Спеціальний інструмент %d"
|
||
|
||
#: lazarusidestrconsts:lismenucut
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
|
||
msgid "Cut selected Components to clipboard"
|
||
msgstr "Вирізати обрані Компоненти в буфер обміну"
|
||
|
||
#: lazarusidestrconsts:lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr "Вирізати вибрані компоненти в буфер"
|
||
|
||
#: lazarusidestrconsts:srkmeccut
|
||
msgid "Cut selection to clipboard"
|
||
msgstr "Вирізати вибране в буфер обміну"
|
||
|
||
#: lazarusidestrconsts:liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr "Н&едоступні Всі"
|
||
|
||
#: lazarusidestrconsts:lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr "Бази даних"
|
||
|
||
#: lazarusidestrconsts:lisdate
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: lazarusidestrconsts:liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr "Ви&далити Всі"
|
||
|
||
#: lazarusidestrconsts:uemdebugword
|
||
msgid "Debug"
|
||
msgstr "Налагодження"
|
||
|
||
#: lazarusidestrconsts:lismenuviewdebugoutput
|
||
msgid "Debug output"
|
||
msgstr "Повідомлення налагоджувача"
|
||
|
||
#: lazarusidestrconsts:lismenudebugwindows
|
||
msgid "Debug windows"
|
||
msgstr "Вікно налагоджувача..."
|
||
|
||
#: lazarusidestrconsts:lismendebuggeroptions
|
||
msgid "Debugger Options ..."
|
||
msgstr "Параметри налагоджувача ..."
|
||
|
||
#: lazarusidestrconsts:lisdebuggererror
|
||
msgid "Debugger error"
|
||
msgstr "Помилка налагоджувача"
|
||
|
||
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr "Помилка налагоджувача%sОпа! Налагоджувач знаходиться в неробочому стані%sЗбережіть работу!%sНатисніть Стоп і сподівайтесь на краще!"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr "Загальні опції налагоджувача"
|
||
|
||
#: lazarusidestrconsts:lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr "Неправильний налагоджувач"
|
||
|
||
#: lazarusidestrconsts:dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "Додавання до шляхів налагоджувача (порожньо):"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr "Специфічні опції налагоджувача (залежить від його типу)"
|
||
|
||
#: lazarusidestrconsts:dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr "Тип налагоджувача і шлях"
|
||
|
||
#: lazarusidestrconsts:dlgcodebugging
|
||
msgid "Debugging:"
|
||
msgstr "Налагоджування:"
|
||
|
||
#: lazarusidestrconsts:lisdecimal
|
||
msgid "Decimal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgassemblerdefault
|
||
msgid "Default"
|
||
msgstr "Типовий"
|
||
|
||
#: lazarusidestrconsts:dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr "Типовий шрифт редактора"
|
||
|
||
#: lazarusidestrconsts:dlgpasext
|
||
msgid "Default pascal extension"
|
||
msgstr "Стандартне розширення паскаля"
|
||
|
||
#: lazarusidestrconsts:dlgdefvaluecolor
|
||
msgid "Default value"
|
||
msgstr "Типове значення"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr "Визначення"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr "Визначає рекурсивно"
|
||
|
||
#: lazarusidestrconsts:lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr "Визначення шаблонів"
|
||
|
||
#: lazarusidestrconsts:dlgeddelay
|
||
msgid "Delay"
|
||
msgstr "Затримка"
|
||
|
||
#: lazarusidestrconsts:dlgeddelete
|
||
msgid "Delete"
|
||
msgstr "Вилучити"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallinsamesource
|
||
msgid "Delete All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditordeletefromtemplate
|
||
msgid "Delete From Template..."
|
||
msgstr "Видалити шаблон форми"
|
||
|
||
#: lazarusidestrconsts:lismenueditordeleteitem
|
||
msgid "Delete Item"
|
||
msgstr "Вилучити елемент"
|
||
|
||
#: lazarusidestrconsts:srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr "Видалити останній символ"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr "Видалити старий файл пакунку?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallbreakpoints2
|
||
msgid "Delete all breakpoints in file %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteallbreakpoints
|
||
msgid "Delete all breakpoints?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
|
||
msgid "Delete all selected breakpoints?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr "Видалити всі ці файли?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr "Видалити файл з неоднозначною назвою?"
|
||
|
||
#: lazarusidestrconsts:lisdeletebreakpointatline
|
||
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr "Видалити символ біля курсора"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr "Видалити поточний рядок"
|
||
|
||
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr "Видалити залежність для %s?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr "Видалення не вдалося"
|
||
|
||
#: lazarusidestrconsts:lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr "Видалення файлу не вдалося"
|
||
|
||
#: lazarusidestrconsts:liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr "Видалення останнього символу"
|
||
|
||
#: lazarusidestrconsts:liscodehelpdeletelinkbutton
|
||
msgid "Delete link"
|
||
msgstr "Видалити посилання"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "Видалити вузол"
|
||
|
||
#: lazarusidestrconsts:lisdeleteoldfile
|
||
msgid "Delete old file %s%s%s?"
|
||
msgstr "Видалити старий файл %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file %s%s%s?"
|
||
msgstr "Видалити старий файл пакунку %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:fdmdeleteselection
|
||
msgid "Delete selection"
|
||
msgstr "Стерти виділення"
|
||
|
||
#: lazarusidestrconsts:dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr "Видалити шаблон "
|
||
|
||
#: lazarusidestrconsts:srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr "Видалити до початку рядка"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr "Видалити до кінця рядка"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr "Видалити до кінця слова"
|
||
|
||
#: lazarusidestrconsts:srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr "Видалити до початку слова"
|
||
|
||
#: lazarusidestrconsts:srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr "Видалити весь текст"
|
||
|
||
#: lazarusidestrconsts:lisdeletingoffilefailed
|
||
msgid "Deleting of file %s%s%s failed."
|
||
msgstr "Видалення файлу %s%s%s не вдалося."
|
||
|
||
#: lazarusidestrconsts:dlgdelphi2ext
|
||
msgid "Delphi 2 Extensions"
|
||
msgstr "Розширення Delphi 2"
|
||
|
||
#: lazarusidestrconsts:dlgdeplhicomp
|
||
msgid "Delphi Compatible"
|
||
msgstr "Сумісне з Delphi"
|
||
|
||
#: lazarusidestrconsts:lisdelphiproject
|
||
msgid "Delphi project"
|
||
msgstr "Проект Delphi"
|
||
|
||
#: lazarusidestrconsts:lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr "Залежність"
|
||
|
||
#: lazarusidestrconsts:lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr "Властивості Залежності"
|
||
|
||
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr "Залежність вже існує"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr "Залежність без власника:%s"
|
||
|
||
#: lazarusidestrconsts:lissortseldescending
|
||
msgid "Descending"
|
||
msgstr "Спадаюче"
|
||
|
||
#: lazarusidestrconsts:listodoldescription
|
||
msgid "Description"
|
||
msgstr "Опис"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdescriptionabstract
|
||
msgid "Description/Abstract"
|
||
msgstr "Опис/коротко"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr "Опис:"
|
||
|
||
#: lazarusidestrconsts:lisoipdescription
|
||
msgid "Description: "
|
||
msgstr "Опис: "
|
||
|
||
#: lazarusidestrconsts:liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr "Команди дизайнера"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
|
||
msgid "Designtime and Runtime"
|
||
msgstr "При розробці і запуску"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdesigntimeonly
|
||
msgid "Designtime only"
|
||
msgstr "Тільки для розробки"
|
||
|
||
#: lazarusidestrconsts:dlgdesktop
|
||
msgid "Desktop"
|
||
msgstr "Стільниця"
|
||
|
||
#: lazarusidestrconsts:dlgdesktopfiles
|
||
msgid "Desktop files"
|
||
msgstr "Файли стільниці"
|
||
|
||
#: lazarusidestrconsts:lisaf2pdestinationpackage
|
||
msgid "Destination Package"
|
||
msgstr "Пакунок призначення"
|
||
|
||
#: lazarusidestrconsts:lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr "Тека призначення"
|
||
|
||
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
|
||
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
||
msgstr "Тека %s%s%s є некоректною %sВиберіть шлях до компілятора."
|
||
|
||
#: lazarusidestrconsts:lismenudiff
|
||
msgid "Diff"
|
||
msgstr "Порівнянти"
|
||
|
||
#: lazarusidestrconsts:liskmdiffeditorfiles
|
||
msgid "Diff editor files"
|
||
msgstr "Порівняти файли кодів"
|
||
|
||
#: lazarusidestrconsts:lisdigits
|
||
msgid "Digits:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdirection
|
||
msgid "Direction"
|
||
msgstr "Напрямок"
|
||
|
||
#: lazarusidestrconsts:lisdirectives
|
||
msgid "Directives"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr "Тека"
|
||
|
||
#: lazarusidestrconsts:dlgdirectorydoesnotexist
|
||
msgid "Directory does not exist"
|
||
msgstr "Теки не існує"
|
||
|
||
#: lazarusidestrconsts:dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr "Тека для побудови пробних проектів"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr "Теки не існує"
|
||
|
||
#: lazarusidestrconsts:lisfindfiledirectoryoptions
|
||
msgid "Directory options"
|
||
msgstr "Параметри тек"
|
||
|
||
#: lazarusidestrconsts:lisdisableallinsamesource
|
||
msgid "Disable All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdisablegroup
|
||
msgid "Disable Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdisabled
|
||
msgid "Disabled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr "Відкинути зміни"
|
||
|
||
#: lazarusidestrconsts:dlgeddisplay
|
||
msgid "Display"
|
||
msgstr "Показувати"
|
||
|
||
#: lazarusidestrconsts:dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr "Дисплей (не для win32, напр., 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
|
||
#: lazarusidestrconsts:dlglnumsbct
|
||
msgid "Display Line Numbers in Run-time Error Backtraces"
|
||
msgstr "Вивести номери рядків в помилках часу виконання"
|
||
|
||
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr "Розрізняти регістр букв, наприклад, А і а"
|
||
|
||
#: lazarusidestrconsts:dlgcfdividerdrawlevel
|
||
msgid "Divider Draw Level"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdonotclosetheide
|
||
msgid "Do not close the IDE"
|
||
msgstr "Не закривати IDE"
|
||
|
||
#: lazarusidestrconsts:lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "Не закривати проект"
|
||
|
||
#: lazarusidestrconsts:lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr "Не зберігати ніякої сесії"
|
||
|
||
#: lazarusidestrconsts:lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr "Не показувати заставки"
|
||
|
||
#: lazarusidestrconsts:lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr "Не показувати це повідомлення знову."
|
||
|
||
#: lazarusidestrconsts:dlgnotsplitlinefront
|
||
msgid "Do not split line In front of:"
|
||
msgstr "Не розривати рядок перед:"
|
||
|
||
#: lazarusidestrconsts:dlgnotsplitlineafter
|
||
msgid "Do not split line after:"
|
||
msgstr "Не розривати рядок після:"
|
||
|
||
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr "Ви дійсно бажаєте забути всі зміни до пакунку %s і завантажити його з файлу?"
|
||
|
||
#: lazarusidestrconsts:lisconfirmlazarusrebuild
|
||
msgid "Do you want to rebuild Lazarus?"
|
||
msgstr "Перебудувати Lazarus?"
|
||
|
||
#: lazarusidestrconsts:rsiwpdocked
|
||
msgid "Docked"
|
||
msgstr "Пришвартований"
|
||
|
||
#: lazarusidestrconsts:lismvdocking
|
||
msgid "Docking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdocumentationeditor
|
||
msgid "Documentation Editor"
|
||
msgstr "Редактор документації"
|
||
|
||
#: lazarusidestrconsts:liscodehelpnodocumentation
|
||
msgid "Documentation entry does not exist"
|
||
msgstr "Документації немає"
|
||
|
||
#: lazarusidestrconsts:lissortseldomain
|
||
msgid "Domain"
|
||
msgstr "Домен"
|
||
|
||
#: lazarusidestrconsts:listodoldone
|
||
msgid "Done"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdoubleclickline
|
||
msgid "Double click line"
|
||
msgstr "Виділити рядок подв. клацанням"
|
||
|
||
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
||
msgid "Double click on messages jumps (otherwise: single click)"
|
||
msgstr "Перехід за подвійним клацанням на повідомленнях (інакше - за одинарним)"
|
||
|
||
#: lazarusidestrconsts:dlgdownword
|
||
msgid "Down"
|
||
msgstr "Вниз"
|
||
|
||
#: lazarusidestrconsts:dlgdragdroped
|
||
msgid "Drag Drop editing"
|
||
msgstr "Редагування типу Drag Drop"
|
||
|
||
#: lazarusidestrconsts:dlgdropfiles
|
||
msgid "Drop files"
|
||
msgstr "Кинути файли"
|
||
|
||
#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
||
msgstr "Дублювання назви: Компонет з назвою %s%s%s вже існує і в успадкованому компоненті %s"
|
||
|
||
#: lazarusidestrconsts:rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr "Датський"
|
||
|
||
#: lazarusidestrconsts:liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr "В&вімкнути Все"
|
||
|
||
#: lazarusidestrconsts:lismenuenvironent
|
||
msgid "E&nvironment"
|
||
msgstr "&Оточення"
|
||
|
||
#: lazarusidestrconsts:lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsedit
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: lazarusidestrconsts:liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr "Редагувати Коди Шаблонів"
|
||
|
||
#: lazarusidestrconsts:lispckediteditgeneraloptions
|
||
msgid "Edit General Options"
|
||
msgstr "Редагувати Загальні Параметри"
|
||
|
||
#: lazarusidestrconsts:srkmeditkeys
|
||
msgid "Edit Keys"
|
||
msgstr "Змінити клавіші"
|
||
|
||
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
|
||
msgid "Edit Options to compile package"
|
||
msgstr "Редагувати параметри для компіляції пакунку"
|
||
|
||
#: lazarusidestrconsts:lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "Інструмент правки"
|
||
|
||
#: lazarusidestrconsts:lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr "Редагувати шаблони коду"
|
||
|
||
#: lazarusidestrconsts:lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr "Редагувати контекстно-чутливої Допомоги"
|
||
|
||
#: lazarusidestrconsts:liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr "Редагувати контекстно-чутливої Допомоги"
|
||
|
||
#: lazarusidestrconsts:liseteditcustomscanners
|
||
msgid "Edit custom scanners (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeditforcmd
|
||
msgid "Edit keys for command"
|
||
msgstr "Редагувати клавіші для команди"
|
||
|
||
#: lazarusidestrconsts:lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr "Редагувати віртуальний модуль"
|
||
|
||
#: lazarusidestrconsts:dlgededit
|
||
msgid "Edit..."
|
||
msgstr "Редагувати..."
|
||
|
||
#: lazarusidestrconsts:dlgedfiles
|
||
msgid "Editor files"
|
||
msgstr "Файли редактора"
|
||
|
||
#: lazarusidestrconsts:dlgeditorfont
|
||
msgid "Editor font"
|
||
msgstr "Шрифт редактора"
|
||
|
||
#: lazarusidestrconsts:dlgeditorfontheight
|
||
msgid "Editor font height"
|
||
msgstr "Висота шрифту"
|
||
|
||
#: lazarusidestrconsts:liskmeditoroptions
|
||
msgid "Editor options"
|
||
msgstr "Налаштування редактора"
|
||
|
||
#: lazarusidestrconsts:lismenueditoroptions
|
||
msgid "Editor options ..."
|
||
msgstr "Налаштування редактора ..."
|
||
|
||
#: lazarusidestrconsts:uemeditorproperties
|
||
msgid "Editor properties"
|
||
msgstr "Властивості редактора"
|
||
|
||
#: lazarusidestrconsts:dlgedelement
|
||
msgid "Element"
|
||
msgstr "Елемент"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr "Інакше"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr "ElseIf"
|
||
|
||
#: lazarusidestrconsts:lisemdemtpymethods
|
||
msgid "Emtpy Methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenableallinsamesource
|
||
msgid "Enable All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenablegroup
|
||
msgid "Enable Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr "Макрос доступний"
|
||
|
||
#: lazarusidestrconsts:rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenabled
|
||
msgid "Enabled"
|
||
msgstr "Доступний"
|
||
|
||
#: lazarusidestrconsts:lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr "Доступний = Include %s in Anchors"
|
||
|
||
#: lazarusidestrconsts:lisenclose
|
||
msgid "Enclose"
|
||
msgstr "Задужкувати"
|
||
|
||
#: lazarusidestrconsts:uemencloseselection
|
||
msgid "Enclose Selection"
|
||
msgstr "Задужкувати виділене"
|
||
|
||
#: lazarusidestrconsts:liskmencloseselection
|
||
msgid "Enclose selection"
|
||
msgstr "Задужкувати віділене"
|
||
|
||
#: lazarusidestrconsts:lismenuencloseselection
|
||
msgid "Enclose selection ..."
|
||
msgstr "Задужкувати виділення в ..."
|
||
|
||
#: lazarusidestrconsts:srvk_end
|
||
msgid "End"
|
||
msgstr "End"
|
||
|
||
#: lazarusidestrconsts:rslanguageenglish
|
||
msgid "English"
|
||
msgstr "Англійська"
|
||
|
||
#: lazarusidestrconsts:lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr "Введіть дані"
|
||
|
||
#: lazarusidestrconsts:lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr "Введіть параметри запуску"
|
||
|
||
#: lazarusidestrconsts:lisentertransla
|
||
msgid "Enter translation language"
|
||
msgstr "Введіть мову перекладу"
|
||
|
||
#: lazarusidestrconsts:dlgrunoenvironment
|
||
msgid "Environment"
|
||
msgstr "Середовище"
|
||
|
||
#: lazarusidestrconsts:srkmcatenvmenu
|
||
msgid "Environment menu commands"
|
||
msgstr "Команди меню оточення"
|
||
|
||
#: lazarusidestrconsts:lismenugeneraloptions
|
||
msgid "Environment options ..."
|
||
msgstr "Параметри оточення ..."
|
||
|
||
#: lazarusidestrconsts:lisccoerrorcaption
|
||
msgid "Error"
|
||
msgstr "Помилка"
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr "Помилка читання пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr "Помилка запису пакунку"
|
||
|
||
#: lazarusidestrconsts:lisiecoerroraccessingxml
|
||
msgid "Error accessing xml"
|
||
msgstr "Помилка доступу до xml"
|
||
|
||
#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
|
||
msgid "Error accessing xml file %s%s%s:%s%s"
|
||
msgstr "Помилка доступу до xml-файлу %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr "Помилка створення файлу"
|
||
|
||
#: lazarusidestrconsts:liserrorcreatinglrs
|
||
msgid "Error creating lrs"
|
||
msgstr "Помилка створення lrs"
|
||
|
||
#: lazarusidestrconsts:liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr "Помилка видалення файлу"
|
||
|
||
#: lazarusidestrconsts:liserrorin
|
||
msgid "Error in %s"
|
||
msgstr "Помилка в %s"
|
||
|
||
#: lazarusidestrconsts:lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr "Помилка в регулярному виразі"
|
||
|
||
#: lazarusidestrconsts:liserrorinitializingprogramserrors
|
||
msgid "Error initializing program%s%s%s%s%sError: %s"
|
||
msgstr "Помилка ініціалізації програми %s%s%s%s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:liserrorloadingfrom
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoerrorloadingxml
|
||
msgid "Error loading xml"
|
||
msgstr "Помилка завантаження xml"
|
||
|
||
#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
|
||
msgid "Error loading xml file %s%s%s:%s%s"
|
||
msgstr "Помилка завантаження xlm-файлу %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr "Помилка переміщення компонента"
|
||
|
||
#: lazarusidestrconsts:liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr "Помилка переміщення компонента %s:%s"
|
||
|
||
#: lazarusidestrconsts:lisabcreationfailed
|
||
msgid "Error occured during Application Bundle creation: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr "Помилка аналізу потоку lfm компонента"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorreading
|
||
msgid "Error reading %s%s%s%s%s"
|
||
msgstr "Помилка читання %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr "Помилка читання файлу"
|
||
|
||
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr "Помилка читання файлу: %s"
|
||
|
||
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr "Помилка читання списку пакунків з файлу%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
|
||
msgid "Error reading project info file %s%s%s%s%s"
|
||
msgstr "Помилка читання файлу відомостей проекту %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr "Помилка перейменування файлу"
|
||
|
||
#: lazarusidestrconsts:liserrorsavingto
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
|
||
msgid "Error while writing %s%s%s%s%s"
|
||
msgstr "Помилка запису %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
|
||
msgid "Error while writing project info file %s%s%s%s%s"
|
||
msgstr "Помилка запису проекту в файл %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lislazbuilderrorwritingfile
|
||
msgid "Error writing file"
|
||
msgstr "Помилка запису файлу"
|
||
|
||
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr "Помилка запису списку пакунків в файл%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liserror
|
||
msgid "Error: "
|
||
msgstr "Помилка: "
|
||
|
||
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr "Помилка: неправильний компілятор:%s"
|
||
|
||
#: lazarusidestrconsts:liserrors
|
||
msgid "Errors"
|
||
msgstr "Помилки"
|
||
|
||
#: lazarusidestrconsts:srvk_escape
|
||
msgid "Escape"
|
||
msgstr "Escape"
|
||
|
||
#: lazarusidestrconsts:liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr "Обчислити/Змінити"
|
||
|
||
#: lazarusidestrconsts:lismenuevaluate
|
||
msgid "Evaluate/Modify ..."
|
||
msgstr "Обчислити/Змінити..."
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
|
||
msgid "Event Log"
|
||
msgstr "Лог-файл подій"
|
||
|
||
#: lazarusidestrconsts:liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "Приклад"
|
||
|
||
#: lazarusidestrconsts:lisexamples
|
||
msgid "Examples"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexcludefilter
|
||
msgid "Exclude Filter"
|
||
msgstr "Фільтр для виключення"
|
||
|
||
#: lazarusidestrconsts:srvk_execute
|
||
msgid "Execute"
|
||
msgstr "Виконати"
|
||
|
||
#: lazarusidestrconsts:liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr "Виконати після"
|
||
|
||
#: lazarusidestrconsts:liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr "Виконати перед"
|
||
|
||
#: lazarusidestrconsts:lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr "Виконати команду після"
|
||
|
||
#: lazarusidestrconsts:lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr "Виконати команду до"
|
||
|
||
#: lazarusidestrconsts:lisexecutionpaused
|
||
msgid "Execution paused"
|
||
msgstr "Виконання зупинене"
|
||
|
||
#: lazarusidestrconsts:lisexecutionpausedadress
|
||
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
||
msgstr "Виконання зупинене%s Адреса: %s%s Процедура: %s%s Файл: %s%s(Коли-небудь тут з'явиться вікно асемблера :)%s"
|
||
|
||
#: lazarusidestrconsts:lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr "Виконання завершене"
|
||
|
||
#: lazarusidestrconsts:lisexecutionstoppedon
|
||
msgid "Execution stopped%s"
|
||
msgstr "Виконання завершене %s"
|
||
|
||
#: lazarusidestrconsts:lispldexists
|
||
msgid "Exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsexit
|
||
msgid "Exit"
|
||
msgstr "Вихід"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr "Вихід без збереження"
|
||
|
||
#: lazarusidestrconsts:lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr "Розширити всі класи"
|
||
|
||
#: lazarusidestrconsts:lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr "Розширити всі пакети"
|
||
|
||
#: lazarusidestrconsts:lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr "Розширити всі модулі"
|
||
|
||
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr "Повна назва файлу в поточному редакторі"
|
||
|
||
#: lazarusidestrconsts:lisexport
|
||
msgid "Export ..."
|
||
msgstr "Експорт ..."
|
||
|
||
#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr "Експортований файл %s%s%s існує.%sВідкрити файл і замінити тільки налаштування компілятора?%s(Решта налаштувань буде збережена.)"
|
||
|
||
#: lazarusidestrconsts:lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr "Експортований файл існує"
|
||
|
||
#: lazarusidestrconsts:lisexportlist
|
||
msgid "Export list"
|
||
msgstr "Список експорту"
|
||
|
||
#: lazarusidestrconsts:liswlexpression
|
||
msgid "Expression"
|
||
msgstr "Вираз"
|
||
|
||
#: lazarusidestrconsts:lisexpression
|
||
msgid "Expression:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr "Розширити шлях до модулів?"
|
||
|
||
#: lazarusidestrconsts:liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr "Налаштування Зовнішніх інструментів"
|
||
|
||
#: lazarusidestrconsts:srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr "Зовнішній інструмент %d"
|
||
|
||
#: lazarusidestrconsts:lisexttoolexternaltools
|
||
msgid "External tools"
|
||
msgstr "Зовнішні інстументи"
|
||
|
||
#: lazarusidestrconsts:srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr "Налаштування зовнішнього інструменту"
|
||
|
||
#: lazarusidestrconsts:dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr "Міжрядковий інтервал"
|
||
|
||
#: lazarusidestrconsts:lisextract
|
||
msgid "Extract"
|
||
msgstr "Здобути"
|
||
|
||
#: lazarusidestrconsts:uemextractproc
|
||
msgid "Extract Procedure"
|
||
msgstr "Здобути процедуру"
|
||
|
||
#: lazarusidestrconsts:srkmecextractproc
|
||
msgid "Extract procedure"
|
||
msgstr "Здобути процедуру"
|
||
|
||
#: lazarusidestrconsts:lismenuextractproc
|
||
msgid "Extract procedure ..."
|
||
msgstr "Здобути процедуру ..."
|
||
|
||
#: lazarusidestrconsts:lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr "HTML шлях до FPC документації"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr "Тека програм FPC SVN"
|
||
|
||
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
|
||
msgid "FPC Source Directory error"
|
||
msgstr "Помилка теки кодів FPC"
|
||
|
||
#: lazarusidestrconsts:dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr "Тека кодів FPC"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
|
||
msgid "FPC source directory \"%s\" not found."
|
||
msgstr "Не знайдена тека кодів FPC \"%s\"."
|
||
|
||
#: lazarusidestrconsts:lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufpdoceditor
|
||
msgid "FPDoc Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfpdoceditor
|
||
msgid "FPDoc editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
|
||
msgid "FPDoc files path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolfailedtoruntool
|
||
msgid "Failed to run tool"
|
||
msgstr "Не вдалося запустити інструмент"
|
||
|
||
#: lazarusidestrconsts:dlgcofast
|
||
msgid "Faster Code"
|
||
msgstr "Швидкий код"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatefile
|
||
msgid "File"
|
||
msgstr "Файл"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
|
||
msgid "File %s%s%s already exists in the project."
|
||
msgstr "Файл %s%s%s вже є в проекті."
|
||
|
||
#: lazarusidestrconsts:lisfilehaschangedsave
|
||
msgid "File %s%s%s has changed. Save?"
|
||
msgstr "Файл %s%s%s змінений. Зберегти?"
|
||
|
||
#: lazarusidestrconsts:lisfileisvirtual
|
||
msgid "File %s%s%s is virtual."
|
||
msgstr "Файл %s%s%s є віртуальним."
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenotfound
|
||
msgid "File %s%s%s not found."
|
||
msgstr "Не знайдений файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisfilenotfound2
|
||
msgid "File %s%s%s not found.%s"
|
||
msgstr "Не знайдений файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
|
||
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
||
msgstr "Не знайдений файл %s%s%s.%sСтворити його?%s"
|
||
|
||
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Файл %s%s%s%sне схожий на текстовий.%sВсе одно відкрити?"
|
||
|
||
#: lazarusidestrconsts:lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr "Властивості файлу"
|
||
|
||
#: lazarusidestrconsts:lisfilesettings
|
||
msgid "File Settings ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pfiletype
|
||
msgid "File Type"
|
||
msgstr "Тип файлу"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr "Файл вже існує"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
|
||
msgid "File already in package"
|
||
msgstr "Файл вже є в пакунку"
|
||
|
||
#: lazarusidestrconsts:dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr "Файлові розширення"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr "Файл вже є в пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr "Файл в проекті"
|
||
|
||
#: lazarusidestrconsts:lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr "У файл не можна писати"
|
||
|
||
#: lazarusidestrconsts:uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr "Файл тільки для читання"
|
||
|
||
#: lazarusidestrconsts:lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr "Файл вже використовується"
|
||
|
||
#: lazarusidestrconsts:lisfilelinkerror
|
||
msgid "File link error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilefilemaskbak
|
||
msgid "File mask (*;*.*;*.bak?)"
|
||
msgstr "Маска файлу (*;*.*;*.bak?)"
|
||
|
||
#: lazarusidestrconsts:srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr "Команди файлового меню"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilename
|
||
msgid "File name:"
|
||
msgstr "Назва файлу:"
|
||
|
||
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr "Файл не є виконуваним"
|
||
|
||
#: lazarusidestrconsts:lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr "Файл не знайдений"
|
||
|
||
#: lazarusidestrconsts:lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr "Файл не в нижньому регістрі"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr "Файл не збережений"
|
||
|
||
#: lazarusidestrconsts:lisfilenottext
|
||
msgid "File not text"
|
||
msgstr "Не текстовий файл"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr "Файл не є модулем"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr "Назва файлу"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr "Назва файлу відрізняється від назви пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr "Назву файлу використано іншим пакунком"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr "Назву файлу використано проектом"
|
||
|
||
#: lazarusidestrconsts:lisfilenameaddress
|
||
msgid "Filename/Address"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispefilename
|
||
msgid "Filename:"
|
||
msgstr "Назва файлу"
|
||
|
||
#: lazarusidestrconsts:lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr "Назва файлу: %s"
|
||
|
||
#: lazarusidestrconsts:dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "Файли"
|
||
|
||
#: lazarusidestrconsts:lisfilter
|
||
msgid "Filter"
|
||
msgstr "Фільтр"
|
||
|
||
#: lazarusidestrconsts:lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr "Фільтр за збіжністю будь-якої частини метода"
|
||
|
||
#: lazarusidestrconsts:lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr "Фільтр за збіжністю початку метода"
|
||
|
||
#: lazarusidestrconsts:srvk_final
|
||
msgid "Final"
|
||
msgstr "Остаточний"
|
||
|
||
#: lazarusidestrconsts:lismenufind
|
||
msgid "Find"
|
||
msgstr "Знайти"
|
||
|
||
#: lazarusidestrconsts:lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "Шукати &далі"
|
||
|
||
#: lazarusidestrconsts:lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "Знайти &попередній"
|
||
|
||
#: lazarusidestrconsts:lismenufindinfiles
|
||
msgid "Find &in files ..."
|
||
msgstr "&Пошук у файлах ..."
|
||
|
||
#: lazarusidestrconsts:lismenufinddeclarationatcursor
|
||
msgid "Find Declaration at cursor"
|
||
msgstr "Знайти опис під курсором"
|
||
|
||
#: lazarusidestrconsts:uemfindidentifierreferences
|
||
msgid "Find Identifier References"
|
||
msgstr "Знайти посилання на ідентифікатор"
|
||
|
||
#: lazarusidestrconsts:lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr "Знайти посилання на ідентифікатор ..."
|
||
|
||
#: lazarusidestrconsts:lismenutemplatefindnext
|
||
msgid "Find Next"
|
||
msgstr "Шукати далі"
|
||
|
||
#: lazarusidestrconsts:lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr "Знайти посилання"
|
||
|
||
#: lazarusidestrconsts:srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr "Знайти інший кінець блоку"
|
||
|
||
#: lazarusidestrconsts:srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr "Знайти початок блоку"
|
||
|
||
#: lazarusidestrconsts:lismenufindcodeblockstart
|
||
msgid "Find code block start"
|
||
msgstr "Знайти початок блоку коду"
|
||
|
||
#: lazarusidestrconsts:liscomppalfindcomponent
|
||
msgid "Find component"
|
||
msgstr "Знайти компонент"
|
||
|
||
#: lazarusidestrconsts:srkmecfinddeclaration
|
||
msgid "Find declaration"
|
||
msgstr "Знайти опис"
|
||
|
||
#: lazarusidestrconsts:srkmecfindidentifierrefs
|
||
msgid "Find identifier references"
|
||
msgstr "Знайти посилання на ідентифікатор"
|
||
|
||
#: lazarusidestrconsts:srkmecfindinfiles
|
||
msgid "Find in files"
|
||
msgstr "Знайти в файлах"
|
||
|
||
#: lazarusidestrconsts:liskmfindincremental
|
||
msgid "Find incremental"
|
||
msgstr "Знайти за зростанням"
|
||
|
||
#: lazarusidestrconsts:srkmecfindnext
|
||
msgid "Find next"
|
||
msgstr "Знайти наступне"
|
||
|
||
#: lazarusidestrconsts:srkmecfindnextwordoccurrence
|
||
msgid "Find next word occurrence"
|
||
msgstr "Знайти наступне слово"
|
||
|
||
#: lazarusidestrconsts:lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr "Знайти або змінити назву ID"
|
||
|
||
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
|
||
msgid "Find other end of code block"
|
||
msgstr "Знайти інший кінець блоку коду"
|
||
|
||
#: lazarusidestrconsts:lisfpfindpalettecomponent
|
||
msgid "Find palette component"
|
||
msgstr "Знайти компонент палітри"
|
||
|
||
#: lazarusidestrconsts:srkmecfindprevious
|
||
msgid "Find previous"
|
||
msgstr "Знайти попередній"
|
||
|
||
#: lazarusidestrconsts:srkmecfindprevwordoccurrence
|
||
msgid "Find previous word occurrence"
|
||
msgstr "Знайти попереднє слово"
|
||
|
||
#: lazarusidestrconsts:srkmecfindproceduredefinition
|
||
msgid "Find procedure definiton"
|
||
msgstr "Знайти опис процедури"
|
||
|
||
#: lazarusidestrconsts:srkmecfindproceduremethod
|
||
msgid "Find procedure method"
|
||
msgstr "Знайти метод процедури"
|
||
|
||
#: lazarusidestrconsts:srkmecfind
|
||
msgid "Find text"
|
||
msgstr "Пошук тексту"
|
||
|
||
#: lazarusidestrconsts:dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr "Знайти текст над курсором"
|
||
|
||
#: lazarusidestrconsts:rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr "Фінська"
|
||
|
||
#: lazarusidestrconsts:lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr "Виправити файл LFM"
|
||
|
||
#: lazarusidestrconsts:lisfloatingpoin
|
||
msgid "Floating Point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecjumptoeditor
|
||
msgid "Focus to source editor"
|
||
msgstr "Фокус в редакторі коду"
|
||
|
||
#: lazarusidestrconsts:liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr "Слідувати за курсором"
|
||
|
||
#: lazarusidestrconsts:lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr "Шрифт без UTF-8"
|
||
|
||
#: lazarusidestrconsts:lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr "Розпочати зміну назв"
|
||
|
||
#: lazarusidestrconsts:dlgforecolor
|
||
msgid "Foreground color"
|
||
msgstr "Колір переднього плану"
|
||
|
||
#: lazarusidestrconsts:dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "Редактор форм"
|
||
|
||
#: lazarusidestrconsts:rsformdatafiledfm
|
||
msgid "Form data file (*.dfm)|*.dfm"
|
||
msgstr "Файл форми (*.dfm)|*.dfm"
|
||
|
||
#: lazarusidestrconsts:lisformloaderror
|
||
msgid "Form load error"
|
||
msgstr "Помилка завантаження форми"
|
||
|
||
#: lazarusidestrconsts:lisformaterror
|
||
msgid "Format error"
|
||
msgstr "Помилка формату"
|
||
|
||
#: lazarusidestrconsts:dlgpofroms
|
||
msgid "Forms"
|
||
msgstr "Форми"
|
||
|
||
#: lazarusidestrconsts:lismenuviewforms
|
||
msgid "Forms..."
|
||
msgstr "Форми..."
|
||
|
||
#: lazarusidestrconsts:lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisvsrforwardsearch
|
||
msgid "Forward Search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmorderforwardone
|
||
msgid "Forward one"
|
||
msgstr "Вперед на одну"
|
||
|
||
#: lazarusidestrconsts:lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascalcompilernotfound
|
||
msgid "Free Pascal Compiler not found"
|
||
msgstr "Компілятор FreePascal не знайдений"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
|
||
msgid "Free Pascal Sources not found"
|
||
msgstr "Не знайдено коди FreePascal"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcefile
|
||
msgid "FreePascal source file"
|
||
msgstr "Файл коду Free Pascal"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcedirectory
|
||
msgid "Freepascal source directory"
|
||
msgstr "Тека кодів FreePascal"
|
||
|
||
#: lazarusidestrconsts:rslanguagefrench
|
||
msgid "French"
|
||
msgstr "Французька"
|
||
|
||
#: lazarusidestrconsts:lisfunction
|
||
msgid "Function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr "Функція: додати розподілювач шляхів"
|
||
|
||
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
|
||
msgid "Function: chomp path delimiter"
|
||
msgstr "Функція: прибрати розподілювач шляхів"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr "Функція: витягнути розширення файлу"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr "Функція: витягнути тільки назву файлу"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr "Функція: витягнути назву файлу з розширенням"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr "Функція: витягнути шлях до файлу"
|
||
|
||
#: lazarusidestrconsts:dlggpccomp
|
||
msgid "GPC (GNU Pascal Compiler) Compatible"
|
||
msgstr "Сумісність з GPC (GNU Pascal Compiler)"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertgplnotice
|
||
msgid "GPL notice"
|
||
msgstr "Примітки GPL"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertgeneral
|
||
msgid "General"
|
||
msgstr "Загальне"
|
||
|
||
#: lazarusidestrconsts:lispckeditgeneraloptions
|
||
msgid "General Options"
|
||
msgstr "Загальні параметри"
|
||
|
||
#: lazarusidestrconsts:srkmecenvironmentoptions
|
||
msgid "General environment options"
|
||
msgstr "Загальні налаштування оточення"
|
||
|
||
#: lazarusidestrconsts:dlgcodbx
|
||
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
||
msgstr "Створити інформацію для DBX (уповільнює зборку)"
|
||
|
||
#: lazarusidestrconsts:dlgcogdb
|
||
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
||
msgstr "Створити інформацію для GDB (уповільнює зборку)"
|
||
|
||
#: lazarusidestrconsts:dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr "Створити код для gprof"
|
||
|
||
#: lazarusidestrconsts:dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr "Створити код для valgrind"
|
||
|
||
#: lazarusidestrconsts:dlgcogenerate
|
||
msgid "Generate:"
|
||
msgstr "Створити:"
|
||
|
||
#: lazarusidestrconsts:rslanguagegerman
|
||
msgid "German"
|
||
msgstr "Німецька"
|
||
|
||
#: lazarusidestrconsts:dlggetposition
|
||
msgid "Get position"
|
||
msgstr "Задіяти позицію"
|
||
|
||
#: lazarusidestrconsts:lispldglobal
|
||
msgid "Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
|
||
msgid "Global Source Path addition"
|
||
msgstr "Додавання загального шляху до текстів програм"
|
||
|
||
#: lazarusidestrconsts:srkmecgotomarker
|
||
msgid "Go to Marker %d"
|
||
msgstr "Перейти до маркера %d"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr "Перейти до редактора %d"
|
||
|
||
#: lazarusidestrconsts:srkmecgotolinenumber
|
||
msgid "Go to line number"
|
||
msgstr "Перейти до рядка номер"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker0
|
||
msgid "Go to marker 0"
|
||
msgstr "Перейти до маркера 0"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker1
|
||
msgid "Go to marker 1"
|
||
msgstr "Перейти до маркера 1"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker2
|
||
msgid "Go to marker 2"
|
||
msgstr "Перейти до маркера 2"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker3
|
||
msgid "Go to marker 3"
|
||
msgstr "Перейти до маркера 3"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker4
|
||
msgid "Go to marker 4"
|
||
msgstr "Перейти до маркера 4"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker5
|
||
msgid "Go to marker 5"
|
||
msgstr "Перейти до маркера 5"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker6
|
||
msgid "Go to marker 6"
|
||
msgstr "Перейти до маркера 6"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker7
|
||
msgid "Go to marker 7"
|
||
msgstr "Перейти до маркера 7"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker8
|
||
msgid "Go to marker 8"
|
||
msgstr "Перейти до маркера 8"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker9
|
||
msgid "Go to marker 9"
|
||
msgstr "Перейти до маркера 9"
|
||
|
||
#: lazarusidestrconsts:srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr "Перейти до відпов. дужки"
|
||
|
||
#: lazarusidestrconsts:srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr "Перейти до наступного редактора"
|
||
|
||
#: lazarusidestrconsts:srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr "Перейти до попереднього редактора"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr "Перейти до редактора коду 1"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr "Перейти до редактора коду 10"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr "Перейти до редактора коду 2"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr "Перейти до редактора коду 3"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr "Перейти до редактора коду 4"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr "Перейти до редактора коду 5"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr "Перейти до редактора коду 6"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr "Перейти до редактора коду 7"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr "Перейти до редактора коду 8"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr "Перейти до редактора коду 9"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoincludedirective
|
||
msgid "Go to to include directive of current include file"
|
||
msgstr "Перейти за директивою include поточного включеного файлу"
|
||
|
||
#: lazarusidestrconsts:listodogoto
|
||
msgid "Goto"
|
||
msgstr "Перейти"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr "Перейти за координатою XY"
|
||
|
||
#: lazarusidestrconsts:lismenugotoincludedirective
|
||
msgid "Goto include directive"
|
||
msgstr "Перейти за директивою $I"
|
||
|
||
#: lazarusidestrconsts:lismenugotoline
|
||
msgid "Goto line ..."
|
||
msgstr "Перейти до рядка ..."
|
||
|
||
#: lazarusidestrconsts:lisuegotoline
|
||
msgid "Goto line :"
|
||
msgstr "Перейти до рядка:"
|
||
|
||
#: lazarusidestrconsts:uemnextbookmark
|
||
msgid "Goto next Bookmark"
|
||
msgstr "Перейти до наступної закладки"
|
||
|
||
#: lazarusidestrconsts:uemprevbookmark
|
||
msgid "Goto previous Bookmark"
|
||
msgstr "Перейти до попер. закладки"
|
||
|
||
#: lazarusidestrconsts:listodolistgotoline
|
||
msgid "Goto selected source line"
|
||
msgstr "Перейти до виділеного рядка коду"
|
||
|
||
#: lazarusidestrconsts:srkmgrabkey
|
||
msgid "Grab key"
|
||
msgstr "Захопити клавішу"
|
||
|
||
#: lazarusidestrconsts:srkmgrabsecondkey
|
||
msgid "Grab second key"
|
||
msgstr "Захопити наступну клавішу"
|
||
|
||
#: lazarusidestrconsts:dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr "Колір виділення"
|
||
|
||
#: lazarusidestrconsts:dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "Сітка"
|
||
|
||
#: lazarusidestrconsts:dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr "Колір сітки"
|
||
|
||
#: lazarusidestrconsts:dlggridx
|
||
msgid "Grid size X"
|
||
msgstr "Розмір X сітки"
|
||
|
||
#: lazarusidestrconsts:dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr "Розмір Y сітки"
|
||
|
||
#: lazarusidestrconsts:lisgroup
|
||
msgid "Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr "Ґруповий відкат"
|
||
|
||
#: lazarusidestrconsts:lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecguessmisplacedifdef
|
||
msgid "Guess misplaced $IFDEF"
|
||
msgstr "Передбачити відсутність $IFDEF"
|
||
|
||
#: lazarusidestrconsts:lismenuguessmisplacedifdef
|
||
msgid "Guess misplaced IFDEF/ENDIF"
|
||
msgstr "Виправити невідповідність IFDEF/ENDIF"
|
||
|
||
#: lazarusidestrconsts:lismenuguessunclosedblock
|
||
msgid "Guess unclosed block"
|
||
msgstr "Виправити незакінчений блок"
|
||
|
||
#: lazarusidestrconsts:dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr "Лінійки допомоги"
|
||
|
||
#: lazarusidestrconsts:dlgguttercolor
|
||
msgid "Gutter color"
|
||
msgstr "Колір поля "
|
||
|
||
#: lazarusidestrconsts:dlggutterwidth
|
||
msgid "Gutter width"
|
||
msgstr "Ширина поля"
|
||
|
||
#: lazarusidestrconsts:lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr "Прокрутка на півсторінки"
|
||
|
||
#: lazarusidestrconsts:lismenueditorhandleonclickevent
|
||
msgid "Handle OnClick Event"
|
||
msgstr "Обробити подію OnClick"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr "Належить "
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr "Належить Налагоджувачу"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr "Належить Програмі"
|
||
|
||
#: lazarusidestrconsts:srvk_hanja
|
||
msgid "Hanja"
|
||
msgstr "Корейська"
|
||
|
||
#: lazarusidestrconsts:lisaf2phasregisterprocedure
|
||
msgid "Has Register procedure"
|
||
msgstr "Має процедуру Register"
|
||
|
||
#: lazarusidestrconsts:lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr "Коментар заголовка для класу"
|
||
|
||
#: lazarusidestrconsts:dlgheapsize
|
||
msgid "Heap Size"
|
||
msgstr "Розмір купи"
|
||
|
||
#: lazarusidestrconsts:rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "Єврейська"
|
||
|
||
#: lazarusidestrconsts:dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "Висота:"
|
||
|
||
#: lazarusidestrconsts:srvk_help
|
||
msgid "Help"
|
||
msgstr "Довідка"
|
||
|
||
#: lazarusidestrconsts:lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "Параметри довідки"
|
||
|
||
#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
|
||
msgid "Help for FreePascal Compiler message"
|
||
msgstr "Довідка до повідомлень Компілятора FreePascal"
|
||
|
||
#: lazarusidestrconsts:srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr "Команди меню Довідка"
|
||
|
||
#: lazarusidestrconsts:lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "Селектор довідки"
|
||
|
||
#: lazarusidestrconsts:lishexadecimal
|
||
msgid "Hexadecimal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr "Приховати вікна IDE при пуску"
|
||
|
||
#: lazarusidestrconsts:uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
||
msgstr "Довідка: функція Створити Рядок Ресурсів вимагає рядкової константи.%sВиберіть тільки рядковий вираз і спробуйте спочатку."
|
||
|
||
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr "Довідка: функція Створити Рядок Ресурсів вимагає рядкової константи.%sВиберіть вираз і спробуйте спочатку."
|
||
|
||
#: lazarusidestrconsts:dlgedhintcommand
|
||
msgid "Hint: click on the command you want to edit"
|
||
msgstr "Довідка: клацніть за команді, яку треба редагувати"
|
||
|
||
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
|
||
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
||
msgstr "Довідка: Ви можете задати шлях до компілятора в Оточенні->Параметри оточення->Файли->Шлях до компілятора"
|
||
|
||
#: lazarusidestrconsts:dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr "Довідки до палітри компонентів"
|
||
|
||
#: lazarusidestrconsts:dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr "Довідки до командних кнопок (відкрити, зберегти і т.д.)"
|
||
|
||
#: lazarusidestrconsts:srvk_home
|
||
msgid "Home"
|
||
msgstr "Home"
|
||
|
||
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr "Home - до найближчого старту"
|
||
|
||
#: lazarusidestrconsts:lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr "Горизонтальний"
|
||
|
||
#: lazarusidestrconsts:dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr "Крок сітки по горизонталі"
|
||
|
||
#: lazarusidestrconsts:dlghostapplication
|
||
msgid "Host application"
|
||
msgstr "Основна програма"
|
||
|
||
#: lazarusidestrconsts:uenotimplcapagain
|
||
msgid "I told You: Not implemented yet"
|
||
msgstr "Таки я Вам кажу, що це ще не реалізовано"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmid
|
||
msgid "ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liside
|
||
msgid "IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr "Інтегрування в IDE"
|
||
|
||
#: lazarusidestrconsts:lisideintf
|
||
msgid "IDE Interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr "Параметри IDE:"
|
||
|
||
#: lazarusidestrconsts:lismenuideinternals
|
||
msgid "IDE internals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uepins
|
||
msgid "INS"
|
||
msgstr "ВСТ"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsidentifier
|
||
msgid "Identifier"
|
||
msgstr "Ідентифікатор"
|
||
|
||
#: lazarusidestrconsts:lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr "Ідентифікатор починається з ..."
|
||
|
||
#: lazarusidestrconsts:dlgedidcomlet
|
||
msgid "Identifier completion"
|
||
msgstr "Завершення ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts:lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr "Ідентифікатор вміщує ..."
|
||
|
||
#: lazarusidestrconsts:lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr "Довжина ідентифікатора:"
|
||
|
||
#: lazarusidestrconsts:dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr "Політика ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts:lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr "Префікс ідентифікатора:"
|
||
|
||
#: lazarusidestrconsts:lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr "Ідентифікатор: %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr "If"
|
||
|
||
#: lazarusidestrconsts:uenotimpltext
|
||
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
||
msgstr "Якщо Ви можете допомогти нам реалізувати цю функцію, напишіть lazarus@miraclec.com"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsifdef
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr "IfNDef"
|
||
|
||
#: lazarusidestrconsts:dlgignoreverb
|
||
msgid "Ignore"
|
||
msgstr "Ігнорувати"
|
||
|
||
#: lazarusidestrconsts:lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr "Ігнорувати пробіли"
|
||
|
||
#: lazarusidestrconsts:lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr "Ігнорувати кількість пробілів"
|
||
|
||
#: lazarusidestrconsts:lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
|
||
msgid "Ignore and save package now"
|
||
msgstr "Ігнорувати і зберегти зараз пакунок"
|
||
|
||
#: lazarusidestrconsts:lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr "Ігнорувати двійкові"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr "Ігнор. різні заверш. рядків (напр., #10 = #13#10)"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
|
||
msgid "Ignore disk changes"
|
||
msgstr "Ігнорувати зміни на диску"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr "Ігнорувати дод./видал. порожніх рядків"
|
||
|
||
#: lazarusidestrconsts:lisignoremissingfile
|
||
msgid "Ignore missing file"
|
||
msgstr "Ігнорувати пропущений файл"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr "Ігнор. пробіли (без CR)"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr "Ігнорувати пробіли в кінці рядка"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr "Ігнорувати пробіли на початку рядка"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr "Ігнорувати ці вирази"
|
||
|
||
#: lazarusidestrconsts:lisignoreusetformasancestor
|
||
msgid "Ignore, use TForm as ancestor"
|
||
msgstr "Ігнорувати, використовувати TForm як предка"
|
||
|
||
#: lazarusidestrconsts:srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisimportlist
|
||
msgid "Import list"
|
||
msgstr "Список імпорту"
|
||
|
||
#: lazarusidestrconsts:dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr "Перед методами"
|
||
|
||
#: lazarusidestrconsts:lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts:dlgassertcode
|
||
msgid "Include Assertion Code"
|
||
msgstr "Включити код Assert"
|
||
|
||
#: lazarusidestrconsts:dlgcoincfiles
|
||
msgid "Include Files (-Fi):"
|
||
msgstr "Додані файли (-Fi):"
|
||
|
||
#: lazarusidestrconsts:lisincludefilter
|
||
msgid "Include Filter"
|
||
msgstr "Фільтр для вибору"
|
||
|
||
#: lazarusidestrconsts:rsincludeversioninfoinexecutable
|
||
msgid "Include Version Info in executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr "Включити файл"
|
||
|
||
#: lazarusidestrconsts:lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr "Шляхи до під'єднуваних файлів"
|
||
|
||
#: lazarusidestrconsts:lisfindfileincludesubdirectories
|
||
msgid "Include sub directories"
|
||
msgstr "Включити підтеки"
|
||
|
||
#: lazarusidestrconsts:dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr "Включити системні змінні"
|
||
|
||
#: lazarusidestrconsts:lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr "Доданий:"
|
||
|
||
#: lazarusidestrconsts:lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr "Пошук за зростанням"
|
||
|
||
#: lazarusidestrconsts:srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr "Зсунути блок вправо"
|
||
|
||
#: lazarusidestrconsts:dlgindentcodeto
|
||
msgid "Indent code to"
|
||
msgstr "Зсунути вправо код за"
|
||
|
||
#: lazarusidestrconsts:lismenuindentselection
|
||
msgid "Indent selection"
|
||
msgstr "Зсунути вправо виділене"
|
||
|
||
#: lazarusidestrconsts:lisindex
|
||
msgid "Index"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr "Індонезійська"
|
||
|
||
#: lazarusidestrconsts:lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr "Інформація про %s"
|
||
|
||
#: lazarusidestrconsts:liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoinherited
|
||
msgid "Inherited"
|
||
msgstr "Наслідуваний"
|
||
|
||
#: lazarusidestrconsts:srvk_insert
|
||
msgid "Insert"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts:liskminsertifdef
|
||
msgid "Insert $IFDEF"
|
||
msgstr "Вставити $IFDEF"
|
||
|
||
#: lazarusidestrconsts:lismenuconditionalselection
|
||
msgid "Insert $IFDEF..."
|
||
msgstr "Вставити $IFDEF..."
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr "Вставити ключове слово CVS Author"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr "Вставити ключове слово CVS Date"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr "Вставити ключове слово CVS Header"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr "Вставити ключове слово CVS ID"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr "Вставити ключове слово CVS Log"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr "Вставити ключове слово CVS Name"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr "Вставити ключове слово CVS Revision"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr "Вставити ключове слово CVS Source"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr "Вставити елемент ChangeLog"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr "Вставити шаблон компілятора FreePascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr "Вставити шаблон проекту FreePascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr "Вставте шаблон Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
|
||
msgid "Insert From Template..."
|
||
msgstr "Вставити шаблон форми..."
|
||
|
||
#: lazarusidestrconsts:srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr "Вставити примітку про GPL"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Kylix 3"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr "Вставити шаблон з теки Kylix 3"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr "Вставити шаблон проекту Kylix 3"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr "Вставити примітку про LGPL"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
|
||
msgid "Insert Lazarus Directory Template"
|
||
msgstr "Вставити шаблон з теки Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisctinsertmacro
|
||
msgid "Insert Macro"
|
||
msgstr "Вставити макрос"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr "Режим вставки"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
|
||
msgid "Insert New Item (after)"
|
||
msgstr "Вставити новий пункт (після)"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
|
||
msgid "Insert New Item (before)"
|
||
msgstr "Вставити новий пункт (перед)"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr "Вставити шаблон"
|
||
|
||
#: lazarusidestrconsts:listddinserttodo
|
||
msgid "Insert ToDo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:ueminserttodo
|
||
msgid "Insert Todo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr "Вставити за алфавітом"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr "Вставити тег жирного тексту"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr "Вставити тег форматування тексту програми"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr "Вставити з врахуванням контексту"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr "Вставити поточні дату і час"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr "Вставити поточне ім'я користувача"
|
||
|
||
#: lazarusidestrconsts:liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr "Вставити дату і час"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertcharacter
|
||
msgid "Insert from Character Map"
|
||
msgstr "Вставити з таблиці символів"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr "Вставити з таблиці символів"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr "Вставити тег форматування курсивом"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr "Вставити змінений LGPL допис"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr "Вставити елемент як дочірній"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr "Вставити елемент нижче"
|
||
|
||
#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr "Вставити тег ремарок"
|
||
|
||
#: lazarusidestrconsts:dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr "Вставляти пробіл після"
|
||
|
||
#: lazarusidestrconsts:dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr "Вставляти пробіл перед"
|
||
|
||
#: lazarusidestrconsts:lismenuinserttext
|
||
msgid "Insert text"
|
||
msgstr "Вставити текст"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr "Вставити тег форматування підкресленням"
|
||
|
||
#: lazarusidestrconsts:liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr "Вставити назву користувача"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr "Вставити тег форматування для змінних"
|
||
|
||
#: lazarusidestrconsts:liskminspect
|
||
msgid "Inspect"
|
||
msgstr "Перевірити"
|
||
|
||
#: lazarusidestrconsts:lismenuinspect
|
||
msgid "Inspect ..."
|
||
msgstr "Слідкувати за ..."
|
||
|
||
#: lazarusidestrconsts:lispckeditinstall
|
||
msgid "Install"
|
||
msgstr "Встановити"
|
||
|
||
#: lazarusidestrconsts:lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr "Встановити при наст. запуску"
|
||
|
||
#: lazarusidestrconsts:lispckeditinstallpackageintheide
|
||
msgid "Install package in the IDE"
|
||
msgstr "Встановити пакунки IDE"
|
||
|
||
#: lazarusidestrconsts:lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "Встановити вибране"
|
||
|
||
#: lazarusidestrconsts:lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr "Встановлення не вдалося"
|
||
|
||
#: lazarusidestrconsts:lispckexplinstalled
|
||
msgid "Installed"
|
||
msgstr "Встановлено"
|
||
|
||
#: lazarusidestrconsts:lisinstalledpackages
|
||
msgid "Installed Packages"
|
||
msgstr "Встановлені пакунки"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr "При встановленні пакунку %s буде автоматично встановлено пакунок:"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr "При встановленні пакунку %s будуть автоматично встановлені пакунки:"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrminterface
|
||
msgid "Interface"
|
||
msgstr "Інтерфейс"
|
||
|
||
#: lazarusidestrconsts:listcompilerinternalerror
|
||
msgid "Internal compiler error! (%d)"
|
||
msgstr "Внутрішня помилка компілятора! (%d)"
|
||
|
||
#: lazarusidestrconsts:dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr "Інтервал в сек"
|
||
|
||
#: lazarusidestrconsts:lisinvalidoff
|
||
msgid "Invalid (Off)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidon
|
||
msgid "Invalid (On)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr "Неправильний тип предка"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidcircle
|
||
msgid "Invalid Circle"
|
||
msgstr "Неправильний цикл"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr "Неправильна назва класу"
|
||
|
||
#: lazarusidestrconsts:lisinvalidcompilerfilename
|
||
msgid "Invalid Compiler Filename"
|
||
msgstr "Неправильна назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
|
||
msgid "Invalid Exclude filter"
|
||
msgstr "Неправильний фільтр виключень"
|
||
|
||
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
|
||
msgid "Invalid Free Pascal source directory"
|
||
msgstr "Неправильна тека кодів FPC"
|
||
|
||
#: lazarusidestrconsts:lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr "Некоректний ідентифікатор"
|
||
|
||
#: lazarusidestrconsts:lispublprojinvalidincludefilter
|
||
msgid "Invalid Include filter"
|
||
msgstr "Неправильний фільтр включень"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr "Неправильна версія (Min-Max)"
|
||
|
||
#: lazarusidestrconsts:lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr "Неправильний пакунок"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr "Неправильна назва пакунку"
|
||
|
||
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr "Некоректний ідентифікатор паскаля"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr "Неправильна секція Resourcestring"
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr "Неправильна назва модуля"
|
||
|
||
#: lazarusidestrconsts:lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr "Неправильна назва модуля: %s"
|
||
|
||
#: lazarusidestrconsts:lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr "Неправильна команда"
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
|
||
msgid "Invalid compiler filename"
|
||
msgstr "Некоректна назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr "Неправильний клас компонента"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr "Некоректна назва файлу налагоджувача"
|
||
|
||
#: lazarusidestrconsts:lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr "Неприпустиме видалення"
|
||
|
||
#: lazarusidestrconsts:lisinvaliddestinationdirectory
|
||
msgid "Invalid destination directory"
|
||
msgstr "Неправильна тека призначення"
|
||
|
||
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr "Неправильний вираз.%sДовідка: функція \"Створити Рядок Ресурсів\" вимагає рядкової константи в одному файлі. Виділіть вираз і спробуйте ще."
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr "Неправильний файл"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr "Неправильне розширення файлу"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Неправильна назва файлу"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
|
||
msgid "Invalid make filename"
|
||
msgstr "Неправильна назва файлу make"
|
||
|
||
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr "Неправильна максимальна версія"
|
||
|
||
#: lazarusidestrconsts:lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr "Неправильна мінімальна версія"
|
||
|
||
#: lazarusidestrconsts:lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr "Неправильний множинний вибір"
|
||
|
||
#: lazarusidestrconsts:liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr "Направильна опція в позиції %d: \"%s\""
|
||
|
||
#: lazarusidestrconsts:lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: %s%s%s"
|
||
msgstr "Неправильний ідентифікатор пакунку: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr "Неправильне розширення файлу пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr "Неправильна назва файлу пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr "Неправильна назва пакунку"
|
||
|
||
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr "Неправильний тип пакунку"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidpackagename
|
||
msgid "Invalid packagename"
|
||
msgstr "Неправильна назва пакунку"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr "Неправильний предок"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr "Неправильний елемент предка"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
|
||
msgid "Invalid pascal unit name"
|
||
msgstr "Неправильна назва модуля паскаля"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr "Неправильний попередній елемент"
|
||
|
||
#: lazarusidestrconsts:lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr "Неправильна назва проц."
|
||
|
||
#: lazarusidestrconsts:lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr "Неправильна назва файлу проекту"
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr "Неправильне виділення"
|
||
|
||
#: lazarusidestrconsts:lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr "Неправильна назва файла модуля"
|
||
|
||
#: lazarusidestrconsts:lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr "Неправильна назва модуля"
|
||
|
||
#: lazarusidestrconsts:lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr "Неправильна назва змінної"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr "Неправильна версія"
|
||
|
||
#: lazarusidestrconsts:ueminvertassignment
|
||
msgid "Invert Assignment"
|
||
msgstr "Інвертувати присвоєння"
|
||
|
||
#: lazarusidestrconsts:srkmecinvertassignment
|
||
msgid "Invert assignment"
|
||
msgstr "Інвертувати присвоєння"
|
||
|
||
#: lazarusidestrconsts:srvk_irregular
|
||
msgid "Irregular "
|
||
msgstr "Нерегулярний "
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "Італійська"
|
||
|
||
#: lazarusidestrconsts:dlgedital
|
||
msgid "Italic"
|
||
msgstr "Курсив"
|
||
|
||
#: lazarusidestrconsts:dlgoiitemheight
|
||
msgid "Item height"
|
||
msgstr "Висота елемента"
|
||
|
||
#: lazarusidestrconsts:lisjitform
|
||
msgid "JIT Form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr "Японська"
|
||
|
||
#: lazarusidestrconsts:lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr "Перейти до Обраного"
|
||
|
||
#: lazarusidestrconsts:lismenujumpback
|
||
msgid "Jump back"
|
||
msgstr "Перейти назад"
|
||
|
||
#: lazarusidestrconsts:lismenujumpforward
|
||
msgid "Jump forward"
|
||
msgstr "Перейти вперед"
|
||
|
||
#: lazarusidestrconsts:lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr "Перейти до"
|
||
|
||
#: lazarusidestrconsts:lismenujumptonextbookmark
|
||
msgid "Jump to next bookmark"
|
||
msgstr "Перейти до наст. закладки"
|
||
|
||
#: lazarusidestrconsts:lismenujumptonexterror
|
||
msgid "Jump to next error"
|
||
msgstr "Перехід до наст. помилки"
|
||
|
||
#: lazarusidestrconsts:lismenujumptoprevbookmark
|
||
msgid "Jump to previous bookmark"
|
||
msgstr "Перейти до попер. закладки"
|
||
|
||
#: lazarusidestrconsts:lismenujumptopreverror
|
||
msgid "Jump to previous error"
|
||
msgstr "Перейти до попер. помилки"
|
||
|
||
#: lazarusidestrconsts:dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr "Перехід (напр. Метод Переходу)"
|
||
|
||
#: lazarusidestrconsts:srvk_junja
|
||
msgid "Junja"
|
||
msgstr "Кенійська"
|
||
|
||
#: lazarusidestrconsts:srvk_kana
|
||
msgid "Kana"
|
||
msgstr "Японська"
|
||
|
||
#: lazarusidestrconsts:liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr "Залишати всі текстові файли"
|
||
|
||
#: lazarusidestrconsts:dlgkeepcaretx
|
||
msgid "Keep caret X position"
|
||
msgstr "Залишати знак вставляння в поз. X"
|
||
|
||
#: lazarusidestrconsts:dlgcokeepvarsreg
|
||
msgid "Keep certain variables in registers"
|
||
msgstr "Залишати однакові змінні в регістрах"
|
||
|
||
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr "Залишати файли, що відпов. фільтру"
|
||
|
||
#: lazarusidestrconsts:liskeepname
|
||
msgid "Keep name"
|
||
msgstr "Залишати назву"
|
||
|
||
#: lazarusidestrconsts:dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr "Залишати порядок процедур"
|
||
|
||
#: lazarusidestrconsts:liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr "Залишити їх і продовжити"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolkey
|
||
msgid "Key"
|
||
msgstr "Ключ"
|
||
|
||
#: lazarusidestrconsts:srkmkey
|
||
msgid "Key (or 2 keys combination)"
|
||
msgstr "Ключ (або комбінація з 2 ключів)"
|
||
|
||
#: lazarusidestrconsts:dlgkeymappingscheme
|
||
msgid "Key Mapping Scheme"
|
||
msgstr "Схема розкладки клавіатури"
|
||
|
||
#: lazarusidestrconsts:dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr "Клавіші"
|
||
|
||
#: lazarusidestrconsts:dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr "Помилки комбінацій клавіш"
|
||
|
||
#: lazarusidestrconsts:liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr "Схема розкладки клавіатури"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr "Ключове слово"
|
||
|
||
#: lazarusidestrconsts:dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr "Політика ключових слів"
|
||
|
||
#: lazarusidestrconsts:lislcl
|
||
msgid "LCL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr "Параметри LCL, що залежать від інтерфейсу:"
|
||
|
||
#: lazarusidestrconsts:lislclwidgettype
|
||
msgid "LCL Widget Type"
|
||
msgstr "Тип LCL Widget"
|
||
|
||
#: lazarusidestrconsts:lislazbuildlclinterface
|
||
msgid "LCL interface"
|
||
msgstr "Інтерфейс LCL"
|
||
|
||
#: lazarusidestrconsts:lislclunitpathmissing
|
||
msgid "LCL unit path missing"
|
||
msgstr "Втрачено шлях до LCL-модуля"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr "Текст форми LFM - Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislfmfile
|
||
msgid "LFM file"
|
||
msgstr "LFM файл"
|
||
|
||
#: lazarusidestrconsts:lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr "Зламався файл LFM"
|
||
|
||
#: lazarusidestrconsts:lislfmfilenotfound
|
||
msgid "LFM file not found"
|
||
msgstr "Не знайдено LFM файлу"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertlgplnotice
|
||
msgid "LGPL notice"
|
||
msgstr "Зауваження LGPL"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr "Ресурс LRS - Lazarus"
|
||
|
||
#: lazarusidestrconsts:dlgenvlanguage
|
||
msgid "Language"
|
||
msgstr "Мова"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr "Мовні розширення"
|
||
|
||
#: lazarusidestrconsts:rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "Остання"
|
||
|
||
#: lazarusidestrconsts:dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr "Останній (напр. в кінці коду)"
|
||
|
||
#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr "Запуск програми"
|
||
|
||
#: lazarusidestrconsts:lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr "Виконувана програма є неправильною"
|
||
|
||
#: lazarusidestrconsts:lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr "Командний рядок виконуваної програми"
|
||
|
||
#: lazarusidestrconsts:lispkgmanglazarus
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusdesktopsettings
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr "Налаштування стільниці Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
|
||
msgid "Lazarus Directory"
|
||
msgstr "Тека Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusfile
|
||
msgid "Lazarus File"
|
||
msgstr "Файл Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr "Графічна оболонка Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazaruseditorv
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusprojectinfofile
|
||
msgid "Lazarus Project Info file"
|
||
msgstr "Файл Info проекту Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr "Тека конфігурації Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr "Тека Lazarus"
|
||
|
||
#: lazarusidestrconsts:dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr "Тека Lazarus (за замовчуванням для всіх проектів)"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
|
||
msgid "Lazarus directory \"%s\" not found."
|
||
msgstr "Не знайдена тека Lazarus \"%s\" "
|
||
|
||
#: lazarusidestrconsts:lislazarusdirectorynotfound
|
||
msgid "Lazarus directory not found"
|
||
msgstr "Не знайдена тека Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusform
|
||
msgid "Lazarus form"
|
||
msgstr "Форма Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusinclude
|
||
msgid "Lazarus include file"
|
||
msgstr "Lazarus-файли, що включаються"
|
||
|
||
#: lazarusidestrconsts:lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr "Мова графічної оболонки Lazarus (напр. en, uk, de, br, fi)"
|
||
|
||
#: lazarusidestrconsts:lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr "Назва мови для Lazarus (напр. english, deutsch, ukrainain)"
|
||
|
||
#: lazarusidestrconsts:lislazaruspackage
|
||
msgid "Lazarus package"
|
||
msgstr "Пакунок Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusproject
|
||
msgid "Lazarus project"
|
||
msgstr "Проект Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusprojectsource
|
||
msgid "Lazarus project source"
|
||
msgstr "Текст проекту Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusunit
|
||
msgid "Lazarus unit"
|
||
msgstr "Модуль Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisleaveemptyfo
|
||
msgid "Leave empty for default .po file"
|
||
msgstr "Залишаю порожнім для po-файлу за замовчуванням"
|
||
|
||
#: lazarusidestrconsts:srvk_left
|
||
msgid "Left"
|
||
msgstr "Ліворуч"
|
||
|
||
#: lazarusidestrconsts:lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftsides
|
||
msgid "Left sides"
|
||
msgstr "Ліві сторони"
|
||
|
||
#: lazarusidestrconsts:lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr "Лівий простір еквівалентно"
|
||
|
||
#: lazarusidestrconsts:dlgleftpos
|
||
msgid "Left:"
|
||
msgstr "Ліворуч:"
|
||
|
||
#: lazarusidestrconsts:dlglevelnoneopt
|
||
msgid "Level 0 (no extra Optimizations)"
|
||
msgstr "Рівень 0 (без екстра-оптимізації)"
|
||
|
||
#: lazarusidestrconsts:dlglevel1opt
|
||
msgid "Level 1 (quick and debugger friendly)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglevel2opt
|
||
msgid "Level 2 (Level 1 + quick optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglevel3opt
|
||
msgid "Level 3 (Level 2 + slow optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislevels
|
||
msgid "Levels"
|
||
msgstr "Рівні"
|
||
|
||
#: lazarusidestrconsts:dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr "Бібліотеки (-F1)"
|
||
|
||
#: lazarusidestrconsts:lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr "Бібліотека"
|
||
|
||
#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
|
||
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptslicense
|
||
msgid "License:"
|
||
msgstr "Ліцензія:"
|
||
|
||
#: lazarusidestrconsts:lisaboutlazarusmsg
|
||
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
|
||
msgid "Limit linecount to"
|
||
msgstr "Обмеження лічильнику рядків до"
|
||
|
||
#: lazarusidestrconsts:listodolline
|
||
msgid "Line"
|
||
msgstr "Рядок"
|
||
|
||
#: lazarusidestrconsts:dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr "Розчіплювання рядка"
|
||
|
||
#: lazarusidestrconsts:srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr "Метод вибору рядка"
|
||
|
||
#: lazarusidestrconsts:lislinelength
|
||
msgid "Line/Length"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortsellines
|
||
msgid "Lines"
|
||
msgstr "Рядки"
|
||
|
||
#: lazarusidestrconsts:lisuidlines
|
||
msgid "Lines:"
|
||
msgstr "Рядків"
|
||
|
||
#: lazarusidestrconsts:dlglinksmart
|
||
msgid "Link Smart"
|
||
msgstr "Розумне компонування"
|
||
|
||
#: lazarusidestrconsts:dlglinklibraries
|
||
msgid "Link Style:"
|
||
msgstr "Стиль компонування"
|
||
|
||
#: lazarusidestrconsts:lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr "Компонувальник"
|
||
|
||
#: lazarusidestrconsts:dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "Створення посилань"
|
||
|
||
#: lazarusidestrconsts:liscmplstlist
|
||
msgid "List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgloaddfile
|
||
msgid "Load desktop settings from file"
|
||
msgstr "Завантаження налаштувань робочого столу з файлу"
|
||
|
||
#: lazarusidestrconsts:lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr "Завантажити з файла"
|
||
|
||
#: lazarusidestrconsts:dlgcoloadsave
|
||
msgid "Load/Save"
|
||
msgstr "Завант./Зберегти"
|
||
|
||
#: lazarusidestrconsts:lispckexplloadedpackages
|
||
msgid "Loaded Packages:"
|
||
msgstr "Завантажені пакунки"
|
||
|
||
#: lazarusidestrconsts:lisloadingfailed
|
||
msgid "Loading %s failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
||
msgstr "Завантаження пакунку %s замінить пакунок%s%s з файлу %s.%sСтарий пакунок змінено.%s%sЗберегти старий пакунок%s?"
|
||
|
||
#: lazarusidestrconsts:dlgrunolocal
|
||
msgid "Local"
|
||
msgstr "Місцевий"
|
||
|
||
#: lazarusidestrconsts:lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr "Місцеві змінні"
|
||
|
||
#: lazarusidestrconsts:lislocals
|
||
msgid "Locals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislogo
|
||
msgid "Logo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenulowercaseselection
|
||
msgid "Lowercase selection"
|
||
msgstr "Вибір в нижньому регістрі"
|
||
|
||
#: lazarusidestrconsts:dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr "Нижній регістр, з великої букви"
|
||
|
||
#: lazarusidestrconsts:liskmmacosx
|
||
msgid "Mac OS X"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolmacros
|
||
msgid "Macros"
|
||
msgstr "Макроси"
|
||
|
||
#: lazarusidestrconsts:dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr "Головне меню"
|
||
|
||
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
|
||
msgid "Main Unit has Application.CreateForm statements"
|
||
msgstr "Головний модуль має програму. Створити оператори форми "
|
||
|
||
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
|
||
msgid "Main Unit has Application.Title statements"
|
||
msgstr "Головний модуль має програму. Заголовні оператори"
|
||
|
||
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
|
||
msgid "Main Unit has Uses Section containing all Units of project"
|
||
msgstr "Головний модуль має секцію Uses, що вміщує всі модулі проекту."
|
||
|
||
#: lazarusidestrconsts:lismainunitispascalsource
|
||
msgid "Main Unit is Pascal Source"
|
||
msgstr "Головний модуль є Pascal-текстом"
|
||
|
||
#: lazarusidestrconsts:lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr "Важливий"
|
||
|
||
#: lazarusidestrconsts:rsmajorrevision
|
||
msgid "Major revision:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr "Створити виконуваний"
|
||
|
||
#: lazarusidestrconsts:lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr "Створити рядок ресурсу ..."
|
||
|
||
#: lazarusidestrconsts:lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr "Створити рядок ресурсу"
|
||
|
||
#: lazarusidestrconsts:lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr "Make не знайдений"
|
||
|
||
#: lazarusidestrconsts:dlgmakepath
|
||
msgid "Make path"
|
||
msgstr "Шлях до Make"
|
||
|
||
#: lazarusidestrconsts:srkmecmakeresourcestring
|
||
msgid "Make resource string"
|
||
msgstr "Створити рядок ресурсу"
|
||
|
||
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr "Компіляція вручну (ніякої автоматизації)"
|
||
|
||
#: lazarusidestrconsts:dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr "Додатковий відступ зліва на сторінці для палітурки"
|
||
|
||
#: lazarusidestrconsts:dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr "Колір Maker"
|
||
|
||
#: lazarusidestrconsts:lissmatches
|
||
msgid "Matches"
|
||
msgstr "Збіги"
|
||
|
||
#: lazarusidestrconsts:lismaxs
|
||
msgid "Max %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr "Максимальна довжина рядка"
|
||
|
||
#: lazarusidestrconsts:dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr "Максимум останніх файлів"
|
||
|
||
#: lazarusidestrconsts:dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr "Максимум останніх файлів проектів"
|
||
|
||
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr "Досягнуто максимуму інструментів"
|
||
|
||
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr "Максимальна версія (необов'язково)"
|
||
|
||
#: lazarusidestrconsts:lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr "Максимальна версія"
|
||
|
||
#: lazarusidestrconsts:dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr "Максимум лічильника"
|
||
|
||
#: lazarusidestrconsts:lismemorydump
|
||
msgid "Memory Dump"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_menu
|
||
msgid "Menu"
|
||
msgstr "Меню"
|
||
|
||
#: lazarusidestrconsts:lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr "Редактор меню"
|
||
|
||
#: lazarusidestrconsts:lismenuviewmessages
|
||
msgid "Messages"
|
||
msgstr "Повідомлення"
|
||
|
||
#: lazarusidestrconsts:dlgmethodinspolicy
|
||
msgid "Method insert policy"
|
||
msgstr "Метод вставки"
|
||
|
||
#: lazarusidestrconsts:dlgminimizeallonminimizemain
|
||
msgid "Minimize all on minimize main"
|
||
msgstr "Мінімізувати все при мінімізації головної програми"
|
||
|
||
#: lazarusidestrconsts:lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr "Мінімальна версія (необов'язково)"
|
||
|
||
#: lazarusidestrconsts:lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr "Мінімальна версія"
|
||
|
||
#: lazarusidestrconsts:lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr "Другорядний"
|
||
|
||
#: lazarusidestrconsts:rsminorrevision
|
||
msgid "Minor revision:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmmirrorhorizontal
|
||
msgid "Mirror horizontal"
|
||
msgstr "Горизонтальне дзеркало"
|
||
|
||
#: lazarusidestrconsts:fdmmirrorvertical
|
||
msgid "Mirror vertical"
|
||
msgstr "Вертикальне дзеркало"
|
||
|
||
#: lazarusidestrconsts:dlgenvmisc
|
||
msgid "Miscellaneous"
|
||
msgstr "Різне"
|
||
|
||
#: lazarusidestrconsts:lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr "Пропущені Події"
|
||
|
||
#: lazarusidestrconsts:lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr "Пропущені пакунки"
|
||
|
||
#: lazarusidestrconsts:lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr "Змішування методів і властивостей"
|
||
|
||
#: lazarusidestrconsts:srvk_modechange
|
||
msgid "Mode Change"
|
||
msgstr "Змінити режим"
|
||
|
||
#: lazarusidestrconsts:uemodified
|
||
msgid "Modified"
|
||
msgstr "Змінено"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
|
||
msgid "Modified LGPL notice"
|
||
msgstr "Змінений LGPL допис"
|
||
|
||
#: lazarusidestrconsts:lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr "Змінено: %s"
|
||
|
||
#: lazarusidestrconsts:listodolfile
|
||
msgid "Module"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts:lismore
|
||
msgid "More"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditmore
|
||
msgid "More ..."
|
||
msgstr "Докладніше ..."
|
||
|
||
#: lazarusidestrconsts:srvk_lbutton
|
||
msgid "Mouse Button Left"
|
||
msgstr "Ліва кнопка мишки"
|
||
|
||
#: lazarusidestrconsts:srvk_mbutton
|
||
msgid "Mouse Button Middle"
|
||
msgstr "Середня кнопка мишки"
|
||
|
||
#: lazarusidestrconsts:srvk_rbutton
|
||
msgid "Mouse Button Right"
|
||
msgstr "Права кнопка мишки"
|
||
|
||
#: lazarusidestrconsts:dlgmouselinks
|
||
msgid "Mouse links"
|
||
msgstr "Зв'язки мишки"
|
||
|
||
#: lazarusidestrconsts:lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr "Пересунути вниз (або вправо)"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorleft
|
||
msgid "Move Editor Left"
|
||
msgstr "Пересунути в редакторі вліво"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorleftmost
|
||
msgid "Move Editor Leftmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorright
|
||
msgid "Move Editor Right"
|
||
msgstr "Пересунути в редакторі вправо"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorrightmost
|
||
msgid "Move Editor Rightmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismovepage
|
||
msgid "Move Page ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr "Пересунути вгору (або вліво)"
|
||
|
||
#: lazarusidestrconsts:lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr "Пересунути на один компонент назад"
|
||
|
||
#: lazarusidestrconsts:lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr "Пересунути на один компонент вперед"
|
||
|
||
#: lazarusidestrconsts:lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr "Пересунути компонент в кінець"
|
||
|
||
#: lazarusidestrconsts:lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr "Пересунути компонент наперед"
|
||
|
||
#: lazarusidestrconsts:srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr "Пересунути курсор вниз на одну сторінку"
|
||
|
||
#: lazarusidestrconsts:srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr "Пересунути курсор вліво на одну сторінку"
|
||
|
||
#: lazarusidestrconsts:srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr "Пересунути курсор вправо на одну сторінку"
|
||
|
||
#: lazarusidestrconsts:srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr "Пересунути курсор на абсолютний початок"
|
||
|
||
#: lazarusidestrconsts:srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr "Пересунути курсор на абсолютний кінець"
|
||
|
||
#: lazarusidestrconsts:srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr "Пересунути курсор до низу сторінки"
|
||
|
||
#: lazarusidestrconsts:srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr "Пересунути курсор в кінець рядка"
|
||
|
||
#: lazarusidestrconsts:srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr "Пересунути курсор на початок рядка"
|
||
|
||
#: lazarusidestrconsts:srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr "Пересунути курсор на початок сторінки"
|
||
|
||
#: lazarusidestrconsts:srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr "Пересунути курсор на попередню сторінку"
|
||
|
||
#: lazarusidestrconsts:srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr "Пересунути курсор на слово вліво"
|
||
|
||
#: lazarusidestrconsts:srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr "Пересунути курсор на слово вправо"
|
||
|
||
#: lazarusidestrconsts:lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr "Пересунути залежність вниз"
|
||
|
||
#: lazarusidestrconsts:lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr "Пересунути залежність вверх"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr "Пересунути редактор вліво"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr "Пересунути редактор вправо"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr "Пересунути включення до успадкованого"
|
||
|
||
#: lazarusidestrconsts:lispemovefiledown
|
||
msgid "Move file down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispemovefileup
|
||
msgid "Move file up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr "Пересунути вузол вниз"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr "Пересунути вузол на один рівень нижче"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr "Пересунути вузол на один рівень вище"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr "Пересунути вузол вверх"
|
||
|
||
#: lazarusidestrconsts:lispatheditmovepathdown
|
||
msgid "Move path down"
|
||
msgstr "Пересунути шлях вниз"
|
||
|
||
#: lazarusidestrconsts:lispatheditmovepathup
|
||
msgid "Move path up"
|
||
msgstr "Пересунути шлях вверх"
|
||
|
||
#: lazarusidestrconsts:fdmordermovetoback
|
||
msgid "Move to back"
|
||
msgstr "До попереднього"
|
||
|
||
#: lazarusidestrconsts:fdmordermovetofront
|
||
msgid "Move to front"
|
||
msgstr "Пересунути наперед"
|
||
|
||
#: lazarusidestrconsts:dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "Множинний Вибір"
|
||
|
||
#: lazarusidestrconsts:fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr "Виділені компоненти мають належати одній формі"
|
||
|
||
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr "ЗАУВАЖЕННЯ:Не можу створити означений шаблон для текстів Free Pascal"
|
||
|
||
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr "ЗАУВАЖЕННЯ:Не можу створити означений шаблон для текстів Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr "ЗАУВАЖЕННЯ:не знайдено конфігураційного файлу до codetools - працюю за замовчуванням "
|
||
|
||
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr "ЗАУВАЖЕННЯ:завантажую старий файл з налаштуваннями codetools"
|
||
|
||
#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
|
||
msgid "NOTE: only absolute paths are supported now"
|
||
msgstr "Нотатка: наразі підтримуються тільки абсолютні шляхи"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmname
|
||
msgid "Name"
|
||
msgstr "Назва"
|
||
|
||
#: lazarusidestrconsts:lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr "Назва нової процедури"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsname
|
||
msgid "Name:"
|
||
msgstr "Назва:"
|
||
|
||
#: lazarusidestrconsts:dlgnaming
|
||
msgid "Naming"
|
||
msgstr "Надання назви"
|
||
|
||
#: lazarusidestrconsts:lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr "Ніколи, тільки вручну"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatenew
|
||
msgid "New"
|
||
msgstr "Новий"
|
||
|
||
#: lazarusidestrconsts:lismenunewother
|
||
msgid "New ..."
|
||
msgstr "Новий..."
|
||
|
||
#: lazarusidestrconsts:lisnewancestors
|
||
msgid "New Ancestors"
|
||
msgstr "Нові предки"
|
||
|
||
#: lazarusidestrconsts:lisnewclass
|
||
msgid "New Class"
|
||
msgstr "Новий клас"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewcomponent
|
||
msgid "New Component"
|
||
msgstr "Новий компонент"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr "Новий файл"
|
||
|
||
#: lazarusidestrconsts:lismenunewform
|
||
msgid "New Form"
|
||
msgstr "Нова форма"
|
||
|
||
#: lazarusidestrconsts:lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "Новий проект ..."
|
||
|
||
#: lazarusidestrconsts:lismenunewprojectfromfile
|
||
msgid "New Project from file ..."
|
||
msgstr "Новий проект з файлу ..."
|
||
|
||
#: lazarusidestrconsts:lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr "Нова вимога"
|
||
|
||
#: lazarusidestrconsts:lismenueditornewtemplatedescription
|
||
msgid "New Template Description..."
|
||
msgstr "Новий опис шаблону "
|
||
|
||
#: lazarusidestrconsts:lismenunewunit
|
||
msgid "New Unit"
|
||
msgstr "Новий модуль"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr "Нова назва класу"
|
||
|
||
#: lazarusidestrconsts:liskmnewpackage
|
||
msgid "New package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenunewpackage
|
||
msgid "New package ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmnewproject
|
||
msgid "New project"
|
||
msgstr "Новий проект"
|
||
|
||
#: lazarusidestrconsts:liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr "Новий проект з файлу"
|
||
|
||
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr "Новий модуль не знаходиться в шляху до модулів"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr "Новий вузол"
|
||
|
||
#: lazarusidestrconsts:lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr "Новий пакунок"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr "Новий рядок"
|
||
|
||
#: lazarusidestrconsts:srvk_next
|
||
msgid "Next"
|
||
msgstr "Далі"
|
||
|
||
#: lazarusidestrconsts:srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr "Наступна закладка"
|
||
|
||
#: lazarusidestrconsts:lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr "Не знайдено розділу в ResourceString"
|
||
|
||
#: lazarusidestrconsts:lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr "Немає резервних файлів"
|
||
|
||
#: lazarusidestrconsts:lisnochange
|
||
msgid "No change"
|
||
msgstr "Без змін"
|
||
|
||
#: lazarusidestrconsts:lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "Не вибрано коду"
|
||
|
||
#: lazarusidestrconsts:lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr "Не успадковані параметри компілятора"
|
||
|
||
#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "Налагоджувач не визначений"
|
||
|
||
#: lazarusidestrconsts:dlgednoerr
|
||
msgid "No errors in key mapping found."
|
||
msgstr "Помилок в схемі розташування клавіш не знайдено"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "Не вибрано пункту"
|
||
|
||
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
||
msgstr "Не знайдено пакунку для залежності %s%s%s.%sВиберіть існуючий пакунок."
|
||
|
||
#: lazarusidestrconsts:lisoipnopackageselected
|
||
msgid "No package selected"
|
||
msgstr "Не вибрано пакунку"
|
||
|
||
#: lazarusidestrconsts:lisnoprogramfilesfound
|
||
msgid "No program file %s%s%s found."
|
||
msgstr "Не знайдено програмного файлу %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr "Не знайдено рядка з константами"
|
||
|
||
#: lazarusidestrconsts:lisldnovalidlazdocpath
|
||
msgid "No valid LazDoc path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
|
||
msgid "Node and its children are only valid for this project"
|
||
msgstr "Вузол і його нащадки правильні лише для поточного проекту"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr "Вузол лише для читання"
|
||
|
||
#: lazarusidestrconsts:srvk_nonconvert
|
||
msgid "Nonconvert"
|
||
msgstr "Неконвертоване"
|
||
|
||
#: lazarusidestrconsts:dlgenvnone
|
||
msgid "None"
|
||
msgstr "Відсутнє"
|
||
|
||
#: lazarusidestrconsts:dlgconormal
|
||
msgid "Normal Code"
|
||
msgstr "Нормальний Код"
|
||
|
||
#: lazarusidestrconsts:srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr "Нормальний режим вибрання"
|
||
|
||
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
|
||
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr "Як правило фільтр є регулярним виразом. В простому синтаксисі a . є нормальним символом, a * відповідає за все, a ? відповідає за будь-який символ, а кома і крапка з комою відділяють альтернативи. Наприклад, простий синтаксис *.pas;*.pp переписується на ^(.*\\.pas|.*\\.pp)$""
|
||
|
||
#: lazarusidestrconsts:lisnotadelphiproject
|
||
msgid "Not a Delphi project"
|
||
msgstr "Це не є проектом Delphi"
|
||
|
||
#: lazarusidestrconsts:lisnotadelphiunit
|
||
msgid "Not a Delphi unit"
|
||
msgstr "Це не є модулем Delphi"
|
||
|
||
#: lazarusidestrconsts:lisuenotfound
|
||
msgid "Not found"
|
||
msgstr "Не знайдено"
|
||
|
||
#: lazarusidestrconsts:lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr "Ще не реалізовано"
|
||
|
||
#: lazarusidestrconsts:lisnotimplementedyet2
|
||
msgid "Not implemented yet."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotimplementedyet
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotnow
|
||
msgid "Not now"
|
||
msgstr "Не зараз"
|
||
|
||
#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
|
||
msgid "Note: All keys will be set to the values of the choosen scheme."
|
||
msgstr "Нотатка: Всім ключам будуть встановлені значення згідно до обраної схеми"
|
||
|
||
#: lazarusidestrconsts:dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr "ЗАУВАЖЕННЯ: Файлами проектів вважаються всі файли в теці проектів"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr "Номер"
|
||
|
||
#: lazarusidestrconsts:srvk_numlock
|
||
msgid "Numlock"
|
||
msgstr "Numlock"
|
||
|
||
#: lazarusidestrconsts:srvk_numpad
|
||
msgid "Numpad %d"
|
||
msgstr "Numpad %d"
|
||
|
||
#: lazarusidestrconsts:lisifdok
|
||
msgid "OK"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr "Розширення ОС"
|
||
|
||
#: lazarusidestrconsts:uepovr
|
||
msgid "OVR"
|
||
msgstr "ЗАМ"
|
||
|
||
#: lazarusidestrconsts:lispckoptsobject
|
||
msgid "Object"
|
||
msgstr "Об'єкт"
|
||
|
||
#: lazarusidestrconsts:lismenuviewobjectinspector
|
||
msgid "Object Inspector"
|
||
msgstr "Інспектор об'єкту"
|
||
|
||
#: lazarusidestrconsts:liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr "Команди Інспектора об'єктів"
|
||
|
||
#: lazarusidestrconsts:lisokbtn
|
||
msgid "Ok"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts:lisoldancestors
|
||
msgid "Old Ancestors"
|
||
msgstr "Старі предки"
|
||
|
||
#: lazarusidestrconsts:lisoldclass
|
||
msgid "Old Class"
|
||
msgstr "Старий клас"
|
||
|
||
#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr "Замість виконання після побудови проекту використовуйте коменду Побудувати Файл"
|
||
|
||
#: lazarusidestrconsts:lisceoonidle
|
||
msgid "On idle"
|
||
msgstr "В паузах"
|
||
|
||
#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr "Замість виконання після побудови проекту використовуйте коменду Виконати Файл"
|
||
|
||
#: lazarusidestrconsts:lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "Мережева довідка"
|
||
|
||
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
|
||
msgid "Online Help not yet implemented"
|
||
msgstr "Довідка по мережі ще не реалізована"
|
||
|
||
#: lazarusidestrconsts:lispldonlyexistingfiles
|
||
msgid "Only existing files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr "Шукати лише для повних слів"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "Тільки вибране"
|
||
|
||
#: lazarusidestrconsts:lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr "Тільки текстові файли"
|
||
|
||
#: lazarusidestrconsts:lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintopen
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: lazarusidestrconsts:lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr "Відкрити %s"
|
||
|
||
#: lazarusidestrconsts:lismenuopen
|
||
msgid "Open ..."
|
||
msgstr "Відкрити ..."
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
|
||
msgid "Open Diff in editor"
|
||
msgstr "Відкрити різницю в редакторі"
|
||
|
||
#: lazarusidestrconsts:lisopenfile2
|
||
msgid "Open File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr "Відкрити Пакунок %s"
|
||
|
||
#: lazarusidestrconsts:lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr "Відкрити файл пакунку"
|
||
|
||
#: lazarusidestrconsts:lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr "Відкрити пакунок?"
|
||
|
||
#: lazarusidestrconsts:lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr "Відкрити попередній перегляд"
|
||
|
||
#: lazarusidestrconsts:lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "Відкрити проект ..."
|
||
|
||
#: lazarusidestrconsts:lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "Відкрити файл проекту"
|
||
|
||
#: lazarusidestrconsts:lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "Відкрити проект?"
|
||
|
||
#: lazarusidestrconsts:lismenutemplateopenrecent
|
||
msgid "Open Recent"
|
||
msgstr "Відкрити нещодавні"
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecent
|
||
msgid "Open Recent ..."
|
||
msgstr "Відкрити нещодавні ..."
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecentproject
|
||
msgid "Open Recent Project ..."
|
||
msgstr "Відкрити останній проект ..."
|
||
|
||
#: lazarusidestrconsts:liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr "Відкрити Модуль %s"
|
||
|
||
#: lazarusidestrconsts:lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr "Відкрити як XML-файл"
|
||
|
||
#: lazarusidestrconsts:lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr "Відкрити існуючий файл"
|
||
|
||
#: lazarusidestrconsts:lisopenfile
|
||
msgid "Open file"
|
||
msgstr "Відкрити файл"
|
||
|
||
#: lazarusidestrconsts:srkmecopenfileatcursor
|
||
msgid "Open file at cursor"
|
||
msgstr "Відкрити файл над курсором"
|
||
|
||
#: lazarusidestrconsts:lismenuopenfilenameatcursor
|
||
msgid "Open filename at cursor"
|
||
msgstr "Відкрити назву файлу над курсором"
|
||
|
||
#: lazarusidestrconsts:dlgqopenlastprj
|
||
msgid "Open last project at start"
|
||
msgstr "При старті відкрити останній проект"
|
||
|
||
#: lazarusidestrconsts:lisoipopenloadedpackage
|
||
msgid "Open loaded package"
|
||
msgstr "Відкрити завантажений пакунок"
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackage
|
||
msgid "Open loaded package ..."
|
||
msgstr "Відкриваю завантажений пакунок ..."
|
||
|
||
#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
|
||
msgid "Open or Load Compiler Options"
|
||
msgstr "Відкрити або Завантажити Опції Компілятора"
|
||
|
||
#: lazarusidestrconsts:liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr "Відкриття пакунку"
|
||
|
||
#: lazarusidestrconsts:lisopenpackage2
|
||
msgid "Open package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr "Відкриття файлу пакунку"
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackagefile
|
||
msgid "Open package file (.lpk) ..."
|
||
msgstr "Відкриття файлу пакунку (.lpk) ..."
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackageofcurunit
|
||
msgid "Open package of current unit"
|
||
msgstr "Відкрити пакунок поточного модуля"
|
||
|
||
#: lazarusidestrconsts:lisopenproject2
|
||
msgid "Open project"
|
||
msgstr "Відкрити проект"
|
||
|
||
#: lazarusidestrconsts:lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr "Відкрити проект знову"
|
||
|
||
#: lazarusidestrconsts:lisiecoopenrecent
|
||
msgid "Open recent"
|
||
msgstr "Відкрити нещодавні"
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecentpkg
|
||
msgid "Open recent package ..."
|
||
msgstr "Відкрити попередній пакунок ..."
|
||
|
||
#: lazarusidestrconsts:lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopentarget
|
||
msgid "Open target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr "Відкрити файл як текст програми"
|
||
|
||
#: lazarusidestrconsts:lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr "Відкрити пакунок %s"
|
||
|
||
#: lazarusidestrconsts:lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr "Відкрити проект %s"
|
||
|
||
#: lazarusidestrconsts:liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr "Відкрити модуль"
|
||
|
||
#: lazarusidestrconsts:dlgoptimiz
|
||
msgid "Optimizations:"
|
||
msgstr "Оптимізації:"
|
||
|
||
#: lazarusidestrconsts:liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr "Опція в позиції %d на дозволяє використовувати аргумент %s"
|
||
|
||
#: lazarusidestrconsts:liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr "Опція в позиції %d потребує аргумент %s"
|
||
|
||
#: lazarusidestrconsts:fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr "Параметр:Кинути на решітку"
|
||
|
||
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr "Параметр:Прикріпити до лінійок"
|
||
|
||
#: lazarusidestrconsts:dlgfropts
|
||
msgid "Options"
|
||
msgstr "Параметри"
|
||
|
||
#: lazarusidestrconsts:lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr "Параметри:"
|
||
|
||
#: lazarusidestrconsts:dlgcoopts
|
||
msgid "Options: "
|
||
msgstr "Параметри:"
|
||
|
||
#: lazarusidestrconsts:fdmorder
|
||
msgid "Order"
|
||
msgstr "Порядок"
|
||
|
||
#: lazarusidestrconsts:dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr "Походження"
|
||
|
||
#: lazarusidestrconsts:dlgcoother
|
||
msgid "Other"
|
||
msgstr "Інше"
|
||
|
||
#: lazarusidestrconsts:dlgcosources
|
||
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr "Відкрити коди (.pp/.pas-файли, що використовуються тільки IDE , але не компілятором)"
|
||
|
||
#: lazarusidestrconsts:dlgotherunitfiles
|
||
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
||
msgstr "Інші модулі файли (-Fu) (роздільником є двокрапка)"
|
||
|
||
#: lazarusidestrconsts:dlgenvotherfiles
|
||
msgid "Other files"
|
||
msgstr "Інші файли"
|
||
|
||
#: lazarusidestrconsts:rsotherinfo
|
||
msgid "Other info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr "Виведення"
|
||
|
||
#: lazarusidestrconsts:dlgpooutputsettings
|
||
msgid "Output Settings"
|
||
msgstr "Вихідні налаштування"
|
||
|
||
#: lazarusidestrconsts:lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr "Вихідна тека"
|
||
|
||
#: lazarusidestrconsts:dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr "Переповн."
|
||
|
||
#: lazarusidestrconsts:lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr "Підмінити мову. Наприклад --language=de. Для можливих величин див. теку languages"
|
||
|
||
#: lazarusidestrconsts:lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr "Змінювання системної змінної"
|
||
|
||
#: lazarusidestrconsts:srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr "Режим перезапису"
|
||
|
||
#: lazarusidestrconsts:lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr "Переписати файл на диску"
|
||
|
||
#: lazarusidestrconsts:lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr "Переписати файл?"
|
||
|
||
#: lazarusidestrconsts:listodolowner
|
||
msgid "Owner"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispackage
|
||
msgid "Package"
|
||
msgstr "Пакунок"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr "Пакунок%s"
|
||
|
||
#: lazarusidestrconsts:lispckexplpackagenotfound
|
||
msgid "Package %s not found"
|
||
msgstr "Пакунк%sне знайдений"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagechangedsave
|
||
msgid "Package %s%s%s changed. Save?"
|
||
msgstr "Пакунок %s%s%s змінено. Записати?"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
|
||
msgid "Package %s%s%s has changed.%sSave package?"
|
||
msgstr "Пакунок %s%s%s змінено.%s Зберегти пакунок?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
|
||
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
||
msgstr "Пакунок %s%s%s не має правильної вихідної теки:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisaf2ppackagenotfound
|
||
msgid "Package %s%s%s not found."
|
||
msgstr "Пакунк %s%s%s не знайдений."
|
||
|
||
#: lazarusidestrconsts:lismenupackagegraph
|
||
msgid "Package Graph ..."
|
||
msgstr "Пакунок Graph ..."
|
||
|
||
#: lazarusidestrconsts:lispackageinfo
|
||
msgid "Package Info"
|
||
msgstr "Пакунок Info"
|
||
|
||
#: lazarusidestrconsts:lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr "Пакунок Name"
|
||
|
||
#: lazarusidestrconsts:lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr "Пакунок Name:"
|
||
|
||
#: lazarusidestrconsts:lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr "Параметри пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgreg
|
||
msgid "Package Registration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr "Відмітити теку кодів пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr "Конфлікти в пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagefilemissing
|
||
msgid "Package file missing"
|
||
msgstr "Пропущений файл пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr "Файл пакунку не знайдений"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
|
||
msgid "Package file not saved"
|
||
msgstr "Файл пакунку не збережений"
|
||
|
||
#: lazarusidestrconsts:liskmpackagegraph
|
||
msgid "Package graph"
|
||
msgstr "Пакунок графіки"
|
||
|
||
#: lazarusidestrconsts:dlgpldpackagegroup
|
||
msgid "Package group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is no designtime package"
|
||
msgstr "Пакунок не є designtime пакунком"
|
||
|
||
#: lazarusidestrconsts:lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr "Пакунок тільки для читання"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr "Потрібен пакунок"
|
||
|
||
#: lazarusidestrconsts:lismenupackagelinks
|
||
msgid "Package links ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr "Така назва пакунку вже існує"
|
||
|
||
#: lazarusidestrconsts:lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr "Назва пакунку починається з ..."
|
||
|
||
#: lazarusidestrconsts:lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr "Назва пакунку вміщує ..."
|
||
|
||
#: lazarusidestrconsts:lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr "Потрібне встановлення пакунку"
|
||
|
||
#: lazarusidestrconsts:lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr "Пакунок не знайдений"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr "Пакунок:%s"
|
||
|
||
#: lazarusidestrconsts:lispckoptspackagetype
|
||
msgid "PackageType"
|
||
msgstr "Тип пакунку"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr "Пакунки повинні мати розширення файлів .lpk"
|
||
|
||
#: lazarusidestrconsts:lispackagestoinstallintheide
|
||
msgid "Packages to install in the IDE"
|
||
msgstr "Пакунки для встановлення в IDE"
|
||
|
||
#: lazarusidestrconsts:lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr "Задовга назва сторінки"
|
||
|
||
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr "Малювати елементи дизайну тільки в паузах (зменшує навантаження на повільних машинах)"
|
||
|
||
#: lazarusidestrconsts:liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr "Сторінка палітри:"
|
||
|
||
#: lazarusidestrconsts:lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr "Абзаци"
|
||
|
||
#: lazarusidestrconsts:liscmparameter
|
||
msgid "Parameter"
|
||
msgstr "Параметр"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr "Параметри:"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node can not contain child nodes."
|
||
msgstr "Елемент предка не може вміщувати дочірніх."
|
||
|
||
#: lazarusidestrconsts:dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr "Обробка"
|
||
|
||
#: lazarusidestrconsts:lislazbuildabopart
|
||
msgid "Part"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispascalsourcefile
|
||
msgid "Pascal source file"
|
||
msgstr "Файл з паскаль-текстом"
|
||
|
||
#: lazarusidestrconsts:lispascalunit
|
||
msgid "Pascal unit"
|
||
msgstr "Паскаль-модуль"
|
||
|
||
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr "Модулі паскаля повинні мати розширення .pp або .pas"
|
||
|
||
#: lazarusidestrconsts:lispasscount
|
||
msgid "Pass Count"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpassoptslinker
|
||
msgid "Pass Options To The Linker (Delimiter is space)"
|
||
msgstr "Передати параметри компонувальнику (відділяти пробілами)"
|
||
|
||
#: lazarusidestrconsts:lismenupaste
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
|
||
msgid "Paste Components from clipboard"
|
||
msgstr "Вставити Компоненти з буферу обміну"
|
||
|
||
#: lazarusidestrconsts:srkmecpaste
|
||
msgid "Paste clipboard to current position"
|
||
msgstr "Вставити з буфера в поточну позицію"
|
||
|
||
#: lazarusidestrconsts:lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr "Вставити вибрані компоненти з буфера"
|
||
|
||
#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr "Шляхи шаблонів"
|
||
|
||
#: lazarusidestrconsts:listofpcpath
|
||
msgid "Path:"
|
||
msgstr "Шлях:"
|
||
|
||
#: lazarusidestrconsts:dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr "Шляхи"
|
||
|
||
#: lazarusidestrconsts:lisuidpathsreadonly
|
||
msgid "Paths (Read Only)"
|
||
msgstr "Шляхи (тільки для читання)"
|
||
|
||
#: lazarusidestrconsts:lismenupause
|
||
msgid "Pause"
|
||
msgstr "Пауза"
|
||
|
||
#: lazarusidestrconsts:srvk_pause
|
||
msgid "Pause key"
|
||
msgstr "Клавіша Pause"
|
||
|
||
#: lazarusidestrconsts:liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr "Зупинити програму"
|
||
|
||
#: lazarusidestrconsts:dlgpersistentcaret
|
||
msgid "Persistent caret"
|
||
msgstr "Нерухомий курсор"
|
||
|
||
#: lazarusidestrconsts:lisccochecktestdir
|
||
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispleasecheckthecompilername
|
||
msgid "Please check the compiler name"
|
||
msgstr "Перевірте назву компілятора"
|
||
|
||
#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
|
||
msgid "Please check the freepascal source directory"
|
||
msgstr "Перевірте теку кодів FreePascal"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr "Відкрийте модуль перед запуском."
|
||
|
||
#: lazarusidestrconsts:srkmpresskey
|
||
msgid "Please press a key ..."
|
||
msgstr "Натисніть будь-яку клавішу..."
|
||
|
||
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr "Збережіть файл перед додаванням в пакунок."
|
||
|
||
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
|
||
msgid "Please save the package first."
|
||
msgstr "Спочатку збережіть пакунок."
|
||
|
||
#: lazarusidestrconsts:lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr "Виберіть пакунок"
|
||
|
||
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
|
||
msgid "Please select a package to open"
|
||
msgstr "Виберіть пакунок, щоб відкрити"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "Виберіть спочатку елемент"
|
||
|
||
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr "Виділіть трохи коду, щоб витягти нову процедуру/метод."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr "Крапка"
|
||
|
||
#: lazarusidestrconsts:lispointer
|
||
msgid "Pointer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "Польська"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolishwin
|
||
msgid "Polish(CP1250)"
|
||
msgstr "Польська(CP1250)"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolishiso
|
||
msgid "Polish(ISO 8859-2)"
|
||
msgstr "Польська(ISO 8859-2)"
|
||
|
||
#: lazarusidestrconsts:rslanguageportugues
|
||
msgid "Portuguese"
|
||
msgstr "Португальська"
|
||
|
||
#: lazarusidestrconsts:lisceomode
|
||
msgid "Preferred Exhibition Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwrdpreview
|
||
msgid "Preview"
|
||
msgstr "Попередній перегляд"
|
||
|
||
#: lazarusidestrconsts:dlgcdtpreview
|
||
msgid "Preview (Max line length = 1)"
|
||
msgstr "Попередній перегляд (max довжина=1)"
|
||
|
||
#: lazarusidestrconsts:srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr "Попередня закладка"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr "Попередній елемент не може вміщувати дочірніх."
|
||
|
||
#: lazarusidestrconsts:srvk_print
|
||
msgid "Print"
|
||
msgstr "Друкування"
|
||
|
||
#: lazarusidestrconsts:listodolistprintlist
|
||
msgid "Print todo items"
|
||
msgstr "Друкувати елементи todo"
|
||
|
||
#: lazarusidestrconsts:srvk_prior
|
||
msgid "Prior"
|
||
msgstr "Перед"
|
||
|
||
#: lazarusidestrconsts:listodolpriority
|
||
msgid "Priority"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprivate
|
||
msgid "Private"
|
||
msgstr "Приватний"
|
||
|
||
#: lazarusidestrconsts:lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr "Приватний метод"
|
||
|
||
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
||
msgstr "Можливо, потрібно встановити деякі пакунки перед тим, як продовжувати.%s%sЗауважте:%sПроект залежить від деяких пакунків, які містять модулі з процедурою Register. Процедура Register зазвичай використовується для встановлення компонентів в IDE. Але наступні модулі залежать від пакунків, які ще не встановлено в IDE. Якщо Ви спробуєте відкрити форму в IDE, яка використовує таку компоненту, отримаєте повідомлення про відсутність компонентів і результати завантаження форми не дадуть очікуваного результату.%s%sЦе жодним чином не відіб'ється на проекті, який відкривається чи на його файлах.%s%sЦе тільки означає: Недобре відкривати форми для роботи перед встановленням відсутніх пакунків.%s%s"
|
||
|
||
#: lazarusidestrconsts:lisprocedure
|
||
msgid "Procedure"
|
||
msgstr "Процедура"
|
||
|
||
#: lazarusidestrconsts:uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr "Процедурний перехід"
|
||
|
||
#: lazarusidestrconsts:srkmecprocedurelist
|
||
msgid "Procedure List ..."
|
||
msgstr "Процедура List ..."
|
||
|
||
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr "Політика вставки процедур"
|
||
|
||
#: lazarusidestrconsts:lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr "Процедура з інтерфейсом"
|
||
|
||
#: lazarusidestrconsts:lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr "Процес"
|
||
|
||
#: lazarusidestrconsts:lisprogram
|
||
msgid "Program"
|
||
msgstr "Програма"
|
||
|
||
#: lazarusidestrconsts:lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr "Виявлена програма"
|
||
|
||
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
||
msgstr "Текст програми повинен мати розширення паскаля, напр. .pas, .pp або .lpr"
|
||
|
||
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
|
||
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Програма%sПрограма freepascal. Файл програми автоматично підтримується lazarus."
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolprogramfilename
|
||
msgid "Programfilename:"
|
||
msgstr "Назва файлу програми:"
|
||
|
||
#: lazarusidestrconsts:lisexeprograms
|
||
msgid "Programs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispdprogress
|
||
msgid "Progress"
|
||
msgstr "Перебіг"
|
||
|
||
#: lazarusidestrconsts:dlgenvproject
|
||
msgid "Project"
|
||
msgstr "Проект"
|
||
|
||
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
|
||
msgid "Project %s%s%s successfully built. :)"
|
||
msgstr "Проект %s%s%s успішно зібрано. :)"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectincpath
|
||
msgid "Project IncPath"
|
||
msgstr "Шлях до файлів проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr "Шляхи, що включені до проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojectinformation
|
||
msgid "Project Information"
|
||
msgstr "Інформація про проект"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr "Інспектор проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr "Інспектор проекту - %s"
|
||
|
||
#: lazarusidestrconsts:dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr "Параметри проекту"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr "Параметри проекту ..."
|
||
|
||
#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr "Мітка теки програмних файлів проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr "Шлях до кодів проекту"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectsrcpath
|
||
msgid "Project SrcPath"
|
||
msgstr "Шлях до кодів проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr "Шлях до модулів проекту"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectunitpath
|
||
msgid "Project UnitPath"
|
||
msgstr "Шлях до модулів проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr "Проект змінено"
|
||
|
||
#: lazarusidestrconsts:lisprojectclosed
|
||
msgid "Project closed"
|
||
msgstr "Проект закритий"
|
||
|
||
#: lazarusidestrconsts:lisprojectdirectory
|
||
msgid "Project directory"
|
||
msgstr "Тека проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr "Назва файлу проекту"
|
||
|
||
#: lazarusidestrconsts:dlgprojfiles
|
||
msgid "Project files"
|
||
msgstr "Файли проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr "Виявлено info-файл проекту"
|
||
|
||
#: lazarusidestrconsts:lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr "Проект є виконуваним"
|
||
|
||
#: lazarusidestrconsts:lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr "Властивості макросів проекту"
|
||
|
||
#: lazarusidestrconsts:srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr "Команди меню Проект"
|
||
|
||
#: lazarusidestrconsts:lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr "Проект: %s"
|
||
|
||
#: lazarusidestrconsts:lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr "Довідка за значенням"
|
||
|
||
#: lazarusidestrconsts:lisceproperties
|
||
msgid "Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr "Властивості:"
|
||
|
||
#: lazarusidestrconsts:dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr "Розширення властивості"
|
||
|
||
#: lazarusidestrconsts:dlgpropnamecolor
|
||
msgid "Property name"
|
||
msgstr "Назва властивості"
|
||
|
||
#: lazarusidestrconsts:lisprotected
|
||
msgid "Protected"
|
||
msgstr "Захищений"
|
||
|
||
#: lazarusidestrconsts:lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr "Захищений метод"
|
||
|
||
#: lazarusidestrconsts:lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisemdpublic
|
||
msgid "Public"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr "Спільний метод"
|
||
|
||
#: lazarusidestrconsts:lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr "Опублікувати пакунок"
|
||
|
||
#: lazarusidestrconsts:lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr "Опублікувати проект ..."
|
||
|
||
#: lazarusidestrconsts:liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr "Опублікувати проект"
|
||
|
||
#: lazarusidestrconsts:lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr "Тека публікації проекту"
|
||
|
||
#: lazarusidestrconsts:lisemdpublished
|
||
msgid "Published"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr "Опублікований метод"
|
||
|
||
#: lazarusidestrconsts:lislazbuildquickbuildoptions
|
||
msgid "Quick Build Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuquickcompile
|
||
msgid "Quick compile"
|
||
msgstr "Швидка компіляція"
|
||
|
||
#: lazarusidestrconsts:liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr "Швидка компіляція без збирання"
|
||
|
||
#: lazarusidestrconsts:lismenuquicksyntaxcheck
|
||
msgid "Quick syntax check"
|
||
msgstr "Швидка перевірка синтаксису"
|
||
|
||
#: lazarusidestrconsts:lismenuquit
|
||
msgid "Quit"
|
||
msgstr "Вихід"
|
||
|
||
#: lazarusidestrconsts:lisquitlazarus
|
||
msgid "Quit Lazarus"
|
||
msgstr "Вийти з Lazarus"
|
||
|
||
#: lazarusidestrconsts:dlgcorange
|
||
msgid "Range"
|
||
msgstr "Діапазон"
|
||
|
||
#: lazarusidestrconsts:lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr "Оновити залежність"
|
||
|
||
#: lazarusidestrconsts:lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr "Оновити файл"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr "Перекомпілювати це, а також і всі потрібні пакунки?"
|
||
|
||
#: lazarusidestrconsts:lisreaderror
|
||
msgid "Read Error"
|
||
msgstr "Помилка читання"
|
||
|
||
#: lazarusidestrconsts:uemreadonly
|
||
msgid "Read Only"
|
||
msgstr "Тільки для читання"
|
||
|
||
#: lazarusidestrconsts:lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr "Тільки для читання:%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr "Помилка читання"
|
||
|
||
#: lazarusidestrconsts:dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr "Префікс READ"
|
||
|
||
#: lazarusidestrconsts:uepreadonly
|
||
msgid "Readonly"
|
||
msgstr "Тільки для читання"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr "Перебудувати Lazarus?"
|
||
|
||
#: lazarusidestrconsts:lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr "Недавні файли"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompileallrequired
|
||
msgid "Recompile all required"
|
||
msgstr "Необхідно перекомпілювати всі"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompileclean
|
||
msgid "Recompile clean"
|
||
msgstr "Чиста перебудова"
|
||
|
||
#: lazarusidestrconsts:lisrecordstruct
|
||
msgid "Record/Structure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuredo
|
||
msgid "Redo"
|
||
msgstr "Повернути"
|
||
|
||
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr "Обмежити мал. дизайнера"
|
||
|
||
#: lazarusidestrconsts:uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr "Переробка коду"
|
||
|
||
#: lazarusidestrconsts:dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr "Посилання"
|
||
|
||
#: lazarusidestrconsts:dlgunitdeprefresh
|
||
msgid "Refresh"
|
||
msgstr "Оновити"
|
||
|
||
#: lazarusidestrconsts:lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr "Оновлювати автоматично"
|
||
|
||
#: lazarusidestrconsts:listodolistrefresh
|
||
msgid "Refresh todo items"
|
||
msgstr "Оновити елементи todo"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr "Порожня процедура реєстрації"
|
||
|
||
#: lazarusidestrconsts:lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr "Зареєструвати модуль"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr "Було викликано RegisterUnit, але пакунків не зареєстровано."
|
||
|
||
#: lazarusidestrconsts:lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr "Зареєстровані доповнення"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregistrationerror
|
||
msgid "Registration Error"
|
||
msgstr "Помилка реєстрації"
|
||
|
||
#: lazarusidestrconsts:lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr "Відносні шляхи"
|
||
|
||
#: lazarusidestrconsts:lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr "Версія"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffrevertall
|
||
msgid "Reload from disk"
|
||
msgstr "Перезавантажити з диска"
|
||
|
||
#: lazarusidestrconsts:lisexttoolremove
|
||
msgid "Remove"
|
||
msgstr "Видалити"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr "Видалити залежність?"
|
||
|
||
#: lazarusidestrconsts:liskmremoveactiveunitfromproject
|
||
msgid "Remove active unit from project"
|
||
msgstr "Видалити активний модуль з проекту"
|
||
|
||
#: lazarusidestrconsts:lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr "Видалити всі некоректні властивості"
|
||
|
||
#: lazarusidestrconsts:liskmremovebreakpoint
|
||
msgid "Remove break point"
|
||
msgstr "Видалити точку зупину"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr "Видалити залежність"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Видалити залежність %s%s%s%sз пакунку %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:srkmecremoveemptymethods
|
||
msgid "Remove empty methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr "Видалити файл"
|
||
|
||
#: lazarusidestrconsts:lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr "Видалити файл %s з проекту?"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefilefrompackage
|
||
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Видалити файл %s%s%s%s з пакунку %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr "Видалити файл?"
|
||
|
||
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr "Видалити файли за фільтром"
|
||
|
||
#: lazarusidestrconsts:lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr "Прибрати з проекту ..."
|
||
|
||
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
|
||
msgid "Remove from favourite properties"
|
||
msgstr "Прибрати з улюблених властивостей"
|
||
|
||
#: lazarusidestrconsts:lisremovefromproject
|
||
msgid "Remove from project"
|
||
msgstr "Видалити з проекту"
|
||
|
||
#: lazarusidestrconsts:lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "Видалити шлях"
|
||
|
||
#: lazarusidestrconsts:lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "Видалити вибраний елемент"
|
||
|
||
#: lazarusidestrconsts:lisremovethem
|
||
msgid "Remove them"
|
||
msgstr "Видалити їх"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
||
msgid "Removed Files (these entries are not saved to the lpk file)"
|
||
msgstr "Видалені файлі (ці елементи не зберігаються в lpk-файлі)"
|
||
|
||
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
|
||
msgid "Removed required packages"
|
||
msgstr "Видалені необхідні пакунки"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
||
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
||
msgstr "Видалені необхідні пакунки (вони не зберігаються в lpk-файлі)"
|
||
|
||
#: lazarusidestrconsts:lisfrirename
|
||
msgid "Rename"
|
||
msgstr "Перейменувати"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr "Перейменувати файл в нижн.рег-рі?"
|
||
|
||
#: lazarusidestrconsts:uemrenameidentifier
|
||
msgid "Rename Identifier"
|
||
msgstr "Перейменувати ID"
|
||
|
||
#: lazarusidestrconsts:lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr "Перейменувати ID ..."
|
||
|
||
#: lazarusidestrconsts:lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr "Перейменувати всі посилання"
|
||
|
||
#: lazarusidestrconsts:lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr "Не вдалося змінити назву файла"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
|
||
msgid "Rename file in package?"
|
||
msgstr "Перейменувати файл в пакунку?"
|
||
|
||
#: lazarusidestrconsts:lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr "Перейменувати файл?"
|
||
|
||
#: lazarusidestrconsts:srkmecrenameidentifier
|
||
msgid "Rename identifier"
|
||
msgstr "Перейменувати ID"
|
||
|
||
#: lazarusidestrconsts:lisfrirenameto
|
||
msgid "Rename to"
|
||
msgstr "Перейменувати в"
|
||
|
||
#: lazarusidestrconsts:lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr "Превести в нижній регістр"
|
||
|
||
#: lazarusidestrconsts:lisrepeatcount
|
||
msgid "Repeat Count:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenureplace
|
||
msgid "Replace"
|
||
msgstr "Заміна"
|
||
|
||
#: lazarusidestrconsts:dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr "Замінити &Всі"
|
||
|
||
#: lazarusidestrconsts:lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr "Замінити файл"
|
||
|
||
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file %s%s%s?"
|
||
msgstr "Замінити існуючий файл %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:srkmecreplace
|
||
msgid "Replace text"
|
||
msgstr "Замінити текст"
|
||
|
||
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
||
msgstr "Замінити %s%s%s%s на %s%s%s в цьому місті?"
|
||
|
||
#: lazarusidestrconsts:lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr "Помилка заміни"
|
||
|
||
#: lazarusidestrconsts:dlgreport
|
||
msgid "Report"
|
||
msgstr "Звіт"
|
||
|
||
#: lazarusidestrconsts:lismenureportingbug
|
||
msgid "Reporting a bug..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr "Необхідні пакунки"
|
||
|
||
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
|
||
msgid "Rescan FPC source directory"
|
||
msgstr "Переглянути теку кодів FPC"
|
||
|
||
#: lazarusidestrconsts:lisvsrresetresultlist
|
||
msgid "Reset Result List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuresetdebugger
|
||
msgid "Reset debugger"
|
||
msgstr "Скидання налагоджувача"
|
||
|
||
#: lazarusidestrconsts:lisresourceloaderror
|
||
msgid "Resource load error"
|
||
msgstr "Помилка завантаження ресурсу"
|
||
|
||
#: lazarusidestrconsts:lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr "Помилка збереження ресурсу"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr "Рядок ресурсів вже існує"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr "Секція Resourcestring:"
|
||
|
||
#: lazarusidestrconsts:lismenurestart
|
||
msgid "Restart"
|
||
msgstr "Перезапуск"
|
||
|
||
#: lazarusidestrconsts:lislazbuildrestartafterbuild
|
||
msgid "Restart after successful Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Відновити геометрію вікна"
|
||
|
||
#: lazarusidestrconsts:rsiwprestorewindowsize
|
||
msgid "Restore window size"
|
||
msgstr "Відновити розмір вікна"
|
||
|
||
#: lazarusidestrconsts:lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccoresults
|
||
msgid "Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr "Відновити"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr "Відновити за Handler`ом"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr "Відновити Unhandled"
|
||
|
||
#: lazarusidestrconsts:srvk_return
|
||
msgid "Return"
|
||
msgstr "Повертання"
|
||
|
||
#: lazarusidestrconsts:lismenurevert
|
||
msgid "Revert"
|
||
msgstr "Зворотній експорт"
|
||
|
||
#: lazarusidestrconsts:lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr "Обертання не вдалося"
|
||
|
||
#: lazarusidestrconsts:lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr "Повернути пакунок?"
|
||
|
||
#: lazarusidestrconsts:srvk_right
|
||
msgid "Right"
|
||
msgstr "Справа"
|
||
|
||
#: lazarusidestrconsts:dlgrightclickselects
|
||
msgid "Right Click selects"
|
||
msgstr "Вибір правим клацанням"
|
||
|
||
#: lazarusidestrconsts:lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
||
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
||
msgstr "Праве клацання на елементі дерева дає меню із всіма доступними функціями пакунку."
|
||
|
||
#: lazarusidestrconsts:dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr "Праве поле"
|
||
|
||
#: lazarusidestrconsts:dlgrightmargincolor
|
||
msgid "Right margin color"
|
||
msgstr "Колір прав. поля"
|
||
|
||
#: lazarusidestrconsts:dlgrightmousemovescursor
|
||
msgid "Right mouse moves caret"
|
||
msgstr "Права кнопка пересуває курсор"
|
||
|
||
#: lazarusidestrconsts:lisrightsides
|
||
msgid "Right sides"
|
||
msgstr "Праві краї"
|
||
|
||
#: lazarusidestrconsts:lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr "По правому краю"
|
||
|
||
#: lazarusidestrconsts:dlgrubberbandgroup
|
||
msgid "Rubber band"
|
||
msgstr "Поле приміток"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectrun
|
||
msgid "Run"
|
||
msgstr "Виконати"
|
||
|
||
#: lazarusidestrconsts:lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr "Виконати Команду"
|
||
|
||
#: lazarusidestrconsts:lismenurunfile
|
||
msgid "Run File"
|
||
msgstr "Виконати файл"
|
||
|
||
#: lazarusidestrconsts:lismenurunparameters
|
||
msgid "Run Parameters ..."
|
||
msgstr "Параметри виконання ..."
|
||
|
||
#: lazarusidestrconsts:srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr "Команди меню Виконати"
|
||
|
||
#: lazarusidestrconsts:dlgrunparameters
|
||
msgid "Run parameters"
|
||
msgstr "Параметри виконання"
|
||
|
||
#: lazarusidestrconsts:liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr "Виконати програму"
|
||
|
||
#: lazarusidestrconsts:lismenuruntocursor
|
||
msgid "Run to cursor"
|
||
msgstr "Виконати до курсора"
|
||
|
||
#: lazarusidestrconsts:lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr "Виконати-до не вдався"
|
||
|
||
#: lazarusidestrconsts:lispckoptsruntimeonly
|
||
msgid "Runtime only"
|
||
msgstr "Часу виконання"
|
||
|
||
#: lazarusidestrconsts:rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "Російська"
|
||
|
||
#: lazarusidestrconsts:lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr "Версія SVN"
|
||
|
||
#: lazarusidestrconsts:dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr "Та ж сама назва (в підтеці)"
|
||
|
||
#: lazarusidestrconsts:lismenusave
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: lazarusidestrconsts:lissavespace
|
||
msgid "Save "
|
||
msgstr "Зберегти "
|
||
|
||
#: lazarusidestrconsts:lissave
|
||
msgid "Save ..."
|
||
msgstr "Збереження ..."
|
||
|
||
#: lazarusidestrconsts:lismenusaveall
|
||
msgid "Save All"
|
||
msgstr "Зберегти всі"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatesaveas
|
||
msgid "Save As"
|
||
msgstr "Зберегти як"
|
||
|
||
#: lazarusidestrconsts:dlgcharcasefileact
|
||
msgid "Save As - auto rename pascal files lower case"
|
||
msgstr "Зберегти як - автоперейменування в нижній регістр"
|
||
|
||
#: lazarusidestrconsts:lismenusaveas
|
||
msgid "Save As ..."
|
||
msgstr "Зберегти як ..."
|
||
|
||
#: lazarusidestrconsts:lismenueditorsaveastemplate
|
||
msgid "Save As Template..."
|
||
msgstr "Зберегти як шаблон..."
|
||
|
||
#: lazarusidestrconsts:lispckeditsavechanges
|
||
msgid "Save Changes?"
|
||
msgstr "Зберегти зміни?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr "Зберегти пакунок%s (*.lpk)"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackage
|
||
msgid "Save Package?"
|
||
msgstr "Зберегти пакунок?"
|
||
|
||
#: lazarusidestrconsts:lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "Зберегти проект"
|
||
|
||
#: lazarusidestrconsts:lissaveprojectlpi
|
||
msgid "Save Project %s (*.lpi)"
|
||
msgstr "Зберегти проект %s (*.lpi)"
|
||
|
||
#: lazarusidestrconsts:lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "Зберегти проект як ..."
|
||
|
||
#: lazarusidestrconsts:lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "Зберегти налаштування"
|
||
|
||
#: lazarusidestrconsts:lishintsaveall
|
||
msgid "Save all"
|
||
msgstr "Зберегти всі"
|
||
|
||
#: lazarusidestrconsts:lissaveallmessagestofile
|
||
msgid "Save all messages to file"
|
||
msgstr "Зберегти всі повідомлення в файл"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr "Зберегти і вийти"
|
||
|
||
#: lazarusidestrconsts:lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr "Зберегти і вийти з діалогу"
|
||
|
||
#: lazarusidestrconsts:lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr "Зберегти і перебудувати IDE"
|
||
|
||
#: lazarusidestrconsts:lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr "Зберегти зміни в проект %s?"
|
||
|
||
#: lazarusidestrconsts:lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "Зберегти зміни?"
|
||
|
||
#: lazarusidestrconsts:dlgsavedfile
|
||
msgid "Save desktop settings to file"
|
||
msgstr "Збер. робочий стіл у файл"
|
||
|
||
#: lazarusidestrconsts:dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr "Зберігати відомості про закриті файли"
|
||
|
||
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr "Зберегти інформацію редактора про файли, що не відносяться до проекту"
|
||
|
||
#: lazarusidestrconsts:dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr "Зберігати відомості тільки про файли проекту"
|
||
|
||
#: lazarusidestrconsts:lissavefilebeforeclosingform
|
||
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
||
msgstr "Зберегти файл %s%s%sперед закриттям форми %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lissavefileas
|
||
msgid "Save file as"
|
||
msgstr "Зберегти файл як"
|
||
|
||
#: lazarusidestrconsts:lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr "Зберегти файл діалогу"
|
||
|
||
#: lazarusidestrconsts:fdmsaveformasxml
|
||
msgid "Save form as xml"
|
||
msgstr "Зберегти файл як xml"
|
||
|
||
#: lazarusidestrconsts:lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr "Зберегти в файлі .lpi"
|
||
|
||
#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr "Зберегти в файлі .lpi в теці проекту"
|
||
|
||
#: lazarusidestrconsts:lisposaveinideconfigdirectory
|
||
msgid "Save in IDE config directory"
|
||
msgstr "Зберегти в теці графічної оболонки"
|
||
|
||
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr "Зберегти інформацію про закриті редактором файли"
|
||
|
||
#: lazarusidestrconsts:lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr "Зберегти повідомлення в файл (*.txt)"
|
||
|
||
#: lazarusidestrconsts:lispckeditsavepackage
|
||
msgid "Save package"
|
||
msgstr "Зберегти пакунок"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackage2
|
||
msgid "Save package?"
|
||
msgstr "Зберегти пакунок?"
|
||
|
||
#: lazarusidestrconsts:liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "Зберегти проект"
|
||
|
||
#: lazarusidestrconsts:liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "Зберегти проект як"
|
||
|
||
#: lazarusidestrconsts:lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr "Зберегти інформацію про сесію в"
|
||
|
||
#: lazarusidestrconsts:lislazbuildsavesettings
|
||
msgid "Save settings"
|
||
msgstr "Зберегти налаштування"
|
||
|
||
#: lazarusidestrconsts:lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "Зберегти в файл"
|
||
|
||
#: lazarusidestrconsts:lisiecosavetorecent
|
||
msgid "Save to recent"
|
||
msgstr "Зберегти в нещодавні"
|
||
|
||
#: lazarusidestrconsts:liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "ЗберегтиВсе"
|
||
|
||
#: lazarusidestrconsts:liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "ЗберегтиЯк"
|
||
|
||
#: lazarusidestrconsts:fdmscaleword
|
||
msgid "Scale"
|
||
msgstr "Масштаб"
|
||
|
||
#: lazarusidestrconsts:lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr "Масштабний фактор:"
|
||
|
||
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
|
||
msgid "Scan Unit for Unit Name and Register procedure"
|
||
msgstr "Шукати в модулі назву і процедуру Register"
|
||
|
||
#: lazarusidestrconsts:liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr "Пошук повідомлень FPC"
|
||
|
||
#: lazarusidestrconsts:liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr "Пошук повідомлень Make"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for Free Pascal Compiler messages"
|
||
msgstr "Пошук повідомлень компілятора FreePascal в виведенні"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for make messages"
|
||
msgstr "Пошук повідомлень make в виведенні"
|
||
|
||
#: lazarusidestrconsts:dlgscope
|
||
msgid "Scope"
|
||
msgstr "Контекст"
|
||
|
||
#: lazarusidestrconsts:srvk_scroll
|
||
msgid "Scroll"
|
||
msgstr "Прокрутити"
|
||
|
||
#: lazarusidestrconsts:dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr "Прокрутити на один вниз"
|
||
|
||
#: lazarusidestrconsts:srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr "Прокрутити вниз один рядок"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr "Прокрутити вліво один символ"
|
||
|
||
#: lazarusidestrconsts:dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr "Прокрутити до кінця файлу"
|
||
|
||
#: lazarusidestrconsts:dlgscrollpastendline
|
||
msgid "Scroll past end of line"
|
||
msgstr "Прокрутити до кінця рядка"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr "Прокрутити вправо на один символ"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr "Прокрутити вверх на один рядок"
|
||
|
||
#: lazarusidestrconsts:lissearchfor
|
||
msgid "Search For "
|
||
msgstr "Шукати "
|
||
|
||
#: lazarusidestrconsts:lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr "Результати пошуку"
|
||
|
||
#: lazarusidestrconsts:lissearchagain
|
||
msgid "Search again"
|
||
msgstr "Шукати знову"
|
||
|
||
#: lazarusidestrconsts:lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr "Шукати також і в коментарях"
|
||
|
||
#: lazarusidestrconsts:lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
|
||
msgid "Search or Filter Phrases In List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr "Шляхи пошуку:"
|
||
|
||
#: lazarusidestrconsts:lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr "Рядок пошуку '%s' не знайдено!"
|
||
|
||
#: lazarusidestrconsts:dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr "Пошук перервано користувачем."
|
||
|
||
#: lazarusidestrconsts:lisssearchtext
|
||
msgid "Search text"
|
||
msgstr "Шукати текст"
|
||
|
||
#: lazarusidestrconsts:lisfrisearchwhere
|
||
msgid "Search where"
|
||
msgstr "Шукати де"
|
||
|
||
#: lazarusidestrconsts:lisssearching
|
||
msgid "Searching"
|
||
msgstr "Пошук"
|
||
|
||
#: lazarusidestrconsts:dlgsearchcaption
|
||
msgid "Searching..."
|
||
msgstr "Пошук..."
|
||
|
||
#: lazarusidestrconsts:lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr "Шукаю: %s"
|
||
|
||
#: lazarusidestrconsts:liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr "Дивись також"
|
||
|
||
#: lazarusidestrconsts:lisseemessages
|
||
msgid "See messages."
|
||
msgstr "Дивись повідомлення."
|
||
|
||
#: lazarusidestrconsts:srkmecselleft
|
||
msgid "SelLeft"
|
||
msgstr "Виділити зліва"
|
||
|
||
#: lazarusidestrconsts:srkmecselright
|
||
msgid "SelRight"
|
||
msgstr "Виділити справа"
|
||
|
||
#: lazarusidestrconsts:lismenuselect
|
||
msgid "Select"
|
||
msgstr "Виділити"
|
||
|
||
#: lazarusidestrconsts:srkmecselectall
|
||
msgid "Select All"
|
||
msgstr "Виділити всі"
|
||
|
||
#: lazarusidestrconsts:lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr "Вибрати Код Макросу"
|
||
|
||
#: lazarusidestrconsts:lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr "Виберіть файли форм Delphi (*.dfm)"
|
||
|
||
#: lazarusidestrconsts:srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr "Виділити вниз"
|
||
|
||
#: lazarusidestrconsts:srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr "Виділити перехід за коорд."
|
||
|
||
#: lazarusidestrconsts:srkmecsellineend
|
||
msgid "Select Line End"
|
||
msgstr "Виділити кінць рядка"
|
||
|
||
#: lazarusidestrconsts:srkmecsellinestart
|
||
msgid "Select Line Start"
|
||
msgstr "Виділити початок рядка"
|
||
|
||
#: lazarusidestrconsts:lismenueditorselectmenu
|
||
msgid "Select Menu:"
|
||
msgstr "Вибрати меню:"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagebottom
|
||
msgid "Select Page Bottom"
|
||
msgstr "Виділити низ сторінки"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr "Виділити сторінку знизу"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr "Виділити сторінку зліва"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr "Виділити сторінку справа"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagetop
|
||
msgid "Select Page Top"
|
||
msgstr "Виділити верх сторінки"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr "Виділити сторінку зверху"
|
||
|
||
#: lazarusidestrconsts:lismenueditorselecttemplate
|
||
msgid "Select Template:"
|
||
msgstr "Вибрати шаблон:"
|
||
|
||
#: lazarusidestrconsts:srkmecselup
|
||
msgid "Select Up"
|
||
msgstr "Виділити вверх"
|
||
|
||
#: lazarusidestrconsts:srkmecselwordleft
|
||
msgid "Select Word Left"
|
||
msgstr "Виділити слово зліва"
|
||
|
||
#: lazarusidestrconsts:srkmecselwordright
|
||
msgid "Select Word Right"
|
||
msgstr "Виділити слово справа"
|
||
|
||
#: lazarusidestrconsts:lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr "Шукати елемент довідки:"
|
||
|
||
#: lazarusidestrconsts:lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "Виберіть елемент"
|
||
|
||
#: lazarusidestrconsts:lisnpselectaprojecttype
|
||
msgid "Select a project type"
|
||
msgstr "Виберіть тип проекту"
|
||
|
||
#: lazarusidestrconsts:lismenuselectall
|
||
msgid "Select all"
|
||
msgstr "Виділити всі"
|
||
|
||
#: lazarusidestrconsts:lismenuselectcodeblock
|
||
msgid "Select code block"
|
||
msgstr "Виділити блок коду"
|
||
|
||
#: lazarusidestrconsts:lispatheditselectdirectory
|
||
msgid "Select directory"
|
||
msgstr "Вибрати теку"
|
||
|
||
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
|
||
msgid "Select grand childs"
|
||
msgstr "Виділити головних нащадків"
|
||
|
||
#: lazarusidestrconsts:lismenuselectline
|
||
msgid "Select line"
|
||
msgstr "Виділити рядок"
|
||
|
||
#: lazarusidestrconsts:liskmselectlineend
|
||
msgid "Select line end"
|
||
msgstr "Виділити до кінця стрічки"
|
||
|
||
#: lazarusidestrconsts:liskmselectlinestart
|
||
msgid "Select line start"
|
||
msgstr "Виділити до початку стрічки"
|
||
|
||
#: lazarusidestrconsts:lissamselectnone
|
||
msgid "Select none"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmselectpagebottom
|
||
msgid "Select page bottom"
|
||
msgstr "Виділити до кінця сторінки"
|
||
|
||
#: lazarusidestrconsts:liskmselectpagetop
|
||
msgid "Select page top"
|
||
msgstr "Виділити до початку стрінки"
|
||
|
||
#: lazarusidestrconsts:lismenuselectparagraph
|
||
msgid "Select paragraph"
|
||
msgstr "Виділити абзац"
|
||
|
||
#: lazarusidestrconsts:lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr "Виділити компонент-предок"
|
||
|
||
#: lazarusidestrconsts:lisselectfile
|
||
msgid "Select the file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr "Виділити до самого початку"
|
||
|
||
#: lazarusidestrconsts:srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr "Виділити до самого кінця"
|
||
|
||
#: lazarusidestrconsts:lismenuselecttobrace
|
||
msgid "Select to brace"
|
||
msgstr "Виділити до дужки"
|
||
|
||
#: lazarusidestrconsts:lismenuselectword
|
||
msgid "Select word"
|
||
msgstr "Виділити слово"
|
||
|
||
#: lazarusidestrconsts:liskmselectwordleft
|
||
msgid "Select word left"
|
||
msgstr "Виділити слово зліва"
|
||
|
||
#: lazarusidestrconsts:liskmselectwordright
|
||
msgid "Select word right"
|
||
msgstr "Виділити слово справа"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "Виділити елемент:"
|
||
|
||
#: lazarusidestrconsts:lispckexplisrequiredby
|
||
msgid "Selected package is required by:"
|
||
msgstr "Вибраний пакунок потрібен для:"
|
||
|
||
#: lazarusidestrconsts:dlgruberbandselectioncolor
|
||
msgid "Selection"
|
||
msgstr "Виділення"
|
||
|
||
#: lazarusidestrconsts:lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr "Вибір перевищує рядкову константу"
|
||
|
||
#: lazarusidestrconsts:lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr "Інструмент вибору"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr "Крапка з комою"
|
||
|
||
#: lazarusidestrconsts:dlgposavesession
|
||
msgid "Session"
|
||
msgstr "Сесія"
|
||
|
||
#: lazarusidestrconsts:srkmecsetmarker
|
||
msgid "Set Marker %d"
|
||
msgstr "Встановити позначку %d"
|
||
|
||
#: lazarusidestrconsts:uemsetfreebookmark
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Встановити вільну Закладку"
|
||
|
||
#: lazarusidestrconsts:lismenusetfreebookmark
|
||
msgid "Set a free bookmark"
|
||
msgstr "Встановити вільну закладку"
|
||
|
||
#: lazarusidestrconsts:dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr "Встановити всі елементи за замовчуванням"
|
||
|
||
#: lazarusidestrconsts:dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr "Встановити елемент за замовчуванням"
|
||
|
||
#: lazarusidestrconsts:liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr "Встановити Закладку на дереві"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker0
|
||
msgid "Set marker 0"
|
||
msgstr "Встановити маркер 0"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker1
|
||
msgid "Set marker 1"
|
||
msgstr "Встановити маркер 1"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker2
|
||
msgid "Set marker 2"
|
||
msgstr "Встановити маркер 2"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker3
|
||
msgid "Set marker 3"
|
||
msgstr "Встановити маркер 3"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker4
|
||
msgid "Set marker 4"
|
||
msgstr "Встановити маркер 4"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker5
|
||
msgid "Set marker 5"
|
||
msgstr "Встановити маркер 5"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker6
|
||
msgid "Set marker 6"
|
||
msgstr "Встановити маркер 6"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker7
|
||
msgid "Set marker 7"
|
||
msgstr "Встановити маркер 7"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker8
|
||
msgid "Set marker 8"
|
||
msgstr "Встановити маркер 8"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker9
|
||
msgid "Set marker 9"
|
||
msgstr "Встановити маркер 9"
|
||
|
||
#: lazarusidestrconsts:dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr "Встановити змінну властивості"
|
||
|
||
#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr "Встановити точку зупину за будь-яких обставин"
|
||
|
||
#: lazarusidestrconsts:srvk_shift
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts:srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr "Короткий"
|
||
|
||
#: lazarusidestrconsts:liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr "Скоротити або розширити назву файла"
|
||
|
||
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
||
msgstr "Чи треба змінити назву файла на нижн. рег. в %s%s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisshow
|
||
msgid "Show"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pshowall
|
||
msgid "Show All"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts:liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr "Значення CodeTools"
|
||
|
||
#: lazarusidestrconsts:dlgcoshowerr
|
||
msgid "Show Errors"
|
||
msgstr "Показувати помилки"
|
||
|
||
#: lazarusidestrconsts:dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr "Показувати лінійки"
|
||
|
||
#: lazarusidestrconsts:dlgshowhint
|
||
msgid "Show Hints"
|
||
msgstr "Показувати довідки"
|
||
|
||
#: lazarusidestrconsts:dlghintsparametersendernotused
|
||
msgid "Show Hints for parameter \"Sender\" not used"
|
||
msgstr "Показ Порад до параметру \"Sender\" не використаний"
|
||
|
||
#: lazarusidestrconsts:dlghintsunused
|
||
msgid "Show Hints for unused units in main source"
|
||
msgstr "Довідки для непотрібних модулів в головному коді"
|
||
|
||
#: lazarusidestrconsts:uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr "Показувати нумерацію рядків"
|
||
|
||
#: lazarusidestrconsts:dlgshownotes
|
||
msgid "Show Notes"
|
||
msgstr "Показувати зауваження"
|
||
|
||
#: lazarusidestrconsts:dlgcoshowoptions
|
||
msgid "Show Options"
|
||
msgstr "Показувати Параметри"
|
||
|
||
#: lazarusidestrconsts:fdmshowoptions
|
||
msgid "Show Options for form editing"
|
||
msgstr "Показувати параметри для редагування форм"
|
||
|
||
#: lazarusidestrconsts:liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowwarnings
|
||
msgid "Show Warnings"
|
||
msgstr "Показувати попередження"
|
||
|
||
#: lazarusidestrconsts:srkmecshowabstractmethods
|
||
msgid "Show abstract methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pshowall
|
||
msgid "Show all"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts:liscoshowallmessages
|
||
msgid "Show all messages"
|
||
msgstr "Показувати всі повідомлення"
|
||
|
||
#: lazarusidestrconsts:dlgshowprocserror
|
||
msgid "Show all procs on error"
|
||
msgstr "Всі процеси при помилках"
|
||
|
||
#: lazarusidestrconsts:dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr "Показувати ширину бордюру"
|
||
|
||
#: lazarusidestrconsts:dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr "Кнопки закриття в записнику"
|
||
|
||
#: lazarusidestrconsts:srkmecshowcodecontext
|
||
msgid "Show code context"
|
||
msgstr "Контекст коду"
|
||
|
||
#: lazarusidestrconsts:dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr "Показувати компільовані процедури"
|
||
|
||
#: lazarusidestrconsts:dlgshowcompileroptions
|
||
msgid "Show compiler options"
|
||
msgstr "Параметри компілятора"
|
||
|
||
#: lazarusidestrconsts:dlgshowcaps
|
||
msgid "Show component captions"
|
||
msgstr "Назви компонентів"
|
||
|
||
#: lazarusidestrconsts:dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "Показувати умови"
|
||
|
||
#: lazarusidestrconsts:dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr "Показувати налагоджувальну інф-ю"
|
||
|
||
#: lazarusidestrconsts:dlgshowdefinedmacros
|
||
msgid "Show defined macros"
|
||
msgstr "Показувати означені макроси"
|
||
|
||
#: lazarusidestrconsts:dlgshowedrhints
|
||
msgid "Show editor hints"
|
||
msgstr "Довідки редактора"
|
||
|
||
#: lazarusidestrconsts:liscodehelpshowemptymethods
|
||
msgid "Show empty methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts:dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr "Показ. викон. інф. (для Win32)"
|
||
|
||
#: lazarusidestrconsts:dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr "Показувати загальні відомості"
|
||
|
||
#: lazarusidestrconsts:lispldshowgloballinks
|
||
msgid "Show global links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr "Показувати сітку"
|
||
|
||
#: lazarusidestrconsts:dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr "Показувати додаткові довідки"
|
||
|
||
#: lazarusidestrconsts:lisshowhintsinobjectinspector
|
||
msgid "Show hints in Object Inspector"
|
||
msgstr "Показувати довідки в Інспекторі об'єкту"
|
||
|
||
#: lazarusidestrconsts:lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr "Показувати змінні"
|
||
|
||
#: lazarusidestrconsts:dlgshowlinenumbers
|
||
msgid "Show line numbers"
|
||
msgstr "Показувати номери рядків"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr "Показувати повідомлення зверху"
|
||
|
||
#: lazarusidestrconsts:dlgshownothing
|
||
msgid "Show nothing (only errors)"
|
||
msgstr "Показувати тільки помилки"
|
||
|
||
#: lazarusidestrconsts:lisshowoldtaborder
|
||
msgid "Show old tab order"
|
||
msgstr "Показувати попередній порядок tab"
|
||
|
||
#: lazarusidestrconsts:lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr "Показувати пакунки"
|
||
|
||
#: lazarusidestrconsts:dlgshowscrollhint
|
||
msgid "Show scroll hint"
|
||
msgstr "Показувати пораду з прокрут."
|
||
|
||
#: lazarusidestrconsts:dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr "Показувати підсумкове"
|
||
|
||
#: lazarusidestrconsts:dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr "Показувати випробувальні файли"
|
||
|
||
#: lazarusidestrconsts:lisshowunits
|
||
msgid "Show units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts:dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr "Показувати використані файли"
|
||
|
||
#: lazarusidestrconsts:lispldshowuserlinks
|
||
msgid "Show user links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissibling
|
||
msgid "Sibling"
|
||
msgstr "Рівень"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr "Сигнали"
|
||
|
||
#: lazarusidestrconsts:lissimplesyntax
|
||
msgid "Simple Syntax"
|
||
msgstr "Простий синтаксис"
|
||
|
||
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr "Простий синтаксис (напр., * замість .*)"
|
||
|
||
#: lazarusidestrconsts:fdmsizeword
|
||
msgid "Size"
|
||
msgstr "Розмір"
|
||
|
||
#: lazarusidestrconsts:lisuidsize
|
||
msgid "Size:"
|
||
msgstr "Розмір"
|
||
|
||
#: lazarusidestrconsts:lisccoskip
|
||
msgid "Skip"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoskipcallingcompiler
|
||
msgid "Skip calling Compiler"
|
||
msgstr "Пропустити виклик компілятора"
|
||
|
||
#: lazarusidestrconsts:lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr "Пропустити файл і продовжити завантаження"
|
||
|
||
#: lazarusidestrconsts:lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr "Пропустити завантаження останнього проекту"
|
||
|
||
#: lazarusidestrconsts:lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcosmaller
|
||
msgid "Smaller Code"
|
||
msgstr "Менший код"
|
||
|
||
#: lazarusidestrconsts:dlgcosmartlinkable
|
||
msgid "Smart Linkable"
|
||
msgstr "Розумна комп."
|
||
|
||
#: lazarusidestrconsts:dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr "Розумна табуляція"
|
||
|
||
#: lazarusidestrconsts:dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr "Защіпнутись за лінійками"
|
||
|
||
#: lazarusidestrconsts:dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr "Вирівнювати по сітці"
|
||
|
||
#: lazarusidestrconsts:srvk_snapshot
|
||
msgid "Snapshot"
|
||
msgstr "Знімок"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr "Деякі файли змінені на диску:"
|
||
|
||
#: lazarusidestrconsts:lissorrynotimplementedyet
|
||
msgid "Sorry, not implemented yet"
|
||
msgstr "Вибачте, поки не реалізовано"
|
||
|
||
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr "Вибачте, цей тип ще не реалізовано"
|
||
|
||
#: lazarusidestrconsts:lispesortfiles
|
||
msgid "Sort files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr "Сортування вибраного"
|
||
|
||
#: lazarusidestrconsts:lismenusortselection
|
||
msgid "Sort selection ..."
|
||
msgstr "Сортування вибраного ..."
|
||
|
||
#: lazarusidestrconsts:lisceomodesource
|
||
msgid "Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewsourceeditor
|
||
msgid "Source Editor"
|
||
msgstr "Редактор тексту"
|
||
|
||
#: lazarusidestrconsts:srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr "Команди блокноту зауважень до тексту програми"
|
||
|
||
#: lazarusidestrconsts:lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr "Код і призначення однакові:%s%s"
|
||
|
||
#: lazarusidestrconsts:lismenuaddbpsource
|
||
msgid "Source breakpoint"
|
||
msgstr "Точка зупину в коді"
|
||
|
||
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
|
||
msgid "Source directory %s%s%s does not exist."
|
||
msgstr "Теки кодів %s%s%s не існує."
|
||
|
||
#: lazarusidestrconsts:lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr "Код змінено"
|
||
|
||
#: lazarusidestrconsts:lissourceofpagehaschangedsave
|
||
msgid "Source of page %s%s%s has changed. Save?"
|
||
msgstr "Код сторінки %s%s%s змінено. Зберегти?"
|
||
|
||
#: lazarusidestrconsts:lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr "Шляхи до програмних файлів"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr "Переглядання коду"
|
||
|
||
#: lazarusidestrconsts:dlgspacenotcosmos
|
||
msgid "Space"
|
||
msgstr "Пробіл"
|
||
|
||
#: lazarusidestrconsts:lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr "Вирівняти по ширині"
|
||
|
||
#: lazarusidestrconsts:srvk_space
|
||
msgid "Space key"
|
||
msgstr "Кнопка пробіл"
|
||
|
||
#: lazarusidestrconsts:rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr "Іспанська"
|
||
|
||
#: lazarusidestrconsts:lisuidsrc
|
||
msgid "Src"
|
||
msgstr "Джл"
|
||
|
||
#: lazarusidestrconsts:dlgcostack
|
||
msgid "Stack"
|
||
msgstr "Стек"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr "Стандартне меню Правка"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr "Стандартне меню Файл"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr "Стандартне меню Довідка"
|
||
|
||
#: lazarusidestrconsts:lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr "Розпочати з нового проекту"
|
||
|
||
#: lazarusidestrconsts:lisstarter
|
||
msgid "Starter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipstate
|
||
msgid "State"
|
||
msgstr "Стан"
|
||
|
||
#: lazarusidestrconsts:dlgstatickeyword
|
||
msgid "Static Keyword in Objects"
|
||
msgstr "Ключове слово Static в об'єктах"
|
||
|
||
#: lazarusidestrconsts:lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr "На крок із входом"
|
||
|
||
#: lazarusidestrconsts:lishintstepover
|
||
msgid "Step Over"
|
||
msgstr "На крок в обхід"
|
||
|
||
#: lazarusidestrconsts:lismenustepinto
|
||
msgid "Step into"
|
||
msgstr "На крок із входом"
|
||
|
||
#: lazarusidestrconsts:lismenustepover
|
||
msgid "Step over"
|
||
msgstr "На крок в обхід"
|
||
|
||
#: lazarusidestrconsts:lismenustop
|
||
msgid "Stop"
|
||
msgstr "Завершити"
|
||
|
||
#: lazarusidestrconsts:lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr "Завершити налагодження?"
|
||
|
||
#: lazarusidestrconsts:dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr "Завершити після купи помилок"
|
||
|
||
#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr "Завершити налагоджування і перебудувати прект?"
|
||
|
||
#: lazarusidestrconsts:lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr "Завершити налагоджування?"
|
||
|
||
#: lazarusidestrconsts:liskmstopprogram
|
||
msgid "Stop program"
|
||
msgstr "Завершити програму"
|
||
|
||
#: lazarusidestrconsts:lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr "Завершити налагоджування?"
|
||
|
||
#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
|
||
msgid "Store dependency filename"
|
||
msgstr "Зберегти залежність файлу"
|
||
|
||
#: lazarusidestrconsts:dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr "Префікс STORED"
|
||
|
||
#: lazarusidestrconsts:lisstreamerror
|
||
msgid "Stream Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr "Помилка потоків"
|
||
|
||
#: lazarusidestrconsts:lisstring
|
||
msgid "String"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr "Рядкова конст."
|
||
|
||
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr "Рядкова константа в коді"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr "Рядки з тим же значенням:"
|
||
|
||
#: lazarusidestrconsts:dlgcostrip
|
||
msgid "Strip Symbols From Executable"
|
||
msgstr "Вирізати символи з виконуваного"
|
||
|
||
#: lazarusidestrconsts:lisstyle
|
||
msgid "Style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr "Підпроцедура"
|
||
|
||
#: lazarusidestrconsts:lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr "Підпроцедура того ж рівня"
|
||
|
||
#: lazarusidestrconsts:dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr "Підтека"
|
||
|
||
#: lazarusidestrconsts:dlgsubpropkcolor
|
||
msgid "Subpropertes"
|
||
msgstr "Підвластивості"
|
||
|
||
#: lazarusidestrconsts:lissuccess
|
||
msgid "Success"
|
||
msgstr "Успішно"
|
||
|
||
#: lazarusidestrconsts:lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr "Перемкнути шляхи"
|
||
|
||
#: lazarusidestrconsts:srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr "Перемкнути модуль/форму"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr "Символ"
|
||
|
||
#: lazarusidestrconsts:dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr "Символ позаду (.~pp)"
|
||
|
||
#: lazarusidestrconsts:dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr "Символ попереду (.~pp)"
|
||
|
||
#: lazarusidestrconsts:lissynedit
|
||
msgid "SynEdit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
|
||
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
||
msgstr "SynEdit - компонент редактора, використано Lazarus. http://sourceforge.net/projects/synedit/"
|
||
|
||
#: lazarusidestrconsts:srkmecsyntaxcheck
|
||
msgid "Syntax check"
|
||
msgstr "Перевірка синтаксису"
|
||
|
||
#: lazarusidestrconsts:dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr "Параметри синтаксису"
|
||
|
||
#: lazarusidestrconsts:dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr "Системні змінні"
|
||
|
||
#: lazarusidestrconsts:dlgbp7cptb
|
||
msgid "TP/BP 7.0 Compatible"
|
||
msgstr "Сумісність з TP/BP 7.0"
|
||
|
||
#: lazarusidestrconsts:srvk_tab
|
||
msgid "Tab"
|
||
msgstr "ТАБ"
|
||
|
||
#: lazarusidestrconsts:listaborderof
|
||
msgid "Tab Order of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr "ТАБ зсуває блоки вправо"
|
||
|
||
#: lazarusidestrconsts:fdmtaborder
|
||
msgid "Tab order..."
|
||
msgstr "Чергування ..."
|
||
|
||
#: lazarusidestrconsts:liseotabwidths
|
||
msgid "Tab widths"
|
||
msgstr "Ширина табулятора"
|
||
|
||
#: lazarusidestrconsts:dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr "ТАБ в пробіли"
|
||
|
||
#: lazarusidestrconsts:lismenutabstospacesselection
|
||
msgid "Tabs to spaces in selection"
|
||
msgstr "ТАБ зробити пробілами в виділеному"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqboapplcltarget
|
||
msgid "Target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr "Для ЦП:"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr "Для ЦП"
|
||
|
||
#: lazarusidestrconsts:listargetos
|
||
msgid "Target OS"
|
||
msgstr "Для якої ОС"
|
||
|
||
#: lazarusidestrconsts:liscotargetosspecificoptions
|
||
msgid "Target OS specific options"
|
||
msgstr "Специфічні параметри ОС"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr "Для ОС:"
|
||
|
||
#: lazarusidestrconsts:dlgtargetplatform
|
||
msgid "Target Platform:"
|
||
msgstr "Платформа"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpotargetfilename
|
||
msgid "Target file name:"
|
||
msgstr "Назва виконуваного файлу:"
|
||
|
||
#: lazarusidestrconsts:listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr "Назва цільового файлу з параметрами"
|
||
|
||
#: lazarusidestrconsts:listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr "Назва цільового файлу проекту"
|
||
|
||
#: lazarusidestrconsts:dlgtargetproc
|
||
msgid "Target i386"
|
||
msgstr "Платформа i386"
|
||
|
||
#: lazarusidestrconsts:lismenueditortemplatepreview
|
||
msgid "Template Preview"
|
||
msgstr "Переглядання шаблону"
|
||
|
||
#: lazarusidestrconsts:dlgtplfname
|
||
msgid "Template file name"
|
||
msgstr "Назва файлу шаблону"
|
||
|
||
#: lazarusidestrconsts:lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr "Шаблони"
|
||
|
||
#: lazarusidestrconsts:dlgccotest
|
||
msgid "Test"
|
||
msgstr "Тест"
|
||
|
||
#: lazarusidestrconsts:listestdirectory
|
||
msgid "Test directory"
|
||
msgstr "Тека проб"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr "Теки проб \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
|
||
msgid "Test: Checking fpc configs ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestmissingppu
|
||
msgid "Test: Checking missing fpc ppu ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypetext
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts:dlgtextattributes
|
||
msgid "Text attributes"
|
||
msgstr "Параметри тексту"
|
||
|
||
#: lazarusidestrconsts:srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr "Команди редагування тексту"
|
||
|
||
#: lazarusidestrconsts:srkmcatmarker
|
||
msgid "Text marker commands"
|
||
msgstr "Команди маркера тексту"
|
||
|
||
#: lazarusidestrconsts:srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr "Команди пошуку і заміни тексту"
|
||
|
||
#: lazarusidestrconsts:srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr "Команди виділення тексту"
|
||
|
||
#: lazarusidestrconsts:lisfindfiletexttofind
|
||
msgid "Text to find:"
|
||
msgstr "Шукати текст:"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgtext1
|
||
msgid "Text1"
|
||
msgstr "Текст1"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgtext2
|
||
msgid "Text2"
|
||
msgstr "Текст2"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr "Головна тека %s,%sде Borland встановив %s коди,%sякі використовують цей %s проект.%sНаприклад: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Головна тека %s, %sде Borland встановив всі коди %s,використані проектом %s. %sНаприклад: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr "Головна тека %s,%sде Borland встановив всі %s коди.%sНаприклад: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Головна тека %s, %sде Borland встановив всі коди %s. %sНаприклад: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr "Тека %s проекту,%sщо вміщує файли .dpr, dpk."
|
||
|
||
#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
||
msgstr "FCL - бібліотека компонентів FreePascal забезпечує базові класи для об'єктного паскаля."
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
|
||
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr "Тека текстів Free Pascal SVN."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
||
msgstr "Тека текстів Free Pascal SVN. Не обов'язково. Це покращить пошук декларацій при налагоджуванні."
|
||
|
||
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
||
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
||
msgstr "Компілятор FreePascal (назва файлу: %s) не знайдено.%sВам рекомендується встановити fpc"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr "Тека проекту FreePascal."
|
||
|
||
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
||
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
||
msgstr "Теки кодів FPC не знайдено.%sОкремі дії з кодом не будуть працювати.%sРекомендується встановити її і встановити шлях%sОточення -> Оточення Параматри -> Файли"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
||
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
||
msgstr "LCL - Бібліотека компонентів Lazarus вміщує всі основні компоненти для редагування форм."
|
||
|
||
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
||
msgstr "LFM-файл (файл форми Lazarus) вміщує некоректні властивості. Це означає, наприклад, що він вміщує деякі властивості/класи, яких немає в поточній версії LCL. Як правило треба прибрати ці властивості з lfm і (якщо треба) виправити код паскаля вручну."
|
||
|
||
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
||
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "Теки Lazarus не знайдено.%sВи не зможете створювати додатки LCL.Перевірте Оточення -> Параметри Оточення -> Файли"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
|
||
msgid "The Lazarus main directory."
|
||
msgstr "Головна тека Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "Максимальна версія %s%s%s некоректна.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "Максимальна версія менше за мінімальну."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "Мінімальна версія %s%s%s є некоректною.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
|
||
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
||
msgstr "Тестової теки не знайдено:%s%s%s%s%s (див. параметри оточення)"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Назва типа предка %s%s%s збігається з%sмодулем %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
||
msgstr "Тип предка %s%s%s є неправильним ідентифікатором паскаля"
|
||
|
||
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
||
msgstr "Клас %s%s%s не є елементом управління (TControl) і його не можна вставити на що-небудь інше.%sНе можу вставити."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
||
msgstr "Назва класу %s%s%s і його предка %s%s%s збігаються."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
||
msgstr "Назва класу %s%s%s вже є в%sПакунок %s%sФайл: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Назва класу %s%s%s збігається з %s назвою модуля %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
|
||
msgid "The class name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Назва класу %s%s%s є неприпустимим ідентифікатором паскаля"
|
||
|
||
#: lazarusidestrconsts:listhecodetoolsfoundanerror
|
||
msgid "The codetools found an error:%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecommandafterisnotexecutable
|
||
msgid "The command after %s%s%s is not executable."
|
||
msgstr "Команда після %s%s%s не є виконуваною."
|
||
|
||
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s%s%s%s"
|
||
msgstr "Команда після опублікування є некоректною:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisccoppunotfounddetailed
|
||
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccocompilernotanexe
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
|
||
msgid "The compiler file \"%s\" is not an executable."
|
||
msgstr "Файл компілятора \"%s\" не є виконуваним."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr "Файл компілятора для пакунку %s не є виконуваним:%s%s"
|
||
|
||
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
||
msgstr "Редактор компонента для класу %s%s%sщо пов'язаний зі словом #%s %s%s%sвикликав помилку:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "Поточна тека кодів FPC %s%s%s%sвиглядає неправильною.%sПеревірте Оточення -> Параметри Оточення -> Файли"
|
||
|
||
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "Поточна тека кодів FPC %s%s%s%sвиглядає неправильною.%sВиберіть Гаразд щоб повернути використаний за замовчуванням %s%s%s,%s або перевірте Оточення -> Параметри Оточення -> Файли"
|
||
|
||
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез нього Ви не зможете створювати додатки LCL.%sПеревірте Оточення -> Параметри Оточення -> Файли"
|
||
|
||
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез нього Ви не зможете створювати додатки LCL.%sВиберіть ОК для використовування теки за замовчуванням %s%s%s,%s або перевірте Оточення -> Параматри Оточення -> Files"
|
||
|
||
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "%s%s%s.%sІнакше перевірте Оточення->Параметри оточення->Файли"
|
||
|
||
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "Поточна назва компілятора %s%s%s%s не є виконуваним файлом.%sПеревірте Environment -> Environment Options -> Files"
|
||
|
||
#: lazarusidestrconsts:lisuethecurre
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
|
||
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
||
msgstr "Поточний шлях модуля для файлу %s%s%s%s - %s%s%s%s.%s%sШлях до модулів LCL %s%s%s відсутній.%s%sДовідка для новачків:%sСтворіть програму lazarus і розмістіть файл в каталозі проекту."
|
||
|
||
#: lazarusidestrconsts:lisccodatesdiffer
|
||
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
||
msgstr "Налагоджувач %s%s%s%sdoes не існує або не є виконуваним.%s%sДив. Оточення -> Параметри Налагоджувача"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr "Файл налагоджувача \"%s\" не є виконуваним."
|
||
|
||
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
|
||
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
||
msgstr "Залежності %s%s%s не знайдено.%sВиберіть існуючий пакунок."
|
||
|
||
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s%s%s%s does not exist."
|
||
msgstr "Теки призначення%s%s%s%s не існує."
|
||
|
||
#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
||
msgstr "Тека %s%s%s більше не потрібна в шляху до модулів.%sПрибрати її?"
|
||
|
||
#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
||
msgstr "Теки %s%s%s немає в шляху до модулів.%sДодати її?"
|
||
|
||
#: lazarusidestrconsts:dlgthedirectory
|
||
msgid "The directory \""
|
||
msgstr "Тека \""
|
||
|
||
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
||
msgstr "Схоже, що файл %s є програмним в існуючому Проекті"
|
||
|
||
#: lazarusidestrconsts:listhefile
|
||
msgid "The file %s%s%s"
|
||
msgstr "Файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhefileisasymlinkopeninstead
|
||
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s is already in the package."
|
||
msgstr "Файл %s%s%s вже в пакунку."
|
||
|
||
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
|
||
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
||
msgstr "Файл %s%s%s не є проектом Delphi (.dpr)"
|
||
|
||
#: lazarusidestrconsts:listhefileisnotadelphiunit
|
||
msgid "The file %s%s%s is not a Delphi unit."
|
||
msgstr "Файл %s%s%s не є модулем Delphi."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
|
||
msgid "The file %s%s%s is not a lazarus package."
|
||
msgstr "Файл %s%s%s не є пакунком Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr "Файл %s%s%s є частиною поточного проекту.%sНе краща ідея ділити файли між проектами і пакунками."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "Файл %s%s%s%sвже в пакунку %s."
|
||
|
||
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
||
msgstr "Файл %s%s%s%sзараз не знаходиться в списку шляхів модулів пакунку.%s%sДодати його туди?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
|
||
msgid "The file %s%s%s%sof package %s is missing."
|
||
msgstr "Файл %s%s%s%sпакунку %s пропущений."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
|
||
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
||
msgstr "Файл %s%s%s%sпакунку %s треба спочатку зберегти."
|
||
|
||
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
|
||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr "Файл %s%s%s%sсхожий на програму. Закрити поточний проект і створити новий проект lazarus для цієї програми?%s\"Ні\" відкриє файл як звичайний код."
|
||
|
||
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
||
msgstr "Файл %s%s%s%sзнайдено в одній з тек кодів пакунку %s, і він схожий на відкомпільований модуль. Такі модулі мають бути в спеціальному каталозі пакунку, інакше інші пакунки не можуть правильно використовувати пакунок.%s%sВидалити такі файли?"
|
||
|
||
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
||
msgstr "Файлу %s%s%s%sне знайдено.%sВи бажаєте пошукати його самостійно?%s"
|
||
|
||
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr "Файл %s%s%s%sне знайдено.%sПропуск продовжить завантаження проекту,%sПереривання зупинить завантаження."
|
||
|
||
#: lazarusidestrconsts:uefilerotext1
|
||
msgid "The file \""
|
||
msgstr "Файл \""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr "Назва файлу %s%s%s є частиною поточного проекту.%sПроекти і пакунки не мають ділити файли."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
||
msgstr "Назва файлу %s%s%sвикористовується%sпакунком %s%s%s%sв файлі %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
||
msgstr "Назва файлу %s%s%s не відповідає назві пакунку %s%s%s в файлі.%sЗамінити назву пакунку на %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr "Файл %s%s%s виглядає як подвійний, тому що пакунок не має теки за замовчуванням.%sВкажіть будь ласка назву файлу з повним шляхом."
|
||
|
||
#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
||
msgstr "Наступні методи, що використовуються %s відсутні в програмному файлі%s%s%s%s%s%sПрибрати завислі посилання?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr "Наступний пакунок не вдалось завантажити"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr "Наступні пакунки не вдалось завантажити:"
|
||
|
||
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
|
||
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application %s%s%s is not executable."
|
||
msgstr "Головна програма %s%s%s не є виконуваним файлом."
|
||
|
||
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
||
msgstr "Виконувана програма %s%s%s%sне існує або не є виконуваною.%s%sДивіться -> Запуск -> Параметри запуску -> Локальні"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
|
||
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
||
msgstr "Тека lazarus \"%s\" виглядає некоректною. Як правило вона вміщує теки lcl, debugger, designer, components, ... ."
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
|
||
msgid "The make file \"%s\" is not an executable."
|
||
msgstr "Файл make \"%s\" не є виконуваним файлом."
|
||
|
||
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "Максимальна версія %s%s%s є неправильною версією пакунку.%s(гарний приклад 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "Мінімальна версія %s%s%s є неправильною версією пакунку.%s(гарний приклад 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
|
||
msgid "The name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Назва %s%s%s є неправильним ідентифікатором паскаля."
|
||
|
||
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
|
||
msgid "The name \"%s\" is not a valid pascal identifier."
|
||
msgstr "Слово \"%s\" є неправильним ідентифікатором мови паскаль."
|
||
|
||
#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
||
msgstr "Пакунок %s є пакунком тільки часу виконання.%sТакі пакунки не можуть бути встановлені в IDE."
|
||
|
||
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr "Пакунок %s тільки для читання."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr "Пакунок %s потребується для %s, який був позначеним для установки.%sДивись діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
|
||
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
||
msgstr "Пакунок %s має файл%s%s%s%s.%sЧи змінити назву файла в пакунку як правило?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
||
msgstr "Пакунок %s%s%s компілюється з помилками.%sВидалити його із встановочного списку?"
|
||
|
||
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
||
msgstr "Пакунок %s%s%s має мітку Автовстановлення.%sЦе означає, що він автоматично вмонтується в IDE. Встановлювані пакунки%sмають бути для розробки."
|
||
|
||
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr "Пакунок %s%s%s встановлено, але не знайдений правильний файл з пакунком (.lpk).%sБув створений зламаний холостий пакунок."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr "Пакунок %s%s%s відмічено для встановлення, але його не було знайдено.%sВидалити залежність із списку установки пакунків?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Пакунок %s%s%s помічено для встановлення.%sЗараз lazarus підтримує тільки статично пов'язані пакунки. Поточна установка потребує перепобудови і перезапуску lazarus.%s%sВи бажаєте перебудувати Lazarus зараз?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Пакунок %s%s%s відмічено.%sЗараз lazarus підтримує тільки статично пов'язані пакунки. Поточне видалення потребує перепобудови і перезапуску lazarus.%s%sВи бажаєте перебудувати Lazarus зараз?"
|
||
|
||
#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
||
msgstr "Назва пакунку %s%s%s в%s%s%s%s є неправильною назвою пакунку lazarus."
|
||
|
||
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
|
||
msgid "The package has already a dependency for the package %s%s%s."
|
||
msgstr "Пакунок вже має залежність від пакунку %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
||
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
||
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть існуючий пакунок."
|
||
|
||
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
|
||
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
||
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть існуючий пакунок."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть інший пакунок(напр., package1.lpk)."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
||
msgstr "Назва пакунку %s%s%s %sфайлу %s%s%s є некоректною."
|
||
|
||
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name %s%s%s is too long (max 100 chars)."
|
||
msgstr "Назва пакунку %s%s%s занадто довга (до 100 симв.)."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr "Шлях до компілятора проекту free pascal. Потрібно лише, якщо Ви встановлюєте нижче програму FPC SVN. Використовується для автостворювання макросів."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr "Шлях до компілятора FreePascal.%s Наприклад, %s/usr/bin%s -n%s або %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
|
||
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
||
msgstr "Програму %smake%s не знайдено.%sЦей інструмент потрібен, щоб Побудувати lazarus.%s"
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package %s%s%s."
|
||
msgstr "Проект вже залежить от пакунку %s%s%s."
|
||
|
||
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
||
msgstr "Файл відомостей проекту %s%s%s%sзбігається з головним кодом!"
|
||
|
||
#: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin
|
||
msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr "Проект треба зберегти для компіляції%sЯкщо Ви встановите теку проб в параметри оточення,%sВи можете створювати проекти і будувати їх одразу.%sЗберегти проект?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr "Проект вимагає пакунку %s%s%s.%sАле його не знайдено. Див. Проект -> Інспектор проекту."
|
||
|
||
#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
|
||
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
||
msgstr "Ресурс класу %s%s%s походить від %s%s%s. Можливо, що це відноситься ло TForm."
|
||
|
||
#: lazarusidestrconsts:lismakeresstrchooseanothername
|
||
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr "Рядок ресурсів %s%s%s вже існує. %sВиберіть іншу назву. %s Використовуйте Пропуск, щоб додати в будь-якому випадку."
|
||
|
||
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
|
||
msgid "The root component can not be deleted."
|
||
msgstr "Компоненту верхнього рівня не може бути видалено."
|
||
|
||
#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
|
||
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
||
msgstr "Модуль %s%s%s вже існує. Пропуск призведе до перейменування,%sВідміна скасує збереження цього файлу, а%sПерервати відмінить збереження взагалі."
|
||
|
||
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
|
||
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
|
||
msgstr "Модуль %s%s%s не в нижньому регістрі.%sКомпілятор FreePascal 1.0.x потребує назв в нижньому регістрі. Якщо Ви не використовуєте fpc 1.0.x для побудови цього модуля, можна ігнорувати це повідомлення.%s%sПерейменувати файл?"
|
||
|
||
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "Модуль вже називається %s%s%s. Ідентифікатори паскаля мають бути унікальними."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
||
msgstr "Назва модуля %s%s%s вже існує в проекті%sв файлі: %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
||
msgstr "Назва модуля %s%s%s вже існує в виділенні%sв файлі: %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name %s%s%s does not correspond to the filename."
|
||
msgstr "Назва модуля %s%s%s не відповідає назві файлу"
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Назва модуля %s%s%s є неприпустимим ідентифікатором паскаля."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
||
msgstr "Назва модуля збігається із зареєстрованим компонентом.%sЦе може призвести до непередбачуваних повідомлень про помилки."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
||
msgstr "Назва модулю %s%s%s%sі назва файлу %s%s%s різні."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
||
msgstr "Така назва модуля %s%s%s вже є в цьому пакунку:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname %s%s%s already exists in this package."
|
||
msgstr "Така назва модуля %s%s%s вже є в цьому пакунку."
|
||
|
||
#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr "Назва модуля не є правильним ідентифікатором pascal. "
|
||
|
||
#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgstr "Назва модуля використана графічною оболонкою при розширенні користувацьких виразів."
|
||
|
||
#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
|
||
msgid "There are more functions in the popupmenu"
|
||
msgstr "У спливаючому меню більше функцій"
|
||
|
||
#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr "В теці є і інші файли з такою самою назвою,%s, що відрізняється тільки регістром:%s%s%sВидалити їх?"
|
||
|
||
#: lazarusidestrconsts:lisccoseveralcompilers
|
||
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
||
msgstr "Існує два модуля з однаковими назвами:%s%s1. %s%s%s з %s%s2. %s%s%s з %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisccoppuolderthancompiler
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
||
msgstr "Існує модуль FPC з такою самою назвою, як і пакунок:%s%s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
||
msgstr "Існує модуль FPC з такою самою назвою, як:%s%s%s%s%s з %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
|
||
msgid "There is a circle in the required packages. See package graph."
|
||
msgstr "Виявлений цикл залежностей пакунків. Дивіться діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
||
msgstr "На диску є файл з такою самою назвою і схожим розширенням%sФайл: %s%sСхожий файл: %s%s%sВидалити інший файл?"
|
||
|
||
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr "Припускається максимум %s інструментів."
|
||
|
||
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
|
||
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
||
msgstr "В проекті є модуль з назвою %s%s%s.%sВиберіть іншу назву"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
||
msgstr "Існує модуль з такою самою назвою, як і пакунок: %s%s1. %s%s%s з %s%s2. %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name %s%s%s"
|
||
msgstr "Вже існує форма з назвою %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
|
||
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
||
msgstr "Вже завантажено пакунок%s%s%s %sз файлу %s%s%s.%sДив. Компоненти -> Діаграма пакунків.%sЗаміна неможлива."
|
||
|
||
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "Вже існує модуль, що називається %s%s%s. Ідентифікатори паскаля мають бути унікальними."
|
||
|
||
#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Вже є модуль з такою назвою. %sФайл: %s"
|
||
|
||
#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
|
||
msgid "There is already another component with the name %s%s%s."
|
||
msgstr "Вже є інший компонент з такою назвою %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
||
msgstr "Вже існує іншій пакунок з назвою %s%s%s.%sКонфліктуючий пакунок:%s%s%s%sФайл: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr "Посеред необхідних пакунків є не збережений. Див. діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
||
msgstr "Не вказаний Debugger.%sВстановлені точки зупину не будуть задіяні до тих пір поки не буде встановлений Debugger в меню опцій діалогу з debugger."
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr "Сталася помилка при запису вибраних компонентів %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr "Сталася помилка при перетворенні бінарного потоку вибраного компонента %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr "Сталася помилка при копіюванні потоку компонента в буфер:%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr "Цього файлу немає у всіх завантажених пакунках."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
||
msgid "This file was automatically created by Lazarus. Do not edit!"
|
||
msgstr "Цей файл було автоматично створено Lazarus. Не редагувати!"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr "Це віртуальний пакунок. В нього немає коду. Збережіть спочатку пакунок."
|
||
|
||
#: lazarusidestrconsts:lisresourcefilecomment
|
||
msgid "This is an automatically generated lazarus resource file"
|
||
msgstr "Це файл ресурсів, що було автоматично створено lazarus"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr "Це пакунок за замовчуванням. Використовується тільки для компонентів без пакунку. Такі компоненти є застарілими."
|
||
|
||
#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
||
msgstr "Це список контролів одного рівня для якого нижня сторона зафіксована. Залишити порожнім для батьківського."
|
||
|
||
#: lazarusidestrconsts:lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
||
msgstr "Це список контролів одного рівня для якого ліва сторона зафіксована. Залишити порожнім для батьківського."
|
||
|
||
#: lazarusidestrconsts:lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
||
msgstr "Це список контролів одного рівня для якого права сторона зафіксована. Залишити порожнім для батьківського."
|
||
|
||
#: lazarusidestrconsts:listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
||
msgstr "Це список контролів одного рівня для якого верхня сторона зафіксована. Залишити порожнім для батьківського."
|
||
|
||
#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr "Це виглядає як pascal файл.%sРекомендується використовувати назви файлів в нижньому регістрі для запобігання різних проблем на деякиих операційних системах і різних компіляторах.%sЗмінити на нижній регістр?"
|
||
|
||
#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr "Цей пакунок встановлений але lpk-файл не був знайдений. Всі компоненти дезактивовані. Будь-ласка, виправте проблему."
|
||
|
||
#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
||
msgid "This source is only used to compile and install the package."
|
||
msgstr "Цей код вимагає тільки компіляції і встановлення пакунку."
|
||
|
||
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr "Цей вираз не може бути витягнутий.%sВиберіть будь-який код, щоб витягти нову процедуру/метод."
|
||
|
||
#: lazarusidestrconsts:listhiswillhappencontinue
|
||
msgid "This will happen:%s%s%sContinue?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr "Програмний канал"
|
||
|
||
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr "Необхідний заголовок і назва файлу"
|
||
|
||
#: lazarusidestrconsts:dlgpotitle
|
||
msgid "Title:"
|
||
msgstr "Заголовок:"
|
||
|
||
#: lazarusidestrconsts:lismenuviewtodolist
|
||
msgid "ToDo List"
|
||
msgstr "Список ToDo"
|
||
|
||
#: lazarusidestrconsts:listodolistoptions
|
||
msgid "ToDo options..."
|
||
msgstr "Параметри ToDo..."
|
||
|
||
#: lazarusidestrconsts:lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr "Перемкнути форму/модуль"
|
||
|
||
#: lazarusidestrconsts:srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr "Перемкнути режим"
|
||
|
||
#: lazarusidestrconsts:liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr "Перемкнути між модулем і формою"
|
||
|
||
#: lazarusidestrconsts:lismenuviewtoggleformunit
|
||
msgid "Toggle form/unit view"
|
||
msgstr "Перемкнути форму/модуль"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewbreakpoints
|
||
msgid "Toggle view Breakpoints"
|
||
msgstr "Перемкнути до перегляду Точок Зупину"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcallstack
|
||
msgid "Toggle view Call Stack"
|
||
msgstr "Перемкнути до перегляду Стеку"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr "Перемкнути до перегляду Коду Explorer"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
|
||
msgid "Toggle view Debugger Output"
|
||
msgstr "Перемкнути до перегляду повідомлень Налагоджувача"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr "Перемкнути до перегляду Документації Редактора"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr "Перемкнути до перегляду гарячих клавіш графічної оболонки"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewlocalvariables
|
||
msgid "Toggle view Local Variables"
|
||
msgstr "Перемкнути до перегляду Локальних Змінних"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr "Перемкнути до перегляду Повідомлень"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr "Перемкнути до перегляду Інспектора Об'єктів"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr "Перемкнути до перегляду Результатів Пошуку"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr "Перемкнути до перегляду Редактора програмного Коду"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewwatches
|
||
msgid "Toggle view Watches"
|
||
msgstr "Перемкнути до перегляду Спостережень"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
|
||
msgid "Toggle view component palette"
|
||
msgstr "Перемкнути до перегляду палітри компонетів"
|
||
|
||
#: lazarusidestrconsts:liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr "Мітка:"
|
||
|
||
#: lazarusidestrconsts:lisctdefstools
|
||
msgid "Tools"
|
||
msgstr "Інструменти"
|
||
|
||
#: lazarusidestrconsts:srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr "Команди меню Інструменти"
|
||
|
||
#: lazarusidestrconsts:dlgtooltipeval
|
||
msgid "Tooltip expression evaluation"
|
||
msgstr "Обчислення виразу"
|
||
|
||
#: lazarusidestrconsts:dlgtooltiptools
|
||
msgid "Tooltip symbol Tools"
|
||
msgstr "Символьні інструменти"
|
||
|
||
#: lazarusidestrconsts:listop
|
||
msgid "Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr "Фіксація по верху"
|
||
|
||
#: lazarusidestrconsts:listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr "Ширина верхнього бордюру. Ця величина додана до базової ширини бордюрів і використовується для відступів навколо контролу."
|
||
|
||
#: lazarusidestrconsts:listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr "Вирівняти по висоті"
|
||
|
||
#: lazarusidestrconsts:dlgtoppos
|
||
msgid "Top:"
|
||
msgstr "Верх:"
|
||
|
||
#: lazarusidestrconsts:listops
|
||
msgid "Tops"
|
||
msgstr "Вершини"
|
||
|
||
#: lazarusidestrconsts:dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr "Обрізати кінцеві пробіли"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr "Посібник"
|
||
|
||
#: lazarusidestrconsts:dlgenvtype
|
||
msgid "Type"
|
||
msgstr "Тип"
|
||
|
||
#: lazarusidestrconsts:lisuidtype
|
||
msgid "Type:"
|
||
msgstr "Тип:"
|
||
|
||
#: lazarusidestrconsts:liscetypes
|
||
msgid "Types"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr "ВЕРХНІЙ РЕГІСТР"
|
||
|
||
#: lazarusidestrconsts:rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr "Українська"
|
||
|
||
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr "Не можу перетворити бінарний потік на текст"
|
||
|
||
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr "Не можу скопіювати компоненти в буфер"
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr "Не можу додати %s до проекту, тому що в проекті вже є модуль з такою самою назвою."
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Не можу додати ресурс T%s:FORMDATA до файлу ресурсів %s%s%s%s.%sМожливо, помилка синтаксису."
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Не можу додати коментар заголовка ресурсу до файлу ресурсу %s%s%s%s.%sМожливо, помилка синтаксису."
|
||
|
||
#: lazarusidestrconsts:lisunabletobackupfileto
|
||
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
||
msgstr "Не можу зберегти резервний файл %s%s%s як %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr "Не можу змінити список автостворюваних форм в коді програми.%sВиправте спочатку помилки."
|
||
|
||
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
||
msgstr "Не можу очистити %s%s%s.%sПеревірте доступ."
|
||
|
||
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr "Не можу очистити теку призначення"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr "Не можу перетворити компонент з текстового на бінарний формат:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertfileerror
|
||
msgid "Unable to convert file %s%s%s%sError: %s"
|
||
msgstr "Не можу перевести файл %s%s%s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
|
||
msgid "Unable to convert lfm to lrs and write lrs file."
|
||
msgstr "Неможливо перетворити lfm в lrs і записати lrs-файл."
|
||
|
||
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
||
msgstr "Не можу перетворити текстові дані форми файлу %s%s%s%s%sна двійковий потік. (%s)"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr "Не можу скопіювати файл"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfileto
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
||
msgstr "Не можу скопіювати файл %s%s%s%sв %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfileto2
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
||
msgstr "Не можу скопіювати файл %s%s%s%sв %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
|
||
msgid "Unable to create Test pascal file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory %s%s%s."
|
||
msgstr "Не можу створити резервну теку %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr "Не можу створити теку"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatedirectory2
|
||
msgid "Unable to create directory %s%s%s"
|
||
msgstr "Не можу створити теку %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatedirectory
|
||
msgid "Unable to create directory %s%s%s."
|
||
msgstr "Не можу створити теку %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr "Не можу створити файл"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile2
|
||
msgid "Unable to create file %s%s%s"
|
||
msgstr "Не можу створити файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefilename
|
||
msgid "Unable to create file %s%s%s."
|
||
msgstr "Не можу створити файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile3
|
||
msgid "Unable to create file%s%s%s%s"
|
||
msgstr "Не можу створити файл %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
|
||
msgid "Unable to create new method. Please fix the error shown in the message window."
|
||
msgstr "Не можу створити новий метод. Виправте помилки, що вказані в вікні повідомлень."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
||
msgstr "Не можу створити теку виведення %s%s%s%sз пакунку %s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
||
msgstr "Не можу створити теку кодів пакунку %s%s%s%sдля пакунку %s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
||
msgstr "Не можу створити теку цілі для lazarus:%s%s%s%s.%sЦя тека потрібна для оновленого IDE lazarus з вашими пакунками."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr "Не можу створити тимчасовий lfm буфер"
|
||
|
||
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file %s%s%s"
|
||
msgstr "Не можу видалити двозначний файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr "Не можу видалити файл"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file %s%s%s."
|
||
msgstr "Не можу видалити файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
||
msgstr "Не можу видалити старий файл %s%s%s%s з пакунку %s."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr "Не можу знайти %s в LFM Потоці"
|
||
|
||
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr "Не можу знайти розділ ResourceStribg в цьому або будь-якому використаному модулі."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in %s%s%s"
|
||
msgstr "Не можу знайти правильну назву класу в %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletofindfile
|
||
msgid "Unable to find file %s%s%s."
|
||
msgstr "Не можу знайти файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to find method. Please fix the error shown in the message window."
|
||
msgstr "Не можу знайти метод. Виправте помилки в вікні повідомлень."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
|
||
msgid "Unable to find the unit of component class %s%s%s."
|
||
msgstr "Не можу знайти модуль компонета класу %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr "Не можу побудувати зміни редактора"
|
||
|
||
#: lazarusidestrconsts:lisccounabletogetfiledate
|
||
msgid "Unable to get file date of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr "Не можу знайти код для дизайнера"
|
||
|
||
#: lazarusidestrconsts:lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr "Не можу завантажити файл"
|
||
|
||
#: lazarusidestrconsts:lisdebugunabletoloadfile2
|
||
msgid "Unable to load file %s%s%s."
|
||
msgstr "Не можу завантажити файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
|
||
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
||
msgstr "Не можу завантажити старий ресурсний файл.%sЦей файл є першим include-файлом в%s розділі ініціалізації.%sНаприклад, {$I %s.lrs}.%sМожливо, помилка синтаксису."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr "Не можу завантажити пакунок"
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadpackage
|
||
msgid "Unable to load package %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
||
msgstr "Неможливо завантажити клас компоненту %s%s%s через те, що він залежить сам від себе. "
|
||
|
||
#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr "Не можу відкрити дизайнер.%sКлас %s не походить від розробляємого класу типу TForm або TDataModule."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
||
msgstr "Не можу відкрити пакунок%s%s%s.%sЦей пакунок було позначено для встановлення."
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr "Не можу прочитати файл"
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfile2
|
||
msgid "Unable to read file %s%s%s!"
|
||
msgstr "Не можу прочитати файл %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfileerror
|
||
msgid "Unable to read file %s%s%s%sError: %s"
|
||
msgstr "Не можу прочитати файл %s%s%s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfilename
|
||
msgid "Unable to read file %s%s%s."
|
||
msgstr "Не можу прочитати файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file %s%s%s.%sError: %s"
|
||
msgstr "Неможливо прочитати файл пакунку %s%s%s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr "Неможливо прочитати файл стану %s проекту %s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Не можу прочитати файл стану %s%s%s%sпакунку %s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file %s%s%s!"
|
||
msgstr "Не можу стерти старий резервний файл %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
||
msgstr "Не можу змінити назву двозначного файла %s%s%s%sв %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr "Не можу змінити назву файла"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefileto
|
||
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
||
msgstr "Не можу змінити назву файла %s%s%s в %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefileto2
|
||
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
||
msgstr "Не можу змінити назву файла %s%s%s%sв %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr "Неможливо змінити назву форми в коді"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr "Не можу змінити назву метода. Виправте помилку. Див. вікно повідомлень."
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr "Неможливо змінити назву змінної в коді."
|
||
|
||
#: lazarusidestrconsts:lisexttoolunabletorunthetool
|
||
msgid "Unable to run the tool %s%s%s:%s%s"
|
||
msgstr "Не можу запустити інструмент %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletosavefile
|
||
msgid "Unable to save file %s%s%s"
|
||
msgstr "Не можу зберегти файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr "Неможливо встановити AnchorSide Control"
|
||
|
||
#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to show method. Please fix the error shown in the message window."
|
||
msgstr "Не можу показати метод. Виправте помилку. Див. вікно повідомлень."
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr "Не можу створити потік %s:T%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr "Не можу скопіювати вибрані компоненти в потік"
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr "Не можу скопіювати вибрані компоненти в потік"
|
||
|
||
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr "Не можу перевести двійковий компонент потоку %s:T%s на текст."
|
||
|
||
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr "Неможливо оновити вираз CreateForm в коді проекту"
|
||
|
||
#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
|
||
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowrite2
|
||
msgid "Unable to write %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowrite
|
||
msgid "Unable to write %s%s%s%s%s."
|
||
msgstr "Не можу записати %s%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr "Не можу записати файл"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefile2
|
||
msgid "Unable to write file %s%s%s"
|
||
msgstr "Не можу записати файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefileerror
|
||
msgid "Unable to write file %s%s%s%sError: %s"
|
||
msgstr "Не можу записати файл %s%s%s%sError: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefilename
|
||
msgid "Unable to write file %s%s%s."
|
||
msgstr "Не можу записати файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lislazbuildunabletowritefile
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
||
msgstr "Не можу записати пакунок%s%s%s%sу файл %s%s%s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Не можу записати файл стану %s%s%s%sпакунку %s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr "Неможливо записати файл стану в проект %s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritetofile2
|
||
msgid "Unable to write to file %s%s%s"
|
||
msgstr "Не можу записати в файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritetofile
|
||
msgid "Unable to write to file %s%s%s!"
|
||
msgstr "Не можу записати в файл %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlguncertopt
|
||
msgid "Uncertain Optimizations"
|
||
msgstr "Нестандартна оптимізація"
|
||
|
||
#: lazarusidestrconsts:lismenuuncommentselection
|
||
msgid "Uncomment selection"
|
||
msgstr "Розкоментувати"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr "Зняти визначення"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr "Зняти визначення зі всіх"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr "Рекурсивно зняти визначення"
|
||
|
||
#: lazarusidestrconsts:dlgedunder
|
||
msgid "Underline"
|
||
msgstr "Підкреслений"
|
||
|
||
#: lazarusidestrconsts:lismenuundo
|
||
msgid "Undo"
|
||
msgstr "Відмінити"
|
||
|
||
#: lazarusidestrconsts:dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "Скасування після збереження"
|
||
|
||
#: lazarusidestrconsts:dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "Межа скасувань:"
|
||
|
||
#: lazarusidestrconsts:srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr "Відмінити зсув блоку вправо"
|
||
|
||
#: lazarusidestrconsts:lismenuunindentselection
|
||
msgid "Unindent selection"
|
||
msgstr "Відмінити зсув блоку вправо"
|
||
|
||
#: lazarusidestrconsts:lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr "Видалити"
|
||
|
||
#: lazarusidestrconsts:lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start"
|
||
msgstr "Видалити при наст. пуску"
|
||
|
||
#: lazarusidestrconsts:lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr "Видалити пакунок%s?"
|
||
|
||
#: lazarusidestrconsts:lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr "Видалити пакунок?"
|
||
|
||
#: lazarusidestrconsts:lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr "Видалити виділення"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeunit
|
||
msgid "Unit"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts:lisunithaschangedsave
|
||
msgid "Unit %s%s%s has changed. Save?"
|
||
msgstr "Модуль %s%s%s змінено. Зберегти?"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
|
||
msgid "Unit %s%s%s was removed from package"
|
||
msgstr "Модуль %s%s%s був видалений з пакунку"
|
||
|
||
#: lazarusidestrconsts:lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr "Назва файлу модуля:"
|
||
|
||
#: lazarusidestrconsts:uemshowunitinfo
|
||
msgid "Unit Info"
|
||
msgstr "Відомості про модулі"
|
||
|
||
#: lazarusidestrconsts:lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr "Назва модуля є неприпустимою"
|
||
|
||
#: lazarusidestrconsts:lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr "Назва модуля:"
|
||
|
||
#: lazarusidestrconsts:lisaf2punitname
|
||
msgid "Unit Name: "
|
||
msgstr "Назва модуля: "
|
||
|
||
#: lazarusidestrconsts:lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr "Тека для генерації модулів"
|
||
|
||
#: lazarusidestrconsts:lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr "Шлях до модулів"
|
||
|
||
#: lazarusidestrconsts:dlgcounitstyle
|
||
msgid "Unit Style:"
|
||
msgstr "Стиль модуля:"
|
||
|
||
#: lazarusidestrconsts:dlgunitdepcaption
|
||
msgid "Unit dependencies"
|
||
msgstr "Залежності модуля"
|
||
|
||
#: lazarusidestrconsts:lisa2punitfilename
|
||
msgid "Unit file name:"
|
||
msgstr "Назва файлу модуля:"
|
||
|
||
#: lazarusidestrconsts:lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr "Ідентифікатор модуля існує"
|
||
|
||
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr "Назва модуля вже існує"
|
||
|
||
#: lazarusidestrconsts:lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr "Назва модуля починається з ..."
|
||
|
||
#: lazarusidestrconsts:lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr "Назва модуля включає ..."
|
||
|
||
#: lazarusidestrconsts:lisunitnotfound
|
||
msgid "Unit not found"
|
||
msgstr "Модул не знайдений"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitnotfound
|
||
msgid "Unit not found: %s%s%s"
|
||
msgstr "Модуль не знайдений: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr "Вихідна тека модулів (-FU):"
|
||
|
||
#: lazarusidestrconsts:lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr "Шляхи до модулів"
|
||
|
||
#: lazarusidestrconsts:lisunitlfmfile
|
||
msgid "Unit: %s%sLFM file: %s"
|
||
msgstr "Модуль: %s%sФайл LFM: %s"
|
||
|
||
#: lazarusidestrconsts:lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr "Назва модуля вже існує"
|
||
|
||
#: lazarusidestrconsts:lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr "Модуль з такою назвою вже є в проекті"
|
||
|
||
#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Назва модуля і Назва файлу не збігаються.%sНаприклад: unit1.pas і Unit1"
|
||
|
||
#: lazarusidestrconsts:lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr "Назва Модуля"
|
||
|
||
#: lazarusidestrconsts:lisunitsnotfound2
|
||
msgid "Units not found"
|
||
msgstr "Модулі не знайдені"
|
||
|
||
#: lazarusidestrconsts:lismenuviewunits
|
||
msgid "Units..."
|
||
msgstr "Модулі..."
|
||
|
||
#: lazarusidestrconsts:srvk_unknown
|
||
msgid "Unknown"
|
||
msgstr "Невідомий"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr "Не збережений пакунок"
|
||
|
||
#: lazarusidestrconsts:dlgupword
|
||
msgid "Up"
|
||
msgstr "Вверх"
|
||
|
||
#: lazarusidestrconsts:lisceoupdate
|
||
msgid "Update"
|
||
msgstr "Поновити"
|
||
|
||
#: lazarusidestrconsts:lispckoptsupdaterebuild
|
||
msgid "Update/Rebuild"
|
||
msgstr "Поновити/перебудувати"
|
||
|
||
#: lazarusidestrconsts:lismenuuppercaseselection
|
||
msgid "Uppercase selection"
|
||
msgstr "Верхний регістр виділення"
|
||
|
||
#: lazarusidestrconsts:lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr "Використання"
|
||
|
||
#: lazarusidestrconsts:dlgcoansistr
|
||
msgid "Use Ansi Strings"
|
||
msgstr "Використовувати рядки Ansi"
|
||
|
||
#: lazarusidestrconsts:dlgpouseappbundle
|
||
msgid "Use Application Bundle for running and debugging (darwin only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuseexcludefilter
|
||
msgid "Use Exclude Filter"
|
||
msgstr "Використовувати фільтр виключень"
|
||
|
||
#: lazarusidestrconsts:dlgcoheaptrc
|
||
msgid "Use Heaptrc Unit"
|
||
msgstr "Використовувати модуль Heaprc"
|
||
|
||
#: lazarusidestrconsts:lisuseincludefilter
|
||
msgid "Use Include Filter"
|
||
msgstr "Використовувати фільтр включень"
|
||
|
||
#: lazarusidestrconsts:dlgusecustomconfig
|
||
msgid "Use addional Compiler Config File"
|
||
msgstr "Використовувати додатковий файл налаштувань компілятора"
|
||
|
||
#: lazarusidestrconsts:dlgedusedefcolor
|
||
msgid "Use default color"
|
||
msgstr "Колір за замовчуванням"
|
||
|
||
#: lazarusidestrconsts:dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr "Використовувати дисплей"
|
||
|
||
#: lazarusidestrconsts:dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr "Використовувати програму для запуску"
|
||
|
||
#: lazarusidestrconsts:dlgpousemanifest
|
||
msgid "Use manifest file to enable themes (windows only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgusefpccfg
|
||
msgid "Use standard Compiler Config File (fpc.cfg)"
|
||
msgstr "Використовувати стандартний файл налаштувань (fpc.cfg)"
|
||
|
||
#: lazarusidestrconsts:dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr "Підсвітка синтаксису"
|
||
|
||
#: lazarusidestrconsts:lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr "Викор. модуль"
|
||
|
||
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
|
||
msgid "Use windowmanager setting"
|
||
msgstr "Використати налаштування windowmanager"
|
||
|
||
#: lazarusidestrconsts:lisplduser
|
||
msgid "User"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecuserfirst
|
||
msgid "User First"
|
||
msgstr "Спочатку Користувач"
|
||
|
||
#: lazarusidestrconsts:dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr "Користувацьке розширення"
|
||
|
||
#: lazarusidestrconsts:dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr "Розширення користувача (.pp.xxx)"
|
||
|
||
#: lazarusidestrconsts:dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr "Overrides користувача"
|
||
|
||
#: lazarusidestrconsts:lisceuses
|
||
msgid "Uses"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgvaluecolor
|
||
msgid "Value"
|
||
msgstr "Значення"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr "Значення як шлях до файлу"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr "Значення як текст"
|
||
|
||
#: lazarusidestrconsts:dlgrunovariable
|
||
msgid "Variable"
|
||
msgstr "Змінна"
|
||
|
||
#: lazarusidestrconsts:lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr "Назва змінної"
|
||
|
||
#: lazarusidestrconsts:dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr "Префікс змінної"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr "Змінна:"
|
||
|
||
#: lazarusidestrconsts:lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr "Змінна: %s"
|
||
|
||
#: lazarusidestrconsts:liscevariables
|
||
msgid "Variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr "Подробиці при компіляції:"
|
||
|
||
#: lazarusidestrconsts:lisversion
|
||
msgid "Version"
|
||
msgstr "Версія"
|
||
|
||
#: lazarusidestrconsts:versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr "Інформація про Версію"
|
||
|
||
#: lazarusidestrconsts:rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsversion
|
||
msgid "Version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisvertical
|
||
msgid "Vertical"
|
||
msgstr "Вертикально"
|
||
|
||
#: lazarusidestrconsts:dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr "Вертикальний крок сітки"
|
||
|
||
#: lazarusidestrconsts:lismenuviewanchoreditor
|
||
msgid "View Anchor Editor"
|
||
msgstr "Показувати редактор прив'язок"
|
||
|
||
#: lazarusidestrconsts:uemviewcallstack
|
||
msgid "View Call Stack"
|
||
msgstr "Показувати стек викликів"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr "Показувати оглядач коду"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcomponentpalette
|
||
msgid "View Component Palette"
|
||
msgstr "Переглянути Палітру Компонетів"
|
||
|
||
#: lazarusidestrconsts:srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr "Переглянути Редактор Документації"
|
||
|
||
#: lazarusidestrconsts:lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr "Показувати форми"
|
||
|
||
#: lazarusidestrconsts:lismenuviewidespeedbuttons
|
||
msgid "View IDE speed buttons"
|
||
msgstr "Переглянути швидкі клавіші графічної оболонки"
|
||
|
||
#: lazarusidestrconsts:lismenuviewjumphistory
|
||
msgid "View Jump-History ..."
|
||
msgstr "Переглядання історії переходів ..."
|
||
|
||
#: lazarusidestrconsts:srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr "Показувати Інспектор Об'єктів"
|
||
|
||
#: lazarusidestrconsts:lispckeditviewpackgesource
|
||
msgid "View Package Source"
|
||
msgstr "Продивитись код пакунку"
|
||
|
||
#: lazarusidestrconsts:lisviewprojectunits
|
||
msgid "View Project Units"
|
||
msgstr "Показувати модулі проекту"
|
||
|
||
#: lazarusidestrconsts:srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr "Показувати результати пошуку"
|
||
|
||
#: lazarusidestrconsts:lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr "Переглянути код (.lfm)"
|
||
|
||
#: lazarusidestrconsts:srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "Показувати редактор тексту"
|
||
|
||
#: lazarusidestrconsts:lispeviewtodolist
|
||
msgid "View ToDo list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewunitdependencies
|
||
msgid "View Unit Dependencies"
|
||
msgstr "Показувати залежності модулів"
|
||
|
||
#: lazarusidestrconsts:liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr "Переглянути Інформацію про Модулі"
|
||
|
||
#: lazarusidestrconsts:lismenuviewunitinfo
|
||
msgid "View Unit Information"
|
||
msgstr "Продивитись відомості про модулі"
|
||
|
||
#: lazarusidestrconsts:lishintviewunits
|
||
msgid "View Units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts:srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr "Показувати редактор прив'язок"
|
||
|
||
#: lazarusidestrconsts:srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr "Переглядання точок зупинки"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr "Переглядання стеку викликів"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr "Браузер коду програми"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr "Переглянути палітру компонетів"
|
||
|
||
#: lazarusidestrconsts:srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr "Переглядання виводу налагоджувача"
|
||
|
||
#: lazarusidestrconsts:srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr "Показувати форми"
|
||
|
||
#: lazarusidestrconsts:liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr "Переглянути історію переходів"
|
||
|
||
#: lazarusidestrconsts:srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr "Переглядання локальних змінних"
|
||
|
||
#: lazarusidestrconsts:srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr "Команди меню Переглядання"
|
||
|
||
#: lazarusidestrconsts:srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr "Переглядання повідомлень"
|
||
|
||
#: lazarusidestrconsts:dlgmainviewforms
|
||
msgid "View project forms"
|
||
msgstr "Показувати форми проекту"
|
||
|
||
#: lazarusidestrconsts:liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr "Переглядання опцій проекту"
|
||
|
||
#: lazarusidestrconsts:liskmviewprojectsource
|
||
msgid "View project source"
|
||
msgstr "Переглядання тексту проекту"
|
||
|
||
#: lazarusidestrconsts:dlgmainviewunits
|
||
msgid "View project units"
|
||
msgstr "Показувати модулі проекту"
|
||
|
||
#: lazarusidestrconsts:srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewtodolist
|
||
msgid "View todo list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr "Показувати залежності модулів"
|
||
|
||
#: lazarusidestrconsts:srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr "Показувати відомості про модулі"
|
||
|
||
#: lazarusidestrconsts:srkmecviewunits
|
||
msgid "View units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts:srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr "Показувати спостереження"
|
||
|
||
#: lazarusidestrconsts:lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr "Переглядачі"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr "Віртуальний модуль"
|
||
|
||
#: lazarusidestrconsts:lisaf2pisvirtualunit
|
||
msgid "Virtual unit (source is not in package)"
|
||
msgstr "Віртуальний модуль (код не в пакункові)"
|
||
|
||
#: lazarusidestrconsts:dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr "Видиме поле (лів)"
|
||
|
||
#: lazarusidestrconsts:dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr "Права видима границя"
|
||
|
||
#: lazarusidestrconsts:lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr "Попередж. при компіляції"
|
||
|
||
#: lazarusidestrconsts:lisccowarningcaption
|
||
msgid "Warning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr "Увага: додатковий файл налаштувань компілятора має ту ж саму назву, як може називатись один із стандартних файлів налаштувань компілятора FreePascal. Це призведе до використання додаткового файлу і пропуску стандартного."
|
||
|
||
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
||
msgstr "Увага: Файл %s%s%s%sналежить поточному проекту."
|
||
|
||
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
||
msgstr "Попередження: знайдений двозначний файл %s%s%s. Код: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:liswatchpropert
|
||
msgid "Watch Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlwatchlist
|
||
msgid "Watch list"
|
||
msgstr "Список спостережень"
|
||
|
||
#: lazarusidestrconsts:lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr "Вікно спостережень"
|
||
|
||
#: lazarusidestrconsts:dlgautocreatenewforms
|
||
msgid "When creating new forms, add them to auto-created forms"
|
||
msgstr "При створенні нових форм додати їх до автостворюваних"
|
||
|
||
#: lazarusidestrconsts:lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr "Коли перемикається файл в редакторі коду"
|
||
|
||
#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
|
||
msgid "When this file is active in source editor ..."
|
||
msgstr "Коли цей файл активний в редакторі коду ..."
|
||
|
||
#: lazarusidestrconsts:lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr "Де"
|
||
|
||
#: lazarusidestrconsts:dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr "Ширина:"
|
||
|
||
#: lazarusidestrconsts:dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwindow
|
||
msgid "Window"
|
||
msgstr "Вікно"
|
||
|
||
#: lazarusidestrconsts:dlgwinpos
|
||
msgid "Window Positions"
|
||
msgstr "Позиції вікна"
|
||
|
||
#: lazarusidestrconsts:lislazbuildwithstaticpackages
|
||
msgid "With packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr "З необхідними пакунками"
|
||
|
||
#: lazarusidestrconsts:liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr "Слово під курсором в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts:srkmecwordcompletion
|
||
msgid "Word completion"
|
||
msgstr "Завершення слів"
|
||
|
||
#: lazarusidestrconsts:dlgwordspolicies
|
||
msgid "Words"
|
||
msgstr "Слова"
|
||
|
||
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
|
||
msgid "Working Directory (Leave empty for file path)"
|
||
msgstr "Робоча Тека (Залишити порожньою для файлового шляху)"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr "Робоча тека:"
|
||
|
||
#: lazarusidestrconsts:dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr "Робоча тека"
|
||
|
||
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
|
||
msgid "Working directory (Leave empty for file path)"
|
||
msgstr "Робоча тека (залишити порожньою для файлового шляху)"
|
||
|
||
#: lazarusidestrconsts:lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr "Робоча тека для побудови"
|
||
|
||
#: lazarusidestrconsts:lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr "Робоча тека для виконання"
|
||
|
||
#: lazarusidestrconsts:liswriteerror
|
||
msgid "Write Error"
|
||
msgstr "Помилка запису"
|
||
|
||
#: lazarusidestrconsts:dlgwritefpclogo
|
||
msgid "Write an FPC logo"
|
||
msgstr "Вивести логотип FPC"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr "Помилка запису"
|
||
|
||
#: lazarusidestrconsts:liswriteerrorfile
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr "Префікс WRITE"
|
||
|
||
#: lazarusidestrconsts:lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisxmlfiles
|
||
msgid "XML files"
|
||
msgstr "Файли XML"
|
||
|
||
#: lazarusidestrconsts:lisxmlparsererrorinfileerror
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You can not build lazarus while debugging or compiling."
|
||
msgstr "Ви не можете перебудувати lazarus при налагоджуванні або компіляції."
|
||
|
||
#: lazarusidestrconsts:dlgdoesnotexist
|
||
msgid "\" does not exist."
|
||
msgstr "\" не існує."
|
||
|
||
#: lazarusidestrconsts:uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr "\" не для запису."
|
||
|
||
#: lazarusidestrconsts:lisexttooltitlecompleted
|
||
msgid "\"%s\" completed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr "перервати побудову"
|
||
|
||
#: lazarusidestrconsts:srkmecaddbreakpoint
|
||
msgid "add break point"
|
||
msgstr "додати точку зупинки"
|
||
|
||
#: lazarusidestrconsts:srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr "додати спостереження"
|
||
|
||
#: lazarusidestrconsts:srvk_apps
|
||
msgid "application key"
|
||
msgstr "клавіша додатку"
|
||
|
||
#: lazarusidestrconsts:lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr "авто-встановити динамічно"
|
||
|
||
#: lazarusidestrconsts:lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr "авто-встановити статично"
|
||
|
||
#: lazarusidestrconsts:lisbegins
|
||
msgid "begins"
|
||
msgstr "починається"
|
||
|
||
#: lazarusidestrconsts:srkmecbuildall
|
||
msgid "build all files of program/project"
|
||
msgstr "побудувати всі файли програми/проекту"
|
||
|
||
#: lazarusidestrconsts:srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr "побудувати файл"
|
||
|
||
#: lazarusidestrconsts:srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr "побудувати програму/проект"
|
||
|
||
#: lazarusidestrconsts:dlglefttopclr
|
||
msgid "color for left, top"
|
||
msgstr "колір зліва зверху"
|
||
|
||
#: lazarusidestrconsts:dlgrightbottomclr
|
||
msgid "color for right, bottom"
|
||
msgstr "колір справа знизу"
|
||
|
||
#: lazarusidestrconsts:lisccomsgppunotfound
|
||
msgid "compiled FPC unit not found: %s.ppu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccompileroptions
|
||
msgid "compiler options"
|
||
msgstr "параметри компілятора"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
|
||
msgid "compiler path"
|
||
msgstr "шлях до компілятора"
|
||
|
||
#: lazarusidestrconsts:srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr "файл налаштувань побудови"
|
||
|
||
#: lazarusidestrconsts:liscontains
|
||
msgid "contains"
|
||
msgstr "вміщує"
|
||
|
||
#: lazarusidestrconsts:lisccocontains
|
||
msgid "contains "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscustomoptions
|
||
msgid "custom options"
|
||
msgstr "параметри користувача"
|
||
|
||
#: lazarusidestrconsts:liscodefault
|
||
msgid "default (%s)"
|
||
msgstr "за замочуванням (%s)"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccoenglishmessagefilemissing
|
||
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr "розрахувати/змінити"
|
||
|
||
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr "файл, куди буде записуватись налагоджувальна інформація. Якщо не вказан., налагоджувальна інформація виводиться в консоль."
|
||
|
||
#: lazarusidestrconsts:lisfpcmakefailed
|
||
msgid "fpcmake failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
|
||
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidinproject
|
||
msgid "in Project:"
|
||
msgstr "в проекті:"
|
||
|
||
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr "у всіх відкритих пакунках і проектах"
|
||
|
||
#: lazarusidestrconsts:lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr "в поточному модулі"
|
||
|
||
#: lazarusidestrconsts:lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr "в головному проекті"
|
||
|
||
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr "в проекті/пакунку, що вміщує цей модуль"
|
||
|
||
#: lazarusidestrconsts:lisincludepath
|
||
msgid "include path"
|
||
msgstr "шлях доданих файлів"
|
||
|
||
#: lazarusidestrconsts:srkmecinspect
|
||
msgid "inspect"
|
||
msgstr "перевірити"
|
||
|
||
#: lazarusidestrconsts:lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr "встановлено динамічно"
|
||
|
||
#: lazarusidestrconsts:lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr "встановлено статично"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr "неправильна назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr "lazarus [параметри] <назва файлу проекту>"
|
||
|
||
#: lazarusidestrconsts:srvk_lwin
|
||
msgid "left windows key"
|
||
msgstr "ліва клавіша windows"
|
||
|
||
#: lazarusidestrconsts:lislibrarypath
|
||
msgid "library path"
|
||
msgstr "шлях до бібліотек"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr "параметри компонувальника"
|
||
|
||
#: lazarusidestrconsts:dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr "нижній регістр"
|
||
|
||
#: lazarusidestrconsts:lisprojectmacrounitpath
|
||
msgid "macro ProjectUnitPath"
|
||
msgstr "макрос ProjectUnitPath"
|
||
|
||
#: lazarusidestrconsts:lisoipmissing
|
||
msgid "missing"
|
||
msgstr "відсутній"
|
||
|
||
#: lazarusidestrconsts:lisoipmodified
|
||
msgid "modified"
|
||
msgstr "змінено"
|
||
|
||
#: lazarusidestrconsts:lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnew
|
||
msgid "new"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidno
|
||
msgid "no"
|
||
msgstr "ні"
|
||
|
||
#: lazarusidestrconsts:dlgnoautomaticrenaming
|
||
msgid "no automatic renaming"
|
||
msgstr "без автоперейменування"
|
||
|
||
#: lazarusidestrconsts:lisccdnoclass
|
||
msgid "no class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
|
||
msgid "no inherited description found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnoname
|
||
msgid "noname"
|
||
msgstr "без назви"
|
||
|
||
#: lazarusidestrconsts:lisnone2
|
||
msgid "none"
|
||
msgstr "нічого"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "нічого не вибрано"
|
||
|
||
#: lazarusidestrconsts:lisobjectpath
|
||
msgid "object path"
|
||
msgstr "шлях до об'єкта"
|
||
|
||
#: lazarusidestrconsts:lisold
|
||
msgid "old"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisor
|
||
msgid "or"
|
||
msgstr "або"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr "пакунок%s не збережений"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr "головний файл є кодом пакунку"
|
||
|
||
#: lazarusidestrconsts:srkmecpause
|
||
msgid "pause program"
|
||
msgstr "призупинити програму"
|
||
|
||
#: lazarusidestrconsts:lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr "виберіть будь-ласка макрос"
|
||
|
||
#: lazarusidestrconsts:lisccoppuexiststwice
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr "тека головних налаштувань, де Lazarus зберігає свої файли налаштувань. За замовчуванням"
|
||
|
||
#: lazarusidestrconsts:srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr "швидка компіляція без збирання"
|
||
|
||
#: lazarusidestrconsts:lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr "тільки для читання"
|
||
|
||
#: lazarusidestrconsts:lisccorelunitpathfoundincfg
|
||
msgid "relative unit path found in fpc cfg: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisremove
|
||
msgid "remove"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecremovebreakpoint
|
||
msgid "remove break point"
|
||
msgstr "видалити точку зупинки"
|
||
|
||
#: lazarusidestrconsts:srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr "скидання налагоджувача"
|
||
|
||
#: lazarusidestrconsts:srvk_rwin
|
||
msgid "right windows key"
|
||
msgstr "права клавіша Windows"
|
||
|
||
#: lazarusidestrconsts:srkmecrunfile
|
||
msgid "run file"
|
||
msgstr "запуск файлу"
|
||
|
||
#: lazarusidestrconsts:srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr "параметри запуску"
|
||
|
||
#: lazarusidestrconsts:srkmecrun
|
||
msgid "run program"
|
||
msgstr "запустити програму"
|
||
|
||
#: lazarusidestrconsts:lissaveallmodified
|
||
msgid "save all modified files"
|
||
msgstr "зберегти всі змінені файли"
|
||
|
||
#: lazarusidestrconsts:lissavecurrenteditorfile
|
||
msgid "save current editor file"
|
||
msgstr "зберегти поточний файл редактора"
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
|
||
msgid "search all &open files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
|
||
msgid "search all files in &project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchindirectories
|
||
msgid "search in &directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtimesecondunit
|
||
msgid "sec"
|
||
msgstr "сек"
|
||
|
||
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr "вторинна тека налаштувань, де Lazarus шукає свої шаблони налаштувань. За замовчуванням "
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr "встановити режим FPC в DELPHI"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr "встановити режим FPC в GPC"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr "встановити режим FPC в TP"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr "ввімкнути IOCHECKS на"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr "ввімкнути OVERFLOWCHECKS на"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr "ввімкнути RANGECHECKS на"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccospaces
|
||
msgid "spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr "статичний файл налаштувань пакунку"
|
||
|
||
#: lazarusidestrconsts:srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr "зупинити програму"
|
||
|
||
#: lazarusidestrconsts:listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr "це довідкове повідомлення"
|
||
|
||
#: lazarusidestrconsts:lisunitpath
|
||
msgid "unit path"
|
||
msgstr "шлях до модуля"
|
||
|
||
#: lazarusidestrconsts:srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr "невідома команда редактора"
|
||
|
||
#: lazarusidestrconsts:lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr "використовувати модуль HeapTrc"
|
||
|
||
#: lazarusidestrconsts:lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr "використовувати LineInfo"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidyes
|
||
msgid "yes"
|
||
msgstr "так"
|
||
|