lazarus/languages/lazaruside.it.po
mattias 630b9a4efd IDE: fixed typo, bug #25816
git-svn-id: trunk@44338 -
2014-03-04 09:11:12 +00:00

19329 lines
570 KiB
Plaintext

msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"PO-Revision-Date: 2011-04-17 23:51+0200\n"
"Last-Translator: Massimo Soricetti <notturno@quipo.it>\n"
"Language-Team: PincoPallo Team\n"
"Language: it\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Plural-Forms: nplurals=2; plural=(n != 1);\n"
"X-Generator: Virtaal 0.5.1\n"
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr ""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Usa schema predefinito"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Azzera preferenze"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Azzera preferenze del gutter"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Azzera preferenze del testo"
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Incolla"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Questa pagina non mostra le vostre attuali preferenze: vedi preferenze avanzate. Usatela per azzerare cambiamenti alle preferenza avanzate"
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Generale"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
#, fuzzy
#| msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Standard: tutte le azioni su click del mouse (breakpoint, fold)"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
#, fuzzy
#| msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Estesa: azioni (breakpoint, fold) su rilascio del click. Selezione con click e trascinamento"
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Gutter"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "Tasto destro del mouse sposta il cursore"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Testo"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
#, fuzzy
#| msgid "Drag Selection (copy/paste)"
msgid "Drag selection (copy/paste)"
msgstr "Trascina selezione (copia/incolla)"
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Doppio"
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Quadruplo"
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Triplo"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Tasto centrale"
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Ci sono modifiche non salvate: usare questa pagina annullerà le modifiche fatte nella pagina avanzata"
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr ""
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Nessuno >"
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Sola lettura"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Minuscolo, prima lettera maiuscola"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Aggiungi operatore di assegnazione :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Evidenziatura parentesi"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Albero di chiusura codice"
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Testo di default"
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Breakpoint disabilitati"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Breakpoint abilitati"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Riga dell'errore"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Punto di esecuzione"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Segnale di codice chiuso"
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Globale"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Spaziatura"
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Riga"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Edit sincrono"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Edita template"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Testo"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Separatore gutter"
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Altre incrementali"
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Evidenzia la parola corrente"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Ricerca incrementale"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Breakpoint non valido"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Evidenzia la riga corrente"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Numero di riga"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Riga modificata"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Collegamento al mouse"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Area selezionata"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Cella attiva"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Altre celle"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Celle sincronizzate"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Cella attiva"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Altre celle"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Celle sincronizzate"
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Blocco di testo"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Breakpoint sconosciuto"
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Parentesi alla parola"
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr ""
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Aggiungi punto e virgola"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Aggiusta linea in testa per il commento nel frontespizio"
#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Tutti i file"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabeticamente"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Cursore sempre visibile"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Azione sui file ambigua:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Avverti prima di compilare"
#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr ""
#: lazarusidestrconsts.dlgapplicationsettings
#, fuzzy
#| msgid "Application Settings"
msgid "Application settings"
msgstr "Impostazioni dell'applicazione"
#: lazarusidestrconsts.dlgassertcode
#, fuzzy
#| msgid "Include Assertion Code"
msgid "Include assertion code"
msgstr "Includi codice assertion"
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Creazione automatica form:"
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Alla creazione di nuove form, aggiungile a quelle auto-create"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Autocancellazione file"
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "Nascondi il mouse durante la scrittura"
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Indenta automaticamente"
#: lazarusidestrconsts.dlgautoindentlink
#, fuzzy
#| msgid "(Setup smart indent)"
msgid "(Set up smart indent)"
msgstr "(Imposta indentazione automatica)"
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Indenta automaticamente"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Rimuovi automaticamente metodi vuoti"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Rinomina automatica dei file in minuscolo"
#: lazarusidestrconsts.dlgautosave
#, fuzzy
#| msgid "Auto save"
msgid "Auto Save"
msgstr "Salvataggio automatico"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Form disponibili:"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Sfondo"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(nessuna sottocartella)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Stesso nome (nella cartella)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Dietro ai metodi"
#: lazarusidestrconsts.dlgblockgroupoptions
#, fuzzy
#| msgid "Selection:"
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Selezione"
#: lazarusidestrconsts.dlgblockindent
#, fuzzy
#| msgid "Block indent"
msgid "Block indent (spaces)"
msgstr "Intentazione blocco"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr ""
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Spazi/tab come riga precedente"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Solo posizione"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Spazi"
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr ""
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr ""
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Evidenzia parentesi"
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr "Riconosci parentesi a coppie"
#: lazarusidestrconsts.dlgcasesensitive
#, fuzzy
#| msgid "&Case Sensitive"
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "Maiuscolo/Minuscolo"
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Verifica opzioni del compilatore"
#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Risultati"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Controllo compilatore ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: Controllo configurazione compilatore ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test: Controllo data compilatore ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test: Compilazione di un file vuoto ..."
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Test: Controllo mancanza fpc ppu"
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: Controllo sorgenti nei percorsi fpc ppu ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: Compilazione di un file vuoto"
#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Ordine delle classi"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Ultima"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "minuscolo"
#: lazarusidestrconsts.dlgcdtpreview
#, fuzzy
#| msgid "Preview (Max line length = 1)"
msgid "Preview (max line length = 1)"
msgstr "Anteprima (Lunghezza massima riga = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Leggi il prefisso"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Posfisso memorizzato"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "MAIUSCOLO"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefisso variabile"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Scrivi il prefisso"
#: lazarusidestrconsts.dlgcentercursorline
#, fuzzy
#| msgid "Center Cursor Line"
msgid "Center cursor line"
msgstr "Centra riga cursore"
#: lazarusidestrconsts.dlgcharcasefileact
#, fuzzy
#| msgid "Save As - auto rename pascal files lower case"
msgid "Save As - auto rename Pascal files lower case"
msgstr "Salva come - auto rinomina i file pascal in minuscolo"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Controlla i package quando crei il form"
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Scegliere il file modello di codice (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Mostra i tasti di chiusura negli appunti"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Schema colori"
#: lazarusidestrconsts.dlgcmacro
#, fuzzy
#| msgid "C Style Macros (global)"
msgid "C style macros (global)"
msgstr "Macro in stile C (globale)"
#: lazarusidestrconsts.dlgcoansistr
#, fuzzy
#| msgid "Use ansi strings"
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Usa stringhe Ansi"
#: lazarusidestrconsts.dlgcoasmstyle
#, fuzzy
#| msgid "Assembler style:"
msgid "Assembler style"
msgstr "Stile assembler:"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Messaggi"
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr ""
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr ""
#: lazarusidestrconsts.dlgcocops
#, fuzzy
#| msgid "C Style Operators (*=, +=, /= and -=)"
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Operatori stile C (*=, +=, /= e -=)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Crea il Makefile"
#: lazarusidestrconsts.dlgcodebugging
#, fuzzy
#| msgid "Debugging info"
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Debugging:"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Aggiunta cammino debugger (nessuno):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Creazione codice"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Entrambi"
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Chiudi"
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Nascondi"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Inverti ordine di chiusura nel Popup"
#: lazarusidestrconsts.dlgcogdb
#, fuzzy
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "Genera informazioni di debug per GDB (compilazione più lenta)"
#: lazarusidestrconsts.dlgcoheaptrc
#, fuzzy
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Usa la unit heaptrc"
#: lazarusidestrconsts.dlgcoincfiles
#, fuzzy
#| msgid "Include Files (-Fi):"
msgid "Include files (-Fi):"
msgstr "Includi i file (-Fi):"
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr ""
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Librerie (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Linking"
#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Carica/Salva"
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Colore"
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Edita colore)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Non modificato"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Colori"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametri della riga di comando (senza il nome dell'applicazione)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Make default indent for new line if comment opens at column:"
msgstr ""
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr ""
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend, if matched or not matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend, if matched or not matched (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend, if matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessage
#, fuzzy
#| msgid "Compiler Messages"
msgid "Compiler messages"
msgstr "Messaggi del compilatore"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr "File della lingua dei messaggi del compilatore"
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Opzioni compilatore"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Completa le proprietà"
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr ""
#: lazarusidestrconsts.dlgconfigfiles
#, fuzzy
#| msgid "Config Files:"
msgid "Config files"
msgstr "File di configurazione:"
#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Varie"
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr ""
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Overflow"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analisi"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Mantieni chiusure durante copia/incolla"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Copia la parola se non c'è selezione"
#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Intervallo"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr ""
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr ""
#: lazarusidestrconsts.dlgcoshowerr
#, fuzzy
#| msgid "Show Errors"
msgid "Show errors"
msgstr "Mostra gli errori"
#: lazarusidestrconsts.dlgcoshowoptions
#, fuzzy
#| msgid "Show Options"
msgid "&Show Options"
msgstr "&Mostra le opzioni"
#: lazarusidestrconsts.dlgcosmartlinkable
#, fuzzy
#| msgid "Smart Linkable"
msgid "Smart linkable"
msgstr "Collegamenti intelligenti"
#: lazarusidestrconsts.dlgcosources
#, fuzzy
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Altri sorgenti (file .pp/.pas, usati dall'IDE e non dal compilatore)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Stack"
#: lazarusidestrconsts.dlgcostrip
#, fuzzy
#| msgid "Strip Symbols From Executable"
msgid "Strip symbols from executable"
msgstr "Esegue strip sugli eseguibili"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automatico"
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr ""
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr ""
#: lazarusidestrconsts.dlgcounitstyle
#, fuzzy
#| msgid "Unit Style"
msgid "Unit style"
msgstr "Stile unit:"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Genera codice per valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Verbosità"
#: lazarusidestrconsts.dlgcppinline
#, fuzzy
#| msgid "C++ Styled INLINE"
msgid "C++ styled INLINE"
msgstr "INLINE in stile C++"
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "Ctrl-centro-click su un tab chiude gli altri"
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr ""
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Cursore oltre EOL"
#: lazarusidestrconsts.dlgcursorgroupoptions
#, fuzzy
#| msgid "Cursor:"
msgid "Cursor"
msgstr "Opzioni cursore:"
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Il cursore salta la selezione"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "Il cursore salta i tab"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Definita dall'utente (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Percorso editor"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Tipo di debugger e cammino"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Carattere dell'editor predefinito"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Valore predefinito"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Cancella il modello "
#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Scrivania"
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Bottoni -"
#: lazarusidestrconsts.dlgdesktopfiles
#, fuzzy
#| msgid "Desktop files"
msgid "Desktop Files"
msgstr "File della scrivania"
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Consigli:"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menu - "
#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr "Varie"
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Direzione"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Disabilita l'antialiasing"
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Usa il colore del margine destro"
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Disegna livelli di separazione"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Colore delle righe nidificate"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Colore della riga"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (locali)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Sezioni unit"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Clausola uses"
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (locali)"
#: lazarusidestrconsts.dlgedadd
#, fuzzy
#| msgid "Add..."
msgid "Add ..."
msgstr "Aggiungi..."
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Indietro"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Grassetto"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Sottocartella"
#: lazarusidestrconsts.dlgedcodetempl
#, fuzzy
#| msgid "Code templates"
msgid "Code Templates"
msgstr "Modelli di codice"
#: lazarusidestrconsts.dlgedcompleteblocks
#, fuzzy
#| msgid "Add close statement for pascal blocks"
msgid "Add close statement for Pascal blocks"
msgstr "Aggiungi istruzione di chiusura per blocchi pascal"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Definita dall'utente"
#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(ritardo di %s secondi)"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Visualizza"
#: lazarusidestrconsts.dlgededit
#, fuzzy
#| msgid "Edit..."
msgid "Edit ..."
msgstr "Modifica..."
#: lazarusidestrconsts.dlgedfiles
#, fuzzy
#| msgid "Editor files"
msgid "Editor Files"
msgstr "File dell'editor"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Completamento dell'identificatore"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Inverti"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignora i lock e usa il più lungo editor non usato"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignora i lock se l'editor è quello corrente"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignora i lock se l'editor è nella finestra corrente"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Bloccato se c'è testo nella vista"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Sbloccato"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Sbloccato se c'è testo nella vista centrata"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Nuovo tab, finestra esistente o nuova"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Nuovo tab in nuova finestra"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Nuovo tab in finestra esistente"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Questa opzione userà il più lungo editor inutilizzato per il file, anche se è bloccato o deve scorrere. L'ordine di focus delle finestre non viene considerato per decidere quale editor usare, anche nel caso in cui l'impostazione di \"ordina con lo stesso criterio\". Questa opzione avrà sempre successo e altre opzioni non sono testate."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Questa opzione controllerà se l'editor attivo attualmente ha il file destinazione, e se sì, userà l'editor attivo anche se è bloccato o se deve scorrere."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Questa opzione controllerà se c'è un editor nella finestra corrente per il file destinazione, e se c'è, userà quell'editor anche se è bloccato o se deve scorrere."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Questa opzione userà un editor bloccato (e solo bloccato), che non deve scorrere per poter mostrare la destinazione del salto (se il punto di salto è già visibile sullo schermo)."
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Questa opzione userà un qualunque editor non bloccato."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Questa opzione userà un editor non bloccato che non deve scorrere per mostrare la destinazione del salto (il punto di salto deve già essere visibile sullo schermo, tranne 2-5 righe in cima)."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Questa opzione aprirà un nuovo tab in una finestra esistente, o se sono tutte bloccate ne aprirà una nuova. Questa opzione avrà sempre successo e non ne saranno provate altre."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Se non ci sono tab sbloccati, questa opzione aprirà un nuovo tab in una nuova finestra (anche se si potrebbero usare altri tab in altre finestre). Questa opzione avrà sempre successo a non ne saranno provate altre."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "Se non ci sono tab sbloccati, questa opzione aprirà un nuovo tab in una finestra esistente (e solo in una esistente). Verrà aperto un tab solo se esiste una finestra, e solo se non ha ancora un editor per il file destinazione."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Corsivo"
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr ""
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Opzioni dell'editor"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Opzioni globali di schema"
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "Varie"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Off"
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "On"
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr ""
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Sottolineato"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Attributi dell'elemento"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Il tasto End salta all'end più vicino"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Chiede"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Nota: i file progetto sono tutti i file nella cartella del progetto"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Backup"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "File"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Griglia"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Lingua"
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Linee guida"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Varie"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Niente"
#: lazarusidestrconsts.dlgenvotherfiles
#, fuzzy
#| msgid "Other files"
msgid "Other Files"
msgstr "Altri file"
#: lazarusidestrconsts.dlgenvproject
#, fuzzy
#| msgid "Project"
msgid "Tabs for project"
msgstr "Progetto"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Focus sui messaggi dopo la compilazione"
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Spazio caratteri extra"
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Spazio riga extra"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Usa file di simboli debug gdb esterno"
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Estensione del file"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Trova il testo al cursore"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Pezzo"
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Spezza sezione"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Commento:"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Nodo"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Item"
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "List <>"
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Object (inherited, inline)"
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (locali)"
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Commento (* *)"
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (nidificati)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Commento { }"
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Commenti nidificati"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procedura)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedura"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Programma"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Commento //"
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Sezione unit"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (globali)"
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Commento"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Nodo"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Elaborazione istruzioni"
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Colore primo piano"
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Criterio di inserimento procedure"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Mantieni l'ordine delle procedure"
#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Percorso del compilatore (%s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Cartella sorgente di FPC"
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Marcatesto"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor form"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr ""
#: lazarusidestrconsts.dlgfromcursor
#, fuzzy
#| msgid "&From Cursor"
msgid "&From cursor"
msgstr "&Dal cursore"
#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Opzioni"
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Ottieni la posizione"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Globale"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Genera codice per gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Reperisci il colore"
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Colore della griglia"
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Ampiezza X griglia"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Ampiezza passo orizzontale della griglia"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Ampiezza Y griglia"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Ampiezza passo verticale della griglia"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Browse del codice"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Debugger"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Ambiente"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Annulla di Gruppo"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Mostra le linee guida"
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Spaziatura"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Collassato"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Colore spaziatura laterale"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Colore bordo spaziatura"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Indice separatori spaziatura"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Scorri mezza pagina"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr ""
#: lazarusidestrconsts.dlgheapsize
#, fuzzy
#| msgid "Heap Size"
msgid "Heap size"
msgstr "Ampiezza dell'Heap"
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Altezza:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Nascondi le finestre dell'IDE durante l'esecuzione"
#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr "Nascondi le icone dei messaggi"
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Nascondi tab in finestre monopagina"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Marca il colore"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Marca il colore del font"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "A sinistra del cursore"
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "Alla destra del cursore"
#: lazarusidestrconsts.dlghintsparametersendernotused
#, fuzzy
#| msgid "Show Hints for parameter \"Sender\" not used"
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Nascondi i consigli sul parametro \"Sender\""
#: lazarusidestrconsts.dlghintsunused
#, fuzzy
#| msgid "Show Hints for unused units in main source"
msgid "Show hints for unused units in main"
msgstr "Mostra consigli per unit non usate nei sorgenti"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Il tasto home salta all'inizio più vicino"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Applicazione host"
#: lazarusidestrconsts.dlgidentifiercompletion
#, fuzzy
#| msgid "Identifier completion"
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Completamento dell'identificatore"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Criterio degli identificatori"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Opzioni IDE:"
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ignora"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Includi le variabili di sistema"
#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr ""
#: lazarusidestrconsts.dlgindentstabsgroupoptions
#, fuzzy
#| msgid "Indent and Tabs"
msgid "Tabs"
msgstr "Opzioni capoverso/tabulazioni"
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Davanti ai metodi"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Il costruttore deve chiamarsi 'init' (e il distruttore 'done')"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr ""
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr ""
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert methods"
msgstr ""
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr ""
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Inserisci spazio dopo di"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Inserisci spazio prima di"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Intervallo in secondi"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Salti (es. metodi di salto)"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Mantieni la posizione X del cursore"
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr ""
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Mappatura tasti"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Errori di mappatura tasti"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Criterio delle parolechiave"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Consenti LABEL e GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Lingua"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Ultima (cioè alla fine del sorgente)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Cartella di Lazarus (predefinita per tutti i progetti)"
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Sinistra:"
#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "Guid lines Left,Top"
msgid "Guide lines Left,Top"
msgstr "colore per sinistra, cima"
#: lazarusidestrconsts.dlglevel1opt
#, fuzzy
#| msgid "Level 1 (quick and debugger friendly)"
msgid "1 (quick, debugger friendly)"
msgstr "Livello 1 (veloce e debugger amichevole)"
#: lazarusidestrconsts.dlglevel2opt
#, fuzzy
#| msgid "Level 2 (Level 1 + quick optimizations)"
msgid "2 (quick optimizations)"
msgstr "Livello 2 (Livello 1 + ottimizzazione veloce)"
#: lazarusidestrconsts.dlglevel3opt
#, fuzzy
#| msgid "Level 3 (Level 2 + slow optimizations)"
msgid "3 (slow optimizations)"
msgstr "Livello 3 (Livello 2 + ottimizzazione lenta)"
#: lazarusidestrconsts.dlglevelnoneopt
#, fuzzy
#| msgid "Level 0 (no extra optimizations)"
msgid "0 (no optimization)"
msgstr "Livello 0 (nessuna ottimizzazione)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Separazione righe"
#: lazarusidestrconsts.dlglinksmart
#, fuzzy
#| msgid "Link Smart"
msgid "Link smart"
msgstr "Link intelligente"
#: lazarusidestrconsts.dlglnumsbct
#, fuzzy
#| msgid "Display Line Numbers in Run-time Error Backtraces"
msgid "Display line numbers in run-time error backtraces"
msgstr "Mostra i numeri di linea nelle backtrace degli errori di esecuzione"
#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Carica impostazioni del desktop dal file"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Menu principale"
#: lazarusidestrconsts.dlgmainviewforms
#, fuzzy
#| msgid "View project forms"
msgid "View Project Forms"
msgstr "Visualizza le form del progetto"
#: lazarusidestrconsts.dlgmainviewframes
#, fuzzy
#| msgid "View project frames"
msgid "View Project Frames"
msgstr "Visualizza i frames del progetto"
#: lazarusidestrconsts.dlgmainviewunits
#, fuzzy
#| msgid "View project units"
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Visualizza le unit del progetto"
#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Percorso make"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margini e spaziatura laterale"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Colore marker"
#: lazarusidestrconsts.dlgmarkupgroup
#, fuzzy
#| msgid "Word under Caret Highlight"
msgid "Highlight of Word under Caret"
msgstr "Evidenzia la parola sotto il cursore"
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Cancella"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Nome"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr "Trova i confini delle parole fino a questa lunghezza:"
#: lazarusidestrconsts.dlgmarkupwordnokeyword
#, fuzzy
#| msgid "Ignore Keywords"
msgid "Ignore keywords"
msgstr "Ignora parole chiave"
#: lazarusidestrconsts.dlgmarkupwordnotimer
#, fuzzy
#| msgid "Disable Timer for Markup Current Word"
msgid "Disable timer for markup current word"
msgstr "Disabilita il timer per il markup della parola corrente"
#: lazarusidestrconsts.dlgmarkupwordtrim
#, fuzzy
#| msgid "Trim Spaces (when highlighting current selection)"
msgid "Trim spaces (when highlighting current selection)"
msgstr "Togli gli spazi (quando si evidenzia la selezione corrente)"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Contatore massimo"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Lunghezza riga massima:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "File recenti massimi"
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "File di progetto recenti massimi"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mescola metodi e proprietà"
#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr "Singolo"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Doppio"
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Triplo"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Quadruplo"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Qualunque"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Sinistra"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Centro"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Crea un fallback"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Cattura"
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Muovi cursore (extra)"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Azione su rilascio click del mouse"
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Azione"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Click"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Edita mouse"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Voce duplicata"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Questa voce è in conflitto con una esistente"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Bottone"
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "Cursore"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Contesto"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Click"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Azione"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Su/Giù"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Opzione"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Ordina"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorità"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Maiuscole"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Mouse"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Avanzato"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Comando IDE"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Tutto"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Spaziatura"
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Albero collassature"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Collassato [+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Espanso [-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Numeri di linea"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Testo"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Selezione"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Altre azioni usando lo stesso pulsante"
#: lazarusidestrconsts.dlgmouseoptotheracthint
#, fuzzy
#| msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Questi possono essere eseguiti a seconda dei tasti modificatori, impostazioni di fallthrough, Singolo/Doppio, Su/Giù..."
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtra tasti modificatori"
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorità"
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Messaggi"
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Multiselezione"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
#, fuzzy
#| msgid "Find editor for jump targets"
msgid "Find Editor for Jump Targets"
msgstr "Trova editor per bersagli di salto:"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Ordine da usare per editor che soddisfano gli stessi criteri"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Editor cliccato per ultimo per questo file"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editor (per il file) nella finestra cliccata più di recente"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Lista di priorità dei criteri per la scelta di un editor:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Pagine e finestre"
#: lazarusidestrconsts.dlgmultiwintabgroup
#, fuzzy
#| msgid "Notebook Tabs:"
msgid "Notebook Tabs"
msgstr "Tab del notebook:"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Assegnazione nomi"
#: lazarusidestrconsts.dlgnoautomaticrenaming
#, fuzzy
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Niente rinomina automatica"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr ""
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Nessuna evidenziazione"
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Posizione dei tab del notebook nel sorgente"
#: lazarusidestrconsts.dlgnotsplitlineafter
#, fuzzy
#| msgid "Do not split line after:"
msgid "Do not split line after"
msgstr "Non spezzare le righe dietro a:"
#: lazarusidestrconsts.dlgnotsplitlinefront
#, fuzzy
#| msgid "Do not split line In front of:"
msgid "Do not split line in front of"
msgstr "Non spezzare le righe davanti a:"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Analizzatore oggetti"
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Altezza dell'oggetto"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Varie"
#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Opzioni"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Impostazioni velocità"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Usa le impostazioni standard di Delphi"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Usa le impostazioni standard di Lazarus"
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr ""
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr ""
#: lazarusidestrconsts.dlgotherunitfiles
#, fuzzy
#| msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgid "Other unit files (-Fu) (delimiter is semicolon):"
msgstr "Altri file unit (-Fu) (il delimitatore è puntoevirgola):"
#: lazarusidestrconsts.dlgoverwriteblock
#, fuzzy
#| msgid "Overwrite Block"
msgid "Overwrite block"
msgstr "Sovrascrivi blocco"
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Consigli per le palette componenti"
#: lazarusidestrconsts.dlgpasext
#, fuzzy
#| msgid "Default pascal extension"
msgid "Default Pascal extension"
msgstr "Estensione Pascal predefinita"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Evidenzia istruzioni di controllo come parole chiave"
#: lazarusidestrconsts.dlgpasextkeywordsgroup
#, fuzzy
#| msgid "Extended Pascal keyword options"
msgid "Extended Pascal Keyword Options"
msgstr "Opzioni per parole chiave pascal estese"
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr ""
#: lazarusidestrconsts.dlgpassoptslinker
#, fuzzy
#| msgid "Pass options to linker (delimiter is space)"
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Passa le opzioni al linker (lo spazio è il delimitatore)"
#: lazarusidestrconsts.dlgpasstringkeywords
#, fuzzy
#| msgid "Highlight String keyword(s)"
msgid "Highlight \"String\" keyword(s)"
msgstr "Evidenzia parola chiave String"
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Predefinito"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Niente"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Solo \"String\""
#: lazarusidestrconsts.dlgpersistentblock
#, fuzzy
#| msgid "Persistent Block"
msgid "Persistent block"
msgstr "Blocco persistente"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Cursore persistente"
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Applicazione"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr ""
#: lazarusidestrconsts.dlgpoclearicon
#, fuzzy
#| msgid "Clear Icon"
msgid "&Clear Icon"
msgstr "Cancella l'icona"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Crea un bundle di applicazioni"
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr ""
#: lazarusidestrconsts.dlgpodpiaware
#, fuzzy
#| msgid "Dpi aware application (for Vista+)"
msgid "Enabled DPI Awareness (for Vista+)"
msgstr "L'applicazione usa i Dpi (da Vista in poi)"
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Form"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr ""
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Icona:"
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(dimensioni: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(nessuna)"
#: lazarusidestrconsts.dlgpoloadicon
#, fuzzy
#| msgid "Load Icon"
msgid "&Load Icon"
msgstr "Carica Icona"
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Varie"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr ""
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr ""
#: lazarusidestrconsts.dlgposaveicon
#, fuzzy
#| msgid "Save Icon"
msgid "&Save Icon"
msgstr "Salva Icona"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sessione"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titolo:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr ""
#: lazarusidestrconsts.dlgpouseappbundle
#, fuzzy
#| msgid "Use Application Bundle for running and debugging (darwin only)"
msgid "Use Application Bundle for running and debugging (Darwin only)"
msgstr "Usa Application Bundle per esecuzione e debug (solo darwin)"
#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes (windows only)"
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Usa il file manifest per abilitare i temi (solo Windows)"
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr ""
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Opzioni progetto"
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Opzioni per il progetto: %s"
#: lazarusidestrconsts.dlgprojfiles
#, fuzzy
#| msgid "Project files"
msgid "Project Files"
msgstr "File del progetto"
#: lazarusidestrconsts.dlgpromptonreplace
#, fuzzy
#| msgid "&Prompt On Replace"
msgid "&Prompt on replace"
msgstr "Conferma il rim&piazzo"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Completamento della proprietà"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Nome proprietà"
#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr "Chiudi automaticamente la dialog di compilazione"
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Apertura ultimo progetto alla partenza"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Mostra lo spazio di contorno"
#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Mostra il dialogo di compilazione"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Mostra la griglia"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Griglia magnetica"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Riferimento"
#: lazarusidestrconsts.dlgregularexpressions
#, fuzzy
#| msgid "Regular E&xpressions"
msgid "Regular e&xpressions"
msgstr "Espressione &regolare"
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Sostituisci &Tutto"
#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace With"
msgid "&Replace with"
msgstr "&Sostituisci con"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Rapporto"
#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "colore per destra, fondo"
#: lazarusidestrconsts.dlgrightclickselects
#, fuzzy
#| msgid "Right Click selects"
msgid "Right click selects"
msgstr "Tasto destro seleziona"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Margine destro"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Cartella di lavoro"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Seleziona nipote"
#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Creazione nastro"
#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Selezione a nastro"
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Display (non per win32, esempio 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Ambiente"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Locale"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variabili di sistema"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Usa DISPLAY"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Variabili utente (hanno la priorità su quelle di sistema)"
#: lazarusidestrconsts.dlgrunparameters
#, fuzzy
#| msgid "Run parameters"
msgid "Run Parameters"
msgstr "Parametri di esecuzione"
#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Salva le impostazioni del desktop su file"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Righe salvate"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Salva informazioni dell'editor per i file chiusi"
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Salva informazioni dell'editor solo per i file di progetto"
#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Campo di validità"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Scorrimento per uno di meno"
#: lazarusidestrconsts.dlgscrollgroupoptions
#, fuzzy
#| msgid "Scrolling:"
msgid "Scrolling"
msgstr "Opzioni scorrimento:"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Mostra il suggerimento per lo scorrimento"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Scorrimento fino alla fine del file"
#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Scorrimento fino alla fine della riga"
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Cartella di ricerca \"%s\" non trovata."
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Ricerca interrotta dall'utente."
#: lazarusidestrconsts.dlgsearchcaption
#, fuzzy
#| msgid "Searching..."
msgid "Searching ..."
msgstr "Ricerca in corso..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Percorsi"
#: lazarusidestrconsts.dlgselectedtext
#, fuzzy
#| msgid "&Selected Text"
msgid "&Selected text"
msgstr "Testo selezionato"
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Imposta tutti gli elementi come predefiniti"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Imposta l'elemento come predefinito"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Imposta la proprietà variabile"
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr ""
#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Mostra intestazioni componenti"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Mostra le procedure compilate"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Mostra numeri linee"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Mostra i condizionali"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Mostra le informazioni di debug"
#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Mostra dritte dell'editor"
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Mostra tutto"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Mostra info sll'eseguibile (solo Win32)"
#: lazarusidestrconsts.dlgshowfullfilenames
msgid "Show full file names"
msgstr ""
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Mostra le informazioni generali"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Mostra i suggerimenti"
#: lazarusidestrconsts.dlgshowhint
#, fuzzy
#| msgid "Show Hints"
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Mostra i suggerimenti"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Mostra numeri di riga"
#: lazarusidestrconsts.dlgshownotes
#, fuzzy
#| msgid "Show Notes"
msgid "Show notes"
msgstr "Mostra le note"
#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Non mostrare nulla (solo gli errori)"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Mostra il sommario"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Mostra i file provati"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Mostra il file usati"
#: lazarusidestrconsts.dlgshowwarnings
#, fuzzy
#| msgid "Show Warnings"
msgid "Show warnings"
msgstr "Mostra gli avvertimenti (warning)"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Mostra bottone singolo in TaskBar"
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr ""
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr ""
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Tab intelligenti"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Simbolo posposto (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Contatore (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Simbolo anteposto (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Linee guida magnetiche"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Spazio"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Consigli per i principali bottoni veloci (apri, salva, ...)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Sorgente editor"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Origine"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr ""
#: lazarusidestrconsts.dlgstatickeyword
#, fuzzy
#| msgid "Static Keyword in Objects"
msgid "Static keyword in objects"
msgstr "Parola chiave static nell'oggetto"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Ferma dopo un certo numero di errori:"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr ""
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr ""
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr ""
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Sottoproprietà"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Opzioni di sintassi"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab indenta i blocchi"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Mostra numeri di tab nel notebook"
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulazioni in spazi"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Larghezza Tab"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Famiglia di CPU di destinazione"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "OS destinazione"
#: lazarusidestrconsts.dlgtargetplatform
#, fuzzy
#| msgid "Target Platform"
msgid "Target platform"
msgstr "Piattaforma obiettivo"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Processore destinazione"
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr ""
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Cartella per costruire progetti di test"
#: lazarusidestrconsts.dlgtexttofind
#, fuzzy
#| msgid "&Text to Find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "&Testo da trovare"
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Cima:"
#: lazarusidestrconsts.dlgtrimspacetypecaption
#, fuzzy
#| msgid "Trim Spaces Style"
msgid "Trim spaces style"
msgstr "Stile di pulitura spazi"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Cursore o edit"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Riga modificata"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Lascia riga"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Solo posizione"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Elimina gli spazi oltre le righe"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Annulla dopo il salvataggio"
#: lazarusidestrconsts.dlgundogroupoptions
#, fuzzy
#| msgid "Undo / Redo:"
msgid "Undo / Redo"
msgstr "Annulla opzioni:"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limite dell'Undo"
#: lazarusidestrconsts.dlgunitdepcaption
#, fuzzy
#| msgid "Unit dependencies"
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "Dipendenze unit"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Aggiorna"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Cartella di output delle Unit (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Riga non salvata"
#: lazarusidestrconsts.dlgusecodefolding
#, fuzzy
#| msgid "Code folding"
msgid "Code Folding"
msgstr "Collassatura del codice"
#: lazarusidestrconsts.dlgusecustomconfig
#, fuzzy
#| msgid "Use additional Compiler Config File"
msgid "Use additional compiler config file"
msgstr "Usa altri file di configurazione per il compilatore"
#: lazarusidestrconsts.dlgusedividerdraw
#, fuzzy
#| msgid "Divider drawing"
msgid "Divider Drawing"
msgstr "Disegno di separatori"
#: lazarusidestrconsts.dlgusefpccfg
#, fuzzy
#| msgid "Use standard Compiler Config File (fpc.cfg)"
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Usa file di configurazione compilatore standard (fpc.cfg)"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Lancia da un altro programma:"
#: lazarusidestrconsts.dlguseminimumime
msgid "Ime handled by System"
msgstr ""
#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Caricamento fallito del file schema utente %s"
#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr "Usa (e edita) impostazioni globali di schema"
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Usa impostazioni locali di schema"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Usa evidenziatura sintassi"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Usa storico tab quando vengono chiusi"
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr ""
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Valore"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Livello dei dettagli mostrati durante la compilazione:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Spaziatura laterale visibile"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Margine destro visibile"
#: lazarusidestrconsts.dlgwholewordsonly
#, fuzzy
#| msgid "&Whole Words Only"
msgid "&Whole words only"
msgstr "Solamente parola intera"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Ampiezza:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Applicazione GUI Win32"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Finestre"
#: lazarusidestrconsts.dlgwinpos
#, fuzzy
#| msgid "Window Positions"
msgid "Window positions"
msgstr "Posizioni della finestra"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr ""
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Parole"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Anteprima"
#: lazarusidestrconsts.dlgwritefpclogo
#, fuzzy
#| msgid "Write an FPC logo"
msgid "Write FPC logo"
msgstr "Scrivi un logo FPC"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "I componenti selezionati piè¹ volte devono essere di una singola form"
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr ""
#: lazarusidestrconsts.fdmdeleteselection
#, fuzzy
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Cancella la selezione"
#: lazarusidestrconsts.fdmmirrorhorizontal
#, fuzzy
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Speculare orizzontale"
#: lazarusidestrconsts.fdmmirrorvertical
#, fuzzy
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Speculare verticale"
#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Indietro di uno"
#: lazarusidestrconsts.fdmorderforwardone
#, fuzzy
#| msgid "Forward one"
msgid "Forward One"
msgstr "Avanti di uno"
#: lazarusidestrconsts.fdmordermovetoback
#, fuzzy
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Sposta indietro"
#: lazarusidestrconsts.fdmordermovetofront
#, fuzzy
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Sposta in primo piano"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr ""
#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as XML"
msgid "Save Form as XML"
msgstr "Salva form come xml"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr ""
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Scala"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Seleziona tutto"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr ""
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Ampiezza"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opzione: griglia magnetica"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opzione: linee guida magnetiche"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Ordine Z"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Su ambo i lati"
#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr ""
#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr ""
#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgcolumnloc
msgid "Location"
msgstr ""
#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr ""
#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = no, 1 = disegna linee di divisione solo per livello principale, 2 = disegna linee per i primi due livelli ecc..."
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Aggiungi file"
#: lazarusidestrconsts.lisa2paddfilestopackage
#, fuzzy
#| msgid "Add files to package"
msgid "Add Files to Package"
msgstr "Aggiungi file al pacchetto"
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Aggiungi al pacchetto"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Tipo antenato ambiguo"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nome classe ambiguo"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nome unit ambiguo"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Tipo antenato"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
#, fuzzy
#| msgid "A pascal unit must have the extension .pp or .pas"
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Una unit pascal deve avere estensione .pp o .pas"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dipendenza errata"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Il nome della classe esiste già"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr ""
#: lazarusidestrconsts.lisa2pcreatenewfile
#, fuzzy
#| msgid "Create new file"
msgid "Create New File"
msgstr "Crea un nuovo file"
#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr ""
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dipendenza"
#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Il file esiste già"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File %s%s%s already exists in the package."
msgstr ""
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Il file è in uso"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Nome file"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Il file non è una unit"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Tipo antenato non valido"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nome classe non valida"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "File non valido"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nome file non valido"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nome unit non valida"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s non è un nome unit valido."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nome nuova classe:"
#: lazarusidestrconsts.lisa2pnewcomponent
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
msgid "New Component"
msgstr "Nuovo componente"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nuovo File"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Non è stato trovato un pacchetto per la dipendenza %s%s%s.%sScegliere un pacchetto esistente."
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nome pagina troppo lungo"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Pagina palette:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Le unit pascal devono avere l'estensione .pp o .pas"
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Salva file video"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Riduci o espandi il nome del file"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Mostra tutto"
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Scambia percorsi"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Il tipo di antenato %s%s%s ha lo stesso nome%sdella unit %s%s%s."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, fuzzy
#| msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
msgstr "Il tipo antenato %s%s%s non è un identificatore pascal valido."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "In nome della classe %s%s%s e il tipo di antenato %s%s%s sono uguali."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "In nome classe %s%s%s esiste già nel%sPacchetto %s%sFile: %s%s%s"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Il nome classe %s%s%s è lo stesso%sdella unit %s%s%s. "
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The class name %s%s%s is not a valid pascal identifier."
msgid "The class name %s%s%s is not a valid Pascal identifier."
msgstr "Il nome classe %s%s%s non è un identificatore pascal valido."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Il file %s%s%s è parte del progetto corrente.%sNon è consigliato condividere file tra progetti e pacchetti."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Il nome del file %s%s%s è ambiguo dato che il pacchetto non possiede ancora una cartella predefinita.%sSpecificare un nomefile con un cammino completo."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "La versione massima %s%s%s è invalida. Si prega di usare il formato major.minor.release.build%sPer esempio: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La versione massima è inferiore della versione minima"
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "La versione minima %s%s%s è invalida. Si prega di usare il formato major.minor.release.build%sPer esempio: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, fuzzy
#| msgid "The package has already a dependency for the package %s%s%s."
msgid "The package already has a dependency on the package %s%s%s."
msgstr "Il pacchetto possiede già una dipendenza per il pacchetto %s%s%s."
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Il nome del pacchetto %s%s%s non è valido.%sScegliere un pacchetto esistente."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Il nome pagina %s%s%s è troppo lungo (max 100 caratteri)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Il nome unit %s%s%s esiste già nel pacchetto:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "In nome unit %s%s%s esiste già in questo pacchetto."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Il nome della unit %s%s%s%s ed il nome del file %s%s%s sono differenti."
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Il nome unit %s%s%s non corrisponde al nome file."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, fuzzy
#| msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Il nome della unit %s%s%s è lo stesso di un componente registrato.%sL'uso di questo puè² provocare messaggi di errore imprevedibili."
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Nome file unit:"
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Nome unit:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Il nome unit esiste già"
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Nome unit non valido"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Abbandonare i cambiamenti?"
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Interrompi tutto"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Interrompi tutto il caricamento"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Interrompi il caricamento del progetto"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Interrompi l'intero caricamento"
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Documentazione"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Informazioni sull'IDE"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Informazioni su Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Licenza: GPL/LGPL. Vedere i sorgenti Lazarus e Free Pascal per dettagli sulla licenza.%sLazarus è una IDE per creare programmi grafici e console con Free Pascal. Free Pascal è un compilatore Pascal e Object Pascal che gira su Windows, Linux, Mac OS X, FreeBSD e altri.%sLazarus è la parte mancante del puzzle vi permetterà di creare programmi in un ambiente simile a Delphi per tutte le piattaforme menzionate. L'IDE è uno strumento RAD che comprende un disegnatore di form.%sPiù Lazarus cresce, più ci servono nuovi sviluppatori."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Lista dei contributori non trovata"
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Ufficiale:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, fuzzy
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgstr "Un %s non può avere TControls.$sPotete porvi sopra solo componenti non visuali."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Riconoscimenti"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Azione:"
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Azioni:"
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Attiva la sintassi delle espressioni regolari per il testo e per la sostituzione (quasi come in perl)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr ""
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Attivo"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Filtri attivi"
#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Aggiungi"
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr ""
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr ""
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr ""
#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr ""
#: lazarusidestrconsts.lisaddfilesindirectory
msgid "Add Files in Directory"
msgstr ""
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr ""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Aggiungi nuova modalità di build e copia le impostazioni da \"%s\""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Aggiungi nuova macro"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Aggiungi nuovo insieme"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Aggiungi requisiti di pacchetto?"
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "Aggiungi pacchetto %s al progetto?"
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Aggiungi il package al progetto"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Aggiungi parentesi ai parametri"
#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr ""
#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Aggiungere %s al progetto?"
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Aggiungi interfacce unit"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Aggiungi unit (sconsigliato)"
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Aggiungi valore alla macro %s"
#: lazarusidestrconsts.lisaf2paddfiletoapackage
#, fuzzy
#| msgid "Add file to a package"
msgid "Add File to Package"
msgstr "Aggiungi un file a un pacchetto"
#: lazarusidestrconsts.lisaf2pdestinationpackage
#, fuzzy
#| msgid "Destination Package"
msgid "Destination package"
msgstr "Pacchetto di destinazione"
#: lazarusidestrconsts.lisaf2pfiletype
#, fuzzy
#| msgid "File Type"
msgid "File type"
msgstr "Tipo file"
#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Possiede una procedura di registrazione"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Pacchetto non valido"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "ID pacchetto non valido: %s%s%s"
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Il pacchetto è a sola lettura"
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Pacchetto %s%s%s non trovato."
#: lazarusidestrconsts.lisaf2pshowall
#, fuzzy
#| msgid "Show All"
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Mostra tutto"
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Il file %s%s%s%ssi trova già nel pacchetto %s."
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Il pacchetto %s è a sola lettura."
#: lazarusidestrconsts.lisaf2punitname
#, fuzzy
#| msgid "Unit Name: "
msgid "Unit name: "
msgstr "Nome unit:"
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Un file %s%s%s esiste gia.%sLo sostituisco?"
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr ""
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Allineamento"
#: lazarusidestrconsts.lisallblockslooksok
#, fuzzy
#| msgid "All blocks looks ok."
msgid "All blocks look ok."
msgstr "Tutti i blocchi sembrano ok"
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr ""
#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Tutti i files"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Tutte le opzioni ereditate"
#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr ""
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Permetti chiamate a funzioni"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Permetti la ricerca per righe multiple"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Tutte le modifice a %s%s%s%s saranno perse se il file viene riaperto"
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Tasti alternativi"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Tasti alternativi (o sequenza di 2 tasti)"
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Sempre"
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr ""
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Ignora sempre"
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Trovato file ambiguo"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Trovato file ambiguo: %s%s%s%sQuesto file può essere confuso con %s%s%s%s%sCancellare il file ambiguo?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Trovati file ambigui"
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Trovata unit ambigua"
#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Trovata unit ambigua"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Anchor Editor - nessun controllo selezionato"
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Abilitato = Include %s è in Anchors"
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ancoraggi dei controlli selezionati"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "L'ultimo startup è incorso in un errore mentre veniva caricato %s!%s%sCaricare di nuovo questo progetto?"
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Nome della classe dell'applicazione"
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr ""
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Applica"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "Applica i flagi di build anche alle dipendenze"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Applica convenzioni"
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Una unit del progetto non può essere usata da altri package/progetti"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Spazio dal bordo attorno al controllo. Gli altri quattro spazi di bordo sono sommati a questo valore"
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Chiedi prima di sostituire ogni testo trovato"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr ""
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "Chiedi il nome del componente dopo averlo messo su un form designer"
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Chiedi il nome del file per ogni nuovo file"
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Chiedi il nome alla creazione"
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr ""
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Completamento automatico: off"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Completamento automatico: on"
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Continua automaticamente dopo:"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Markup e corrispondenze"
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automatico"
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr "Converti automaticamente i file .lfm in file include .lrs"
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Invoca automaticamente dopo il punto "
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "Interruzione di riga"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "spazio"
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "fine parola"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "non aggiungere caratteri"
#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Funzioni automatiche"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Mostra automaticamente"
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr ""
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr ""
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Fai un backup dei file modificati"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Backup file fallito"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Crea una sottocartella di backup nella cartella del progetto"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Cambiare il nome pacchetto o la versione interrompe le dipendenze. Si desidera cambiare anche le dipendenze?%sBattete Sì se volete cambiare tutte le dipendenze elencate%so Ignora per interrompere le dipendenze e continuare."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "inizia"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "dietro i correlati"
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
#, fuzzy
#| msgid "Always Build before Run"
msgid "Always build before run"
msgstr "Fai sempre la build prima di eseguire"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Comando di costruzione"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Invece di costruisci progetto esegui il comando Costruisci File"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Invece di lancia progetto esegui il comando Lancia File"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Esegui comando"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
#, fuzzy
#| msgid "When this file is active in source editor ..."
msgid "When this file is active in source editor"
msgstr "Quando questo file è attivo nell'editor dei sorgenti ..."
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
#, fuzzy
#| msgid "Working directory (Leave empty for file path)"
msgid "Working directory (leave empty for file path)"
msgstr "Cartella di lavoro (lasciare vuoto per il cammino)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Grassetto per valori non standard"
#: lazarusidestrconsts.lisborderspace
#, fuzzy
#| msgid "BorderSpace"
msgid "Border space"
msgstr "SpazioBordo"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Spazio del bordo inferiore. Questo valore viene aggiunto al bordo inferiore, ed è usato per lo spazio sotto il controllo."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Ancora inferiore"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Code"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Questo è il controllo compagno a cui il bordo inferiore è ancorato. Lasciare vuoto per il controllo padre."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Stessa spaziature al fondo"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Divisione"
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Proprietà del breakpoint"
#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Aggiungi"
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Chiudi"
#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Cancella"
#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr ""
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Sostituire ..."
#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "&Abilitato"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Trova"
#: lazarusidestrconsts.lisbtnquit
#, fuzzy
#| msgid "Quit"
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "&Esci"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Rimuovi"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Sostituisci"
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Costruisci"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "Costruisci tutti i file del progetto/pacchetto/IDE"
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Costruisci"
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "Costruisci l'IDE con i pacchetti"
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Costruzione di Lazarus fallita"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Differenza fra modi di costruzione"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
#, fuzzy
#| msgid "Differences to other build modes"
msgid "Differences from other build modes"
msgstr "Differenza con altri modi di costruzione"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Modo:"
#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr ""
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Modi di costruzione"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Costruisci un nuovo progetto"
#: lazarusidestrconsts.lisbuildnumber
#, fuzzy
#| msgid "Build Number"
msgid "Build number"
msgstr "Numero di costruzione"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Costruisci"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr ""
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Chiamata di %s per creare un nuovo makefile da %s fallita."
#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr ""
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Annulla"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Annulla il caricamento di questo componente"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Annulla il caricamento della unit"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Annulla rinomina"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Non posso compilare il progetto"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
#, fuzzy
#| msgid "Can not copy top level component."
msgid "Cannot copy top level component."
msgstr "Impossibile copiare il componente principale."
#: lazarusidestrconsts.liscannotcreatefile
#, fuzzy
#| msgid "Can not create file %s%s%s"
msgid "Cannot create file %s%s%s"
msgstr "Impossibile creare il file %s%s%s"
#: lazarusidestrconsts.liscannotfindlazarusstarter
#, fuzzy
#| msgid "Cannot find lazarus starter:%s%s"
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Impossibile trovare esecutore di Lazarus:%s%s"
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr ""
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Si può cambiare solo la classe dei TComponents."
#: lazarusidestrconsts.liscaptiondiff
msgctxt "lazarusidestrconsts.liscaptiondiff"
msgid "Diff"
msgstr "Diff"
#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr ""
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Cambia la Classe di %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "nessuna classe"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Compilatore ambiguo"
#: lazarusidestrconsts.lisccochecktestdir
#, fuzzy
#| msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Controllare la cartella di test sotto %sAmbiente -> Opzioni ambiente -> Files -> Cartella per la build di progetti di prova"
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Il compilatore \"%s\" non è un file eseguibile.%sDettagli: %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "contiene"
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Copia l'output alla clipboard"
#: lazarusidestrconsts.lisccodatesdiffer
#, fuzzy
#| msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Le date dei file .ppu di FPC differiscono di oltre un'ora. E' possibile che provengano da due diverse installazioni.%sFile1: %s%"
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Errore"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ERRORE: "
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Il cammino delle unit FPC contiene un sorgente: "
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "nuovi simboli di riga"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "SUGGERIMENTO: "
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Compilatore invalido"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Percorso di ricerca invalido"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Cartella di test invalida"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Unit mancante"
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "Unit FPC compilata non trovata: %s.ppu"
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "trovate configurazioni multiple del compilatore:"
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "fpc.cfg non trovato"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "non ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "file .ppu doppio: %s, %s"
#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "L'unità compilata FPC %s.ppu non è stata trovata.%sIn genere significa che il vostro file fpc.cfg è errato, o che la vostra installazione di FPC è danneggiata."
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Uno dei file .ppu è più vecchio del compilatore stesso:%s%s"
#: lazarusidestrconsts.lisccoseveralcompilers
#, fuzzy
#| msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "C'è più di un compilatore FreePascal nel vostro path.%s%s%sAvete dimenticato di cancellare un vecchio compilatore?"
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Salta"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "caratteri speciali"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Tutti i test sono stati superati"
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Non posso creare il Test File"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, fuzzy
#| msgid "Unable to create Test pascal file \"%s\"."
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Non posso creare il Test file pascal \"%s\"."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "caratteri insoliti"
#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Attenzione:"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ATTENZIONE:"
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "Delimitatore di path errato"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Categorie"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Complessità"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Costanti"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Blocchi vuoti"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Sezioni classe vuote"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Costruttori vuoti"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Procedure vuote"
#: lazarusidestrconsts.liscefilter
#, fuzzy
#| msgid "(Filter)"
msgid "(filter)"
msgstr "(Filtro)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Segui il cursore"
#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s in %s"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "E' un controllo principale"
#: lazarusidestrconsts.liscelongparamlistcount
#, fuzzy
#| msgid "Parameters count treating as \"many\""
msgid "Parameters count treated as \"many\""
msgstr "Conteggio parametri trattato come \"molti\""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Procedure lunghe"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Conteggio righe di procedura trattato come \"lunghe\""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Molte procedure nidificate"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Molti parametri"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Mostra categorie"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Mostra nodi sorgente"
#: lazarusidestrconsts.liscenestedproccount
#, fuzzy
#| msgid "Nested procedures count treating as \"many\""
msgid "Nested procedures count treated as \"many\""
msgstr "Conteggio procedure nidificate trattato come \"molte\""
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr ""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
#, fuzzy
#| msgid "Center control horizontally relative to the given sibling"
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Centra il controllo orizzontalmente rispetto al controllo compagno"
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
#, fuzzy
#| msgid "Center control vertically relative to the given sibling"
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Centra il controllo verticalmente rispetto al controllo compagno"
#: lazarusidestrconsts.liscenterform
#, fuzzy
#| msgid "Center form"
msgid "Center Form"
msgstr "Centra form"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centra nella finestra"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Centra"
#: lazarusidestrconsts.lisceomode
#, fuzzy
#| msgid "Preferred Exhibition Mode"
msgid "Preferred exhibition mode"
msgstr "Modo preferito di visualizzazione"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Categoria"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Sorgente"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Mai, solo manualmente"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Usato solo in modalità categoria"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Se inutilizzato"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Aggiorna automaticamente"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Varie"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Aggiorna"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Durante lo switch dei file nell'editor dei sorgenti"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedure"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Proprietà"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Proprietà pubblicate senza default"
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr "Mostra osservazioni su"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Stile"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Cose da fare"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Tipi"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Costanti anonime"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Membri non ordinati"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Visibilità non ordinata"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Variabili"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Indentazione errata"
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occured during deletion of%s\"%s:%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr ""
#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr ""
#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr ""
#: lazarusidestrconsts.liscfeinfile
msgid "%sIn file %s%s"
msgstr ""
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr ""
#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr ""
#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr ""
#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr ""
#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr ""
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr ""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr ""
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Cambia"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Cambia modo di build"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Cambia classe"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr ""
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Cambia codifica"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Cambia file"
#: lazarusidestrconsts.lischangeparent
#, fuzzy
#| msgid "Change Parent..."
msgid "Change Parent"
msgstr "Cambia padre..."
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr ""
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr ""
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr ""
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Caratteri"
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Mappa caratteri"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr ""
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontentratherthantimesta
msgid "Check for disk file changes via content rather than timestamp"
msgstr ""
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr "Controlla se il prossimo token nel sorgente è un END: se non lo è, mette un END su una nuova riga e va a capo"
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Controlla opzioni"
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Scegliere un nome differente"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr ""
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Scegli un link FPDoc"
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Scegli un tasto ..."
#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "Scegli un nome per il nuovo componente"
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr ""
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr ""
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
#, fuzzy
#| msgid "Choose a pascal file for indentation examples"
msgid "Choose a Pascal file for indentation examples"
msgstr "Scegli un file pascal per esempi di indentazione"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Scegli un file di messaggi del compilatore"
#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Scegli il nome file del compilatore (%s)"
#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Scegliere il nome file del debugger"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Scegli un pacchetto Delphi (*.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Scegli un pacchetto Lazarus (*.lpk)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Scegli la unit Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Scegliere la cartella"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Scegliere la cartella sorgente FPC"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Scegliere la cartella di Lazarus"
#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Scegli il cammino make"
#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Scegli un nome"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Scegli una di queste voci per creare un nuovo File"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Scegli uno di queste voci per creare un nuovo Package"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Scegli una di queste voci per creare un nuovo Progetto"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Scegli uno di questi oggetti quello da cui ereditare"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Scegliere sorgente programma (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Scegli la struttura per racchiudere la selezione"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Scegli la cartella per i test"
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Completamento di classe"
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Classi e proprietà esistono già. i valori non sono stati controllati."
#: lazarusidestrconsts.lisclassesppunotfoundcheckyourfpccfg
msgid "classes.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "La classe %s%s%s non è una classe di componente registrata.%sImpossibile incollare."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Classe non trovata"
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Classe %s%s%s del metodo %s%s%s non trovata."
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Pulisci la cartella"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Pulisci le sottocartelle"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Mantieni tutti i file di testo"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Mantieni tutti i file che corrispondono al filtro"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Elimina tutti i file che corrispondono al filtro"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Sintassi semplice (cioè * invece di .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr ""
#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr ""
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Pulisci sorgenti Lazarus"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr ""
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuild
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr ""
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Pulisco il cammino dei moduli?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Clear"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Pulisci cartella"
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr ""
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Clicca qui per sfogliare i file"
#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr "Clicca per vedere i possibili usi"
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr ""
#: lazarusidestrconsts.lisclose
#, fuzzy
#| msgid "&Close"
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "&Chiudi"
#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Chiudi tutto"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Chiudi i file"
#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "Nascondi la finestra"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Chiusura di una finestra editor di sorgente. Vuoi chiudere tutti i file oppure nascondere la finestra?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Chiudi la finestra di editing sorgenti"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opzioni specifiche interfaccia LCL:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parametro"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Componenti"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Eredità"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Lista"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Tavolozza"
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr ""
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "File di configurazione del compilatore aggiuntivo ambiguo"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Chiamata su:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, fuzzy
#| msgid "%s%sClick OK if you are sure to do that."
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sClicca OK se sei sicuro di volerlo fare."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Comando:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Codice"
#: lazarusidestrconsts.liscodebrowser
#, fuzzy
#| msgid "Code browser"
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Navigatore del codice"
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Browser del codice"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Opzioni di generazione del codice"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Aggiungi cammino"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Esplora"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Conferma sostituzione"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Crea oggetto di aiuto"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Rimuovi il cammino"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Descrizione"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Errori"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Esempio"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr ""
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Inserisci tag di formattazione grassetto"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Inserisci il tag di formattazione codice"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Inserisci it tag di formattazione corsivo"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Inserisci il tag di formattazione evidenziato"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Inserisci il tag di formattazione sottolineato"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Inserisci il tag di formattazione Var"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Ereditati"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Inserisci un link ..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Inserisci il tag di formattazione paragrafo"
#: lazarusidestrconsts.liscodehelpmainformcaption
#, fuzzy
#| msgid "FPDoc editor"
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(nessuna descrizione ereditata trovata)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NESSUNO>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Vedi anche"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Breve descrizione di"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Breve"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgid "Ignore constants in next functions"
msgstr "Ignora le costanti nelle prossime funzioni"
#: lazarusidestrconsts.liscodeobscharconst
msgid "Search for unnamed char constants"
msgstr "Cerca costanti char anonime"
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Osservatore del codice"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgid "Ignore next unnamed constants"
msgstr "Ignora le prossime costanti anonime"
#: lazarusidestrconsts.liscodetempladd
#, fuzzy
#| msgid "Add"
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Aggiungi"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Aggiungi modello di codice"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "Esiste già un token %s%s%s!"
#: lazarusidestrconsts.liscodetemplautocompleteon
#, fuzzy
#| msgid "Auto complete on ..."
msgid "Auto complete on"
msgstr "Completamento automatico su..."
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Cambia"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Commento:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Modifica il modello di codice"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Errore"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Azione: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, fuzzy
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "I nodi auto creati non si possono modificare, %se non possono avere nodi figlio auto creati."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, auto generata"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
#, fuzzy
#| msgid "Auto generated nodes can not be edited."
msgid "Auto generated nodes cannot be edited."
msgstr "I nodi autogenerati non si possono modificare"
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blocco"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor dei define dei CodeTool"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
#, fuzzy
#| msgid "compiler path"
msgid "Compiler path"
msgstr "cammino del compilatore"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Converti nodo"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Crea i define per la cartella %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Crea i define per il compilatore Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Crea i Define per il codice sorgente SVN di Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Crea i define per il progetto %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Crea Macro FPC e percorsi per una cartella progetto fpc"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Define"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Define ricorsivamente"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Cancella nodo"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "La %s cartella principale,%sdove Borland ha installato tutti i %s sorgenti.%sPer esempio: C:/Programmi/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "La %s cartella principale,%sdove Borland ha installato tutti i %s sorgenti,%susati da questo %s progetto.%sPer esempio: C:/Programmi/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Descrizione:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "cartella %s"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Esci senza salvare"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Cartella dei sorgenti SVN di FPC"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Cartella"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Inserisci il modello di compilatore Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Inserisci modello di directory Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Inserisci modello di progetto Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Inserisci modello di directory Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Inserisci modello di directory Delphy 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Inserisci modello di progetto Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Inserisci modello di compilatore Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Inserisci modello di directory Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Inserisci modello di progetto Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Inserisci modello di compilatore Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Inserisci modello di progetto Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Inserisci il modello del sorgente SVN di Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Inserisci modello di compilatore Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Inserisci modello di directory Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Inserisci modello di progetto Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Inserisci nodo figlio"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Inserisci nodo qui sotto"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Inserisci modello"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Genitore non valido"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Nodo genitore non valido"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Nodo precedente non valido"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "La %s directory principale,%sdove Borland ha installato tutti i %s sorgenti.%sPer esempio: /home/utente/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "La %s directory principale,%sdove Borland installa tutti i %s sorgenti,%susati da questo %s progetto.%sPer esempio: /home/utente/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Sposta il nodo giù"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Sposta il nodo di un livello giù"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Sposta il nodo di un livello su"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Sposta il nodo su"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nuovo nodo"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Il nodo è in sola lettura"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "nessuna selezionata"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
#, fuzzy
#| msgid "Parent node can not contain child nodes."
msgid "Parent node cannot contain child nodes."
msgstr "Il nodo genitore non può contenere nodi figlio."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Il nodo precedente non può contenere nodi figli"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Cartella progetto"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "directory progetto %s"
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Errore di lettura"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Salva ed esci"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Seleziona nodo"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
#, fuzzy
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "La cartella dei sorgenti SVN di Free Pascal (non richiesto). Questo migliora la ricerca delle dichiarazioni ed il debugging."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Cartella del progetto Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "La cartella dei sorgenti SVN di Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, fuzzy
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Il cammino per il compilatore Free Pascal.%s Per esempio %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
#, fuzzy
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Il cammino al compilatore Free Pascal per questo progetto. Richiesto unicamente se è stato settato il sorgente FPC SVN sottostante . Utilizzato per ricreare le macro."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "La %s cartella del progetto,%sche contiene il file .dpr e dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Undefine"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Undefine a tutto"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Undefine ricorsivamente"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Valore come path di file"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Valore testo"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variabile:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Errore di scrittura"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Chiocciola"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Parentesi"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Duepunti"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Virgola"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identificatore"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Parola chiave"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "A capo"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Niente"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Numero"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Punto"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Puntoevirgola"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Spazio"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Costante stringa"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Simbolo"
#: lazarusidestrconsts.liscodetoolstemplatefile
msgid "CodeTools template file"
msgstr ""
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Esegui dopo"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Esegui prima"
#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr ""
#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr ""
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr ""
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Comprimi tutte le classi"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Comprimi tutti i pacchetti"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Comprimi tutte le unit"
#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr ""
#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr ""
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Comandi da lanciare dopo la pubblicazione"
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Comando post-pubblicazione non valido"
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Comando dopo la pubblicazione di un modulo"
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Parametri dalla linea di comando"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametri della riga di comando del programma"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Compila"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compilatore"
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr ""
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Errore: compilatore non valido: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nome file del compilatore"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
#, fuzzy
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Dritta: imposta il cammino del compilatore in Ambiente->Opzioni di ambiente->File->Percorso compilatore"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Nota: non è stato trovato il file configurazione codetools - uso i default"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Nota: caricamento vecchio file opzioni codetools: "
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Compila"
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (compilazione ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Mostra righe di consigli lunghe"
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Estendi all'estrema sinistra"
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Estendi un pò a sinistra"
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Mai"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Estendi solo a destra"
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
#, fuzzy
#| msgid "Component name \"%s\" is a pascal keyword."
msgid "Component name \"%s\" is a Pascal keyword."
msgstr "Il nome del componente \"%s\" è una parola chiave pascal"
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Il nome del componente %s%s%s è una parola chiave"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Il nome del componente %s%s%s non è un identificatore valido"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr ""
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Apri package"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Apri unit"
#: lazarusidestrconsts.liscomptest
#, fuzzy
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Test"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Condizione"
#: lazarusidestrconsts.lisconditionals
#, fuzzy
#| msgid "Conditionals:"
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Condizionali:"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Cartella della configurazione di Lazarus"
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Configura la costruzione %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Configura la %scostruzione di Lazarus%s"
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr ""
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr ""
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus sarà ricostruito con i seguenti profili:%sContinuo?"
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Conferma i cambiamenti"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Conferma cancellazione"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy
#| msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Vuoi ricostruire Lazarus con il profilo: %s?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Conferma il nuovo gruppo di package per la IDE"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Azione"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Nuovo gruppo di package"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Vecchio gruppo di package"
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Applicazione console"
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr ""
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Codice del costruttore"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "contiene"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Sensibile al contesto"
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Continua"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Continua e non chiedere più"
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Continua senza caricare la form"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Contributors"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Il controllo necessita del genitore"
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr ""
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "E' stato aggiunto un offset alla coordinata Top nei contenitori visuali"
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Offset delle coordinate"
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "I file delle unit saranno cercati in tutte le sottocartelle"
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "BeginCodeTools ha fallito!"
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Categorie:"
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Conversione abortita."
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Conversione pronta."
#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Converti package Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Converti progetto Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Converti unit Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertingfile
msgid "* Converting file %s *"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Errore=\"%s\""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Conversione di unit fallita"
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr "Impossibile convertire la unit%s%s%s"
#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifixingusedunits
msgid "* Fixing used units for file %s *"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Funzione Delphi"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) include file mancante"
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Nome Delphi"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Il nome del package esiste già"
#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
msgid "Removed unit \"%s\" in uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfile
#, fuzzy
#| msgid "Repairing form file %s"
msgid "* Repairing form file %s *"
msgstr "Riparazione del file del form %s"
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
#, fuzzy
#| msgid "*** Repairing form files ... ***"
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Riparazione dei file dei form... ***"
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Sostituita unit \"%s\" con \"%s\" nella sezione uses."
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "C'è già un package di nome\"%s\"%sPer favore chiudere questo package prima."
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Unit da sostituire in %s"
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Errore di conversione"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Converti"
#: lazarusidestrconsts.lisconvertencoding
#, fuzzy
#| msgid "Convert encoding"
msgid "Convert Encoding"
msgstr "Converti codifica"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Converti codifica dei progetti/pacchetti"
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Converti progetto o pacchetto"
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr ""
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "La conversione aggiunge compilazione condizionale per supportare diverse piattaforme destinazione"
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Sostituzione di funzione"
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Alcune funzioni Delphi si possono sostituire con funzioni LCL"
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Funzioni / procedure da sostituire"
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Offset sinistro"
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Nuovo nome"
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Container padre"
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Offset Top"
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Sostituzione di tipo"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Tipo sconosciuto in file del form (DFM/LFM)"
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Tipi da sostituire"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Sostituzione unit"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Nomi di unit nella sezione uses del sorgente di una unit"
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Unit da sostituire"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Proprietà sconosciute"
#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Copia"
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Copia tutto"
#: lazarusidestrconsts.liscopyallitemstoclipboard
#, fuzzy
#| msgid "Copy all items to clipboard"
msgid "Copy All Items to Clipboard"
msgstr "Copia tutti gli oggetti negli appunti"
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Copia tutto l'output negli appunti"
#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
#, fuzzy
#| msgid "Copy all shown and hidden messages to clipboard"
msgid "Copy All Shown and Hidden Messages to Clipboard"
msgstr "Copia tutti i messaggi mostrati e nascosti negli appunti"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
#, fuzzy
#| msgid "Copy all shown messages to clipboard"
msgid "Copy All Shown Messages to Clipboard"
msgstr "Copia tutti i messaggi mostrati negli appunti"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Copia la descrizione negli appunti"
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Errore di copia"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Errore di copia"
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr "Copia %s%s%s negli appunti"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "La copia di una form intera non è stata implementata."
#: lazarusidestrconsts.liscopyitemtoclipboard
#, fuzzy
#| msgid "Copy item to clipboard"
msgid "Copy Item to Clipboard"
msgstr "Copia oggetto negli appunti"
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
#, fuzzy
#| msgid "Copy selected items to clipboard"
msgid "Copy Selected Items to Clipboard"
msgstr "Copia gli oggetti selezionati negli appunti"
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
#, fuzzy
#| msgid "Copy selected messages to clipboard"
msgid "Copy Selected Messages to Clipboard"
msgstr "Copia i messaggi selezionati negli appunti"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Cerca i messaggi FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Cerca i messaggi Make"
#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr ""
#: lazarusidestrconsts.liscoskipcallingcompiler
#, fuzzy
#| msgid "Skip calling Compiler"
msgid "Skip calling compiler"
msgstr "Salta la chiamata al compilatore"
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr "Non posso aggiungere %s{$I %s%s} al sorgente principale!"
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr "Non posso aggiungere %s{$R %s%s} al sorgente principale!"
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr "Non posso aggiungere %s%s%s al sorgente principale!"
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr "Non posso togliere %s%s%s dal sorgente principale!"
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr "Non posso togliere %s{$I %s%s} dal sorgente principale!"
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr "Non posso togliere %s{$R %s%s} dal sorgente principale!"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
#, fuzzy
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Attenzione: il file aggiuntivo di configurazione del compilatore ha lo stesso nome di un file di configurazione standard del compilatore Free Pascal. Verrà letto SOLO il file di configurazione aggiuntivo e non quello standard."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Apri il pacchetto %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Apri la unit %s"
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Crea prima un progetto!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr ""
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Creare cartella?"
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Crea funzione"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Crea nodo di aiuto"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Crealo"
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr ""
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Crea progetto"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Crea/aggiorna file .po quando si salva un file .lfm"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Creazione del file indice %s dei sorgenti FPC..."
#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "Basso"
#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "Cima"
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Scegli la cartella"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Valori cartella CodeTool"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definisci modelli"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<nessuna variabile selezionata>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Apri anteprima"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Strumenti"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Variabile: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nome variabile"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Modelli"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr ""
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr ""
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "prego selezionare una macro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Seleziona la Code Macro"
#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Corrente"
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr ""
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Colonna cursore nell'editor corrente"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Riga cursore nell'editor corrente"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after comments are deleted and macros are replaced."
msgstr ""
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "opzioni personalizzate"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Opzioni personalizzate"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Programma personalizzato"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr ""
#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Taglia"
#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr ""
#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr ""
#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr ""
#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr ""
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Modulo dati"
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Data"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Cancella tutto"
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Cancella tutto"
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Disabilita tutto"
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Disabilita tutto"
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Abilita tutto"
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Abilita tutto"
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
#, fuzzy
#| msgid "Copy to clipboard"
msgid "Copy to Clipboard"
msgstr "Copia negli appunti"
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr ""
#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr ""
#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr ""
#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr ""
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr ""
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr ""
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Cancella"
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Disabilita"
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Disabilita"
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Abilita"
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Abilita"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Non è stato specificato nessun debugger"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Imposta comunque un breakpoint"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, fuzzy
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Non è stato specificato un debugger.%sIl settaggio dei breakpoint non avrà effetto finché non scegli un Debugger nella dialog delle opzioni di debugger nel menu."
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "On/Off"
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Disabilita/Abilita aggiornamenti per tutta la finestra"
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Debugger"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Errore del debugger%sOoops, il debugger è entrato in stato di errore%sSalvate subito il vostro lavoro!%sPremere stop e sperare..."
#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr ""
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Debugger non valido"
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (debug ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Aggiungi eccezione"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Percorso di ricerca opzionale"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Punto di interruzione"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Pulisci il log all'esecuzione"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Debugger"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Opzioni generali del debugger"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Opzioni specifiche del debugger (dipendono dal tipo di debugger)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Nome di eccezione duplicato"
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Immetti il nome dell'eccezione"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Log degli eventi"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Modificato da"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Modificato dal Debugger"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Modificato dal Programma"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignora questa eccezione"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Eccezioni del linguaggio"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
#, fuzzy
#| msgid "Limit linecount to"
msgid "Limit line count to"
msgstr "Limita il conteggio righe a"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modulo"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "Notifica le eccezioni di Lazarus"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Eccezioni del Sistema Operativo"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Output"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Processo"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Riprendi"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Resume gestito"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Resume non gestito"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Mostra messaggio alla fine"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Segno"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Impossibile caricare il file"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Impossibile caricare il file %s%s%s."
#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Decimale"
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Predefinito"
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Ritarda per righe di consigli lunghe nel box di completamento"
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Ritarda per consigli e box di completamento"
#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Cancella"
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Cancella tutto"
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Cancella tutti i breakpoint?"
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Cancellare tutti i breakpoints nel file %s%s%s?"
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Cancellare tutti nello stesso sorgente"
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Cancellare tutti i breakpoints selezionati?"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Cancellare tutti questi files?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Cancellare file ambiguo?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Cancella breakpoints"
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Cancellare il breakpoint %s\"%s\" rigo %d?"
#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Cancellazione del file fallita"
#: lazarusidestrconsts.lisdeletemacro
#, fuzzy
#| msgid "Delete macro %s"
msgid "Delete macro %s%s%s?"
msgstr "Cancella macro %s"
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Cancela modo \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Cancellare il vecchio file %s%s%s?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Cancellare il vecchio file?"
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Cancellare i file selezionati"
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr "Cancella valore %s%s%s"
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Cancella valore %s"
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Cancellazione del file %s%s%s fallita."
#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"
#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "Package Delphi"
#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Progetto Delphi"
#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "Unit Delphi"
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Cartella di destinazione"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Codice del distruttore"
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Insensibile alle maiuscole/minuscole"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignora l'aggiunta o la rimozione di righe vuote"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignora differenze nei fineriga (cioè #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignora il numero dei caratteri spazio"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignora gli spazi (caratteri di avanzamento riga non inclusi)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignora spazi alla fine delle righe"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignora spazi all'inizio delle righe"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Solo selezione"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Apri Diff nell'editor"
#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Testo1"
#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Testo2"
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Cifre:"
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Direttive"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Direttive per una nuova unit"
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr "Cartella %s%s%s non trovata."
#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr ""
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Cartella non scrivibile"
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "La cartella dove l'IDE salva i file .po"
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Disabilitare tutti nello stesso sorgente"
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Disabilita i breakpoint"
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Disabilitato"
#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr ""
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Disabilita I18N per LFM"
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lisdisassgotoaddress
#, fuzzy
#| msgid "Goto address"
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "Salta a indirizzo"
#: lazarusidestrconsts.lisdisassgotoaddresshint
#, fuzzy
#| msgid "Goto address"
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "Salta a indirizzo"
#: lazarusidestrconsts.lisdisassgotocurrentaddress
#, fuzzy
#| msgid "Goto current address"
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "Salta a indirizzo corrente"
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
#, fuzzy
#| msgid "Goto current address"
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "Salta a indirizzo corrente"
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Annulla modifiche"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Annulla tutte le modifiche"
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Fai clic su di una delle voci sopra per vedere il risultato di un diff"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Errore nella lettura file: %s"
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignora i cambiamenti su disco"
#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Ricarica da disco"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Alcuni file su disco sono cambiati:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Distingui tra lettere maiuscole e minuscole per es. tra A e a"
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr ""
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr ""
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr ""
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Esporta ..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr ""
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Apri ..."
#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Salva ..."
#: lazarusidestrconsts.lisdoesnotexists
#, fuzzy
#| msgid "%s does not exists: %s"
msgid "%s does not exist: %s"
msgstr "%s non esiste: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Non chiudere il progetto"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "Non compilare le dipendenze"
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Non mostrare lo splash screen"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Non mostrare questa dialog per questo progetto"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Non mostrare più questo messaggio"
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Giù"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr ""
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Disegna linee griglia"
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copia i componenti selezionati negli appunti"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Taglia i componenti selezionati negli appunti"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Sposta il componente indietro di uno"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Sposta il componente avanti di uno"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Sposta indietro il componente"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Sposta il componente in primo piano"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Incolla componenti selezionati dagli appunti"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Seleziona componente genitore"
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr ""
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr ""
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr "Trovato duplicato del valore %s%s%s."
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Nome duplicato: Esiste già un componente chiamato %s%s%s nel componente ereditato %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Path di ricerca duplicato"
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Modifica"
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Edita aiuto contestuale"
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr ""
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr ""
#: lazarusidestrconsts.liseditorfiletypes
msgid "Editor file types"
msgstr ""
#: lazarusidestrconsts.liseditormacros
msgid "Editor macros"
msgstr ""
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr ""
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Tutti i pacchetti"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Progetto corrente"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Tutti i progetti"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "imposta modalità FPC a Delphi"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "imposta modalità FPC a FPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "imposta modalità FPC a GPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "impostare il modo FPC a MacPas"
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "imposta modalità FPC a TP"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "imposta IOCHECKS abilitati"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "imposta OVERFLOWCHECKS abilitati"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "imposta RANGECHECKS abilitati"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "usa la unit HeapTrc"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "usa la unit LineInfo"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Per creare uno strumento serve almeno un titolo e un nome file."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Modifica strumenti"
#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr "Nascondi la form principale"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Tasto"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Macro"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametri:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Nome del programma:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Ricerca nel risultato di messaggi del compilatore Free Pascal"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Ricerca nel risultato di messaggi di make"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Sono richiesti un titolo ed un nome file"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Cartella di lavoro:"
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Tutto"
#: lazarusidestrconsts.lisemdemptymethods
#, fuzzy
#| msgid "Emtpy Methods"
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Metodi vuoti"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Trovati Metodi vuoti:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr ""
#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Solamente pubblicato"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Pubblico"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Pubblicato"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Rimuovi i metodi"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Cercare in quete sezioni di Class:"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr ""
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Vuoto"
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Abilitare tutto"
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "&Abilitare tutto nello stesso sorgente"
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Abilita i breakpoint"
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Abilitato"
#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr ""
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Abilita supporto a internazionalizzazione e traduzione"
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Abilita le macro"
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = replace whole identifier, Disable = replace prefix"
msgstr ""
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Chiusura"
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Codifica del file su disco %s%s%s% è %s. La nuova codifica è %s"
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Codifica del file su disco %s%s%s% è %s. La nuova codifica è %s"
#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr ""
#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr ""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Variabile ambiente, nome come parametro"
#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr "Salta dal messaggio alla riga del sorgente con doppio click (altrimenti con singolo click)"
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Cartella non trovata"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nome file del debugger non valido"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Il file del debugger \"%s\" non è un eseguibile."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Cartella di test \"%s\" non trovata."
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Opzione non valida a posizione %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "L'opzione alla posizione %d non permette un argomento: %s"
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "L'opzione alla posizione %d richiede un argomento: %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Errore: "
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Errore nella creazione del file"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Errore durante la cancellazione del file"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Errore in %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Linking / Pass options to linker):"
msgstr ""
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr ""
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr ""
#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "ERROR: invalid build mode \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Errore nel caricamento del file"
#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr "Errore caricando il file \"%s\":%s%s"
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Errore nel caricamento di %s da%s%s%s%s"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Errore nello spostamento del componente"
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Errore nello spostamento del componente %s:%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Errore nel dare un nome al componente"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Errore nell'apertura della componente"
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Errore nell'elaborazione dello stream componente lfm."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Errore nella lettura dell'elenco pacchetti dal file%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Errore nella lettura XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Errore nella lettura del file XML %s%s%s%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Errore durante la rinomina file"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Errori"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Errore nel salvataggio di %s in %s%s%s%s"
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Errore nell'impostare il nome del componente %s in %s"
#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorwritingfile2
msgid "Error writing file %s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Errore nella scrittura dell'elenco pacchetti sul file%s%s%s%s"
#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Edita scanner personalizzati (%s)"
#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "Valuta espressione"
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "&Valuta"
#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr ""
#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr ""
#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr ""
#: lazarusidestrconsts.liseverynthlinenumber
#, fuzzy
#| msgid "Every n-th line number:"
msgid "Every n-th line number"
msgstr "Ogni N numeri di riga:"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "File di esempio:"
#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Esempi:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#Packagename.UnitName.Identifier"
#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr ""
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Notifica dell'eccezione del debugger"
#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr ""
#: lazarusidestrconsts.lisexcludefilter
#, fuzzy
#| msgid "Exclude Filter"
msgid "Exclude filter"
msgstr "Escludi Filtro"
#: lazarusidestrconsts.lisexecutable
msgid "Executable"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Esecuzione comando dopo"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Esecuzione comando prima"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Esecuzione bloccata"
#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Programmi"
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Esci"
#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Espandi tutte le classi"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Espandi tutti i pacchetti"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Espandi tutte le unit"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Nome file espanso del file dell'editor corrente"
#: lazarusidestrconsts.lisexport
#, fuzzy
#| msgid "Export ..."
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Esporta ..."
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr ""
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Esporta elenco"
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr ""
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Espressione:"
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Estendere il cammino delle unit?"
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Estrai"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Estrai procedura"
#: lazarusidestrconsts.lisexttoolexternaltools
#, fuzzy
#| msgid "External tools"
msgid "External Tools"
msgstr "Tool esterni"
#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Fallita l'esecuzione d'uno strumento"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Raggiunto la massimo degli strumenti"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "C'è un massimo di %s strumenti."
#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" completato"
#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Impossibile eseguire lo strumento %s%s%s:%s%s"
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Non posso creare l'Application bundle per \"%s\""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Caricamento stato di collassatura fallito"
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr ""
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Riduce il disegno del designer"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Disegna oggetti nel designer solo in pausa (riduce il lavoro per computer lenti)"
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "File"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr ""
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Il file %s%s%s%snon sembra un file di testo.%sAprirlo ugualmente?"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Il file %s%s%s%snon sembra un file di testo.%sAprirlo ugualmente?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Estensione dei file di programma"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtro dei file"
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr ""
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr ""
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Il file %s%s%s è cambiato. Salvarlo?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Il file non ha un progetto"
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr ""
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr ""
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Il file non è scrivibile"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Il file è un symlink"
#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Il file %s%s%s è virtuale."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Errore nel link del file"
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Nome file/Indirizzo"
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "File non trovato"
#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "File %s%s%s non trovato.%s"
#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "File %s%s%s non trovato.%sVuoi crearlo?%s"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "File non minuscolo"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "File non di testo"
#: lazarusidestrconsts.lisfilesettings
#, fuzzy
#| msgid "File Settings ..."
msgid "File Settings"
msgstr "Impostazioni file ..."
#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr ""
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Files in codifica ASCII o UTF-8"
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "I file non hanno codifica ASCII né UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "file, dove viene scritto l'output di debug. Se non specificato, l'output di debug viene scritto sulla console."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtro"
#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Filtro: %s"
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Gruppi di filtri"
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectory
msgid "D&irectory"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Opzioni cartella"
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr ""
#: lazarusidestrconsts.lisfindfileincludesubdirectories
#, fuzzy
#| msgid "Include sub directories"
msgid "Include &sub directories"
msgstr "Includi sottocartella"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Pattern &multiriga"
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Solo file di testo"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "ricercare tutti i file nel progetto"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "ricercare tutti i file aperti"
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "ricercare in cartelle"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Dove"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Trova combinazione di tasti"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Trova unit mancante"
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Primo"
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Ripara file LFM"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Virgola mobile"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Forza rinomina"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Form"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Errore di formato"
#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr ""
#: lazarusidestrconsts.lisfpccfgismissing
msgid "fpc.cfg is missing."
msgstr ""
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake fallito"
#: lazarusidestrconsts.lisfpcmessagefile
msgid "FPC message file"
msgstr ""
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr "Risorse FPC"
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr ""
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC troppo vecchio"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Versione FPC: "
#: lazarusidestrconsts.lisfpcversioneg222
#, fuzzy
#| msgid "FPC Version (e.g. 2.2.4)"
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Versione FPC (es. 2.2.4)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "Errore nella scrittura di \"%s\"%s%s"
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Errore di sintassi FPDoc"
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr ""
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "C'è un errore di sintassi nell'elemento FPDoc \"%s\":%s%s"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Frame"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Ricerca indietro"
#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
#, fuzzy
#| msgid "Freepascal source directory"
msgid "Free Pascal source directory"
msgstr "Cartella sorgente del Freepascal"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Ricerca avanti"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "File aggiuntivi da cercare (cioè /cammino/*.pas;/cammino2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Trova o rinomina identificatore"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Trova i riferimenti"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identificatore: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "in tutti i pacchetti e i progetti aperti"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "nella unit corrente"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "nel progetto principale"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "nel progetto/pacchetto a cui appartiene la unit corrente"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Identificatore non valido"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Rinomina tutti i riferimenti"
#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Rinomina a"
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Cerca anche nei commenti"
#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Cerca dove"
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Funzione"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Generale"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "prendi la parola alla posizione attuale del cursore"
#: lazarusidestrconsts.lisgotoline
#, fuzzy
#| msgid "Goto line"
msgid "Goto Line"
msgstr "Salta alla riga"
#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Vai alla riga di sorgente selezionata"
#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<descrizione>%sCopyright (C) <anno><nome dell'autore><contatto>%sQuesto sorgente è software libero; potete ridistribuirlo e/o modificarlo sotto le condizioni stabilite dalla GNU General Public License, come è edita dalla Free Software Foundation; potete usare o la versione 2 della licenza oppure, a vostra scelta, una versione successiva. %sQueso codice è distribuito con la speranza che vi sia utile, ma SENZA NESSUNA GARANZIA; senza nemmeno l'implicita garanzia di COMMERCIABILITA' e di IDONEITA' PER UN PARTICOLARE SCOPO. Leggete la GNU General Public License per ulteriori dettagli. %sUna copia della GNU General Public License è disponibile sul World Wide Web sul sito <http://www.gnu.org/copyleft/gpl.html>. Potete anche ottenerla scrivendo a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Gruppo"
#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr ""
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr ""
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Cresci fino al più grande"
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Ha aiuto"
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Intestazione commento per classe"
#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Aiuto"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Voci di aiuto"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Selettore di aiuto"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Esadecimale"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
#, fuzzy
#| msgid "Help for FreePascal Compiler message"
msgid "Help for Free Pascal Compiler message"
msgstr "Aiuto su un messaggio del Compilatore FreePascal"
#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr "Nascondi messaggi per mezzo di direttive"
#: lazarusidestrconsts.lishint
msgid "Hint"
msgstr ""
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Consiglio: un valore di default può essere definito nei condizionali."
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Consiglio: Controlla se due package contengono una unit con lo stesso nome."
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Salva tutto"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Passo interno"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Esegui fino al ritorno dalla funzione"
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Passa oltre"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Consiglio: la funzione \"Make Resourcestring\" vuole una stringa costante.%sSelezionare l'espressione e riprovare."
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Consiglio: la funzione Make Resourcestring vuole una stringa costante.%sSelezionare una sola espressione stringa e riprovare."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Cambia da form a unit"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Vista form"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Vista unit"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Conteggio hit"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Database"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Opzioni aiuto"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Proprietà:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Visualizzatori"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Percorso di FPC Doc HTML"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Orizzontale"
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Opzioni di build dell'IDE"
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr ""
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr ""
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Creazione del Makefile per il package %s"
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Errore: esecuzione del tool 'compila dopo' fallita sul package %s"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informazioni sull'IDE"
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "ATTENZIONE: nome di unit %s non valido, package=%s"
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr ""
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "identificatore"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "L'identificatore comincia con ..."
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "L'identificatore contiene ..."
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Opzioni IDE:"
#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr ""
#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr ""
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Il titolo dell'IDE inizia con il nome del progetto"
#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Errore accedendo all'xml"
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Errore accedendo al file xml %s%s%s:%s%s"
#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Errore caricando l'xml"
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Errore caricando il file xml %s%s%s:%s%s"
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Il file di esportazione già esiste"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Il file di esportazione %s%s%s esiste già.%sAprire il file e sostituire solo le opzioni del compilatore?%s(le altre saranno mantenute.)"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Carica dal file"
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Apri o carica le opzioni del compilatore"
#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Apri recenti"
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Files recenti"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Salva nel file"
#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Salva nei recenti"
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%s%sFor example:%s"
msgstr ""
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignora tutto"
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignora e continua"
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Ignora i file binari"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ignora questo tipo di eccezione"
#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Ignora, usa TForm come antenato"
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Imita l'indentazione della unit, progetto o package corrente"
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Commento all'implementazione per classe"
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr ""
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Importa elenco"
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr ""
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Impossibile"
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr ""
#: lazarusidestrconsts.lisincludefilter
#, fuzzy
#| msgid "Include Filter"
msgid "Include filter"
msgstr "Includi Filtro"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "cammino di inclusione"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Includi i percorsi"
#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr ""
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr ""
#: lazarusidestrconsts.lisindentationforpascalsources
#, fuzzy
#| msgid "Indentation for pascal sources"
msgid "Indentation for Pascal sources"
msgstr "Indentazione per sorgenti pascal"
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Indice"
#: lazarusidestrconsts.lisinfobuildabort
#, fuzzy
#| msgid "Aborted..."
msgid "Aborted ..."
msgstr "Annullato..."
#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Compila progetto"
#: lazarusidestrconsts.lisinfobuildcompile
#, fuzzy
#| msgid "Compiling..."
msgctxt "lazarusidestrconsts.lisinfobuildcompile"
msgid "Compiling ..."
msgstr "Compilando..."
#: lazarusidestrconsts.lisinfobuilderror
#, fuzzy
#| msgid "Error..."
msgid "Error ..."
msgstr "Errore..."
#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Errori:"
#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Consigli:"
#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Righe:"
#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Interrompi"
#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Note:"
#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr "Progetto:"
#: lazarusidestrconsts.lisinfobuildsuccess
#, fuzzy
#| msgid "Success..."
msgid "Success ..."
msgstr "Successo."
#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Avvertimenti:"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Informazione"
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informazioni su %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informazioni sull'FPC usato"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr ""
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Di fronte al relativo"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Oggetto ereditato"
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr ""
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Per poter creare una copia pulita del progetto/package, tutti i file nella seguente cartella saranno cancellati e il loro contenuto sarà perso.%s%sCancella tutti i file in%s%s%s?"
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Inserisci"
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Inserisci la data"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Inserisci data e ora"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "Inserisci data e ora. Opzionale: stringa di formattazione"
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "Inserisci la data. Opzionale: stringa di formattazione"
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "Inserisci end se serve"
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Inserisci Macro"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "Inserisci il nome della procedura corrente"
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Inserisci tag PrintShort"
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Inserisci tag PrintShort"
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "inserisci testa della procedura"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "inserisci il nome della procedura"
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "inserisci l'ora"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr "Inserisci l'ora. Opzionale: stringa di formattazione"
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Inserisci tag URL"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "In sessione"
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Ispeziona"
#: lazarusidestrconsts.lisinspectclassinherit
msgid "%s : Class %s inherits from %s"
msgstr ""
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Dati"
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Analizzatore di debug"
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Metodi"
#: lazarusidestrconsts.lisinspectpointerto
msgid "Pointer to %s"
msgstr ""
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Proprietà"
#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr ""
#: lazarusidestrconsts.lisinspectunavailable
msgid "%s : unavailable"
msgstr ""
#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr ""
#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr ""
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Installazione fallita"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr ""
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Installalo, mi piace il grasso"
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Installa selezione"
#: lazarusidestrconsts.lisinstalluninstallpackages
#, fuzzy
#| msgid "Install/Uninstall packages"
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Installa/Disinstalla package"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interattivo"
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Comando non valido"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Cancellazione non valida"
#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Espressione non valida:%s%s%s%s"
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Espressione non valida.%sConsiglio: la funzione \"Make Resourcestring\" vuole una stringa costante in un file singolo. Selezionare l'espressione e riprovare."
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Filtro non valido"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Riga non valida, colonna nel messaggio%s%s"
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro %s%s%s. The macro name must be a Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr ""
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr ""
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Modo %s non valido"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Multiselezione non valida"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Invalido (Off)"
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Invalido (On)"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Identificatore Pascal non valido"
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
#, fuzzy
#| msgid "The name \"%s\" is not a valid pascal identifier."
msgid "The name \"%s\" is not a valid Pascal identifier."
msgstr "Il nome \"%s\" non è un identificatore Pascal valido."
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Nome proc non valido"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nome di file del progetto non valido"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Cartella di pubblicazione non valida"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Selezione non valida"
#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr ""
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s fa già parte del progetto."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s non è un nome progetto valido.%sScegliere un altro nome (es. progetto1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr ""
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr ""
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Storico dei salti"
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr ""
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Tieni i file convertiti aperti nell'editor"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Tutti i file di progetto saranno aperti nell'editor dopo la conversione"
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Tieni nella lista di installazione"
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Mantieni il nome"
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr ""
#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr ""
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Ignora e continua"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Tasto"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Comandi personalizzati"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Comandi di progettazione"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Comando dell'Ispettore Oggetti"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Tasto (o sequenza di 2 tasti)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Interrompi building"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Aggiungi watch"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Costruisci l progetto/programma"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Scegli schema di mappatura tasti"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Classico"
#: lazarusidestrconsts.liskmcleanupcompiled
msgid "Clean up build files"
msgstr ""
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Chiudi il progetto"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Editor dei define per CodeTool"
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr ""
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "ura %sC File%s"
#: lazarusidestrconsts.liskmconfigurecustomcomponents
#, fuzzy
#| msgid "Configure custom components"
msgid "Configure Custom Components"
msgstr "Configura componenti personali"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Aiuto relativo al contesto"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Converti un pacchetto Delphi in pacchetto Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project"
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Converti un progetto Delphi in progetto Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit"
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Converti unit Delphi in unit Lazarus"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
#, fuzzy
#| msgid "Convert DFM file to LFM"
msgid "Convert DFM File to LFM"
msgstr "Converti file DFM in LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Copia il Componente selezionato negli Appunti"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Taglia i Componebti selezionati negli Appunti"
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Cancella l'ultimo carattere"
#: lazarusidestrconsts.liskmdiffeditorfiles
#, fuzzy
#| msgid "Diff editor files"
msgid "Diff Editor Files"
msgstr "File dell'editor Diff "
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Edita modelli di codice"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Edita aiuto sensibile al contesto"
#: lazarusidestrconsts.liskmencloseselection
#, fuzzy
#| msgid "Enclose selection"
msgid "Enclose Selection"
msgstr "Includi la selezione"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Valuta/Modifica"
#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr ""
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Impostazioni Strumenti esterni"
#: lazarusidestrconsts.liskmfindincremental
#, fuzzy
#| msgid "Find incremental"
msgid "Find Incremental"
msgstr "Trova incrementale"
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Vai al segnalibro 0"
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Vai al segnalibro 1"
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Vai al segnalibro 2"
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Vai al segnalibro 3"
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Vai al segnalibro 4"
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Vai al segnalibro 5"
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Vai al segnalibro 6"
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Vai al segnalibro 7"
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Vai al segnalibro 8"
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Vai al segnalibro 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Vai all'editor sorgenti 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Vai all'editor sorgenti 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Vai all'editor sorgenti 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Vai all'editor sorgenti 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Vai all'editor sorgenti 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Vai all'editor sorgenti 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Vai all'editor sorgenti 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Vai all'editor sorgenti 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Vai all'editor sorgenti 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Vai all'editor sorgenti 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Inserisci data e ora"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Inserisci il nome utente"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Analizza"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Schema della tastiera"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (default)"
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Mac OS X (stile Apple)"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Mac OS X (stile Lazarus)"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Nuovo pacchetto"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nuovo progetto"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nuovo progetto da file"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nuova Unit"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Nota: tutti i tasti saranno settati al valore dello schema scelto"
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Apri un pacchetto"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Incolla Componente dagli appunti"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Metti in pausa il programma"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Pubblica il progetto"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Compilazione veloce, niente linking"
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr ""
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Esegui programma"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "SalvaTutto"
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "SalvaCome"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Salva progetto"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Salva progetto come"
#: lazarusidestrconsts.liskmselectlineend
#, fuzzy
#| msgid "Select line end"
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Seleziona la fine della riga"
#: lazarusidestrconsts.liskmselectlinestart
#, fuzzy
#| msgid "Select line start"
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Seleziona l'inizio della riga"
#: lazarusidestrconsts.liskmselectpagebottom
#, fuzzy
#| msgid "Select page bottom"
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Seleziona la fine della pagina"
#: lazarusidestrconsts.liskmselectpagetop
#, fuzzy
#| msgid "Select page top"
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Seleziona l'inizio della pagina"
#: lazarusidestrconsts.liskmselectwordleft
#, fuzzy
#| msgid "Select word left"
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Seleziona la parola a sinistra"
#: lazarusidestrconsts.liskmselectwordright
#, fuzzy
#| msgid "Select word right"
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Seleziona la parola a destra"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Imposta segnalibro libero"
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Imposta segnalibro 0"
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Imposta segnalibro 1"
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Imposta segnalibro 2"
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Imposta segnalibro 3"
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Imposta segnalibro 4"
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Imposta segnalibro 5"
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Imposta segnalibro 6"
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Imposta segnalibro 7"
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Imposta segnalibro 8"
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Imposta segnalibro 9"
#: lazarusidestrconsts.liskmstopprogram
#, fuzzy
#| msgid "Stop program"
msgid "Stop Program"
msgstr "Interrompi il programma"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Passa tra Unit e Form"
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "Inverti marker 0"
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "Inverti marker 1"
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "Inverti marker 2"
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "Inverti marker 3"
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "Inverti marker 4"
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "Inverti marker 5"
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "Inverti marker 6"
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "Inverti marker 7"
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "Inverti marker 8"
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "Inverti marker 9"
#: lazarusidestrconsts.liskmtoggleviewassembler
#, fuzzy
#| msgid "Toggle view Assembler"
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Inverti vista assembler"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
#, fuzzy
#| msgid "Toggle view Breakpoints"
msgid "View Breakpoints"
msgstr "Inverti vista breaskpoint"
#: lazarusidestrconsts.liskmtoggleviewcallstack
#, fuzzy
#| msgid "Toggle view Call Stack"
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Inverti vista stack delle chiamate"
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Inverti vista del browser di codice"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
#, fuzzy
#| msgid "Toggle view component palette"
msgid "Toggle View Component Palette"
msgstr "Inverti vista tavolozza dei componenti"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
#, fuzzy
#| msgid "Toggle view Debuger Event Log"
msgid "View Debuger Event Log"
msgstr "Mosta/nascondi log eventi del debugger"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
#, fuzzy
#| msgid "Toggle view Debugger Output"
msgid "View Debugger Output"
msgstr "Mostra/nascondi output del debugger"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Mostra/nascondi editor della documentazione"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Mostra/nascondi speed button dell'IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
#, fuzzy
#| msgid "Toggle view Local Variables"
msgid "View Local Variables"
msgstr "Mostra/nascondi variabili locali"
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Mostra/nascondi messaggi"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Mostra/nascondi Analizzatore oggetti"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
#, fuzzy
#| msgid "Toggle view Registers"
msgid "View Registers"
msgstr "Mostra/nascondi registri"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Mostra/nascondi risultati di ricerca"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Mostra/nascondi editor sorgente"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
#, fuzzy
#| msgid "Toggle view Watches"
msgid "View Watches"
msgstr "Mostra/nascondi Osservazioni"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Mostra storico salti"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Mostra le opzioni del progetto"
#: lazarusidestrconsts.liskmviewprojectsource
#, fuzzy
#| msgid "View project source"
msgid "View Project Source"
msgstr "Mostra il sorgente del progetto"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Mostra le informazioni sulla Unit"
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Lancio applicazione fallito"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Esecuzione riga di comando di destinazione"
#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Settaggi Desktop di Lazarus"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Cartella di Lazarus"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "cartella, da usare come cartella base"
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "IDE Lazarus v%s"
#: lazarusidestrconsts.lislazarusfile
#, fuzzy
#| msgid "Lazarus File"
msgid "Lazarus file"
msgstr "File di Lazarus"
#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "form di Lazarus"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "IDE Lazarus"
#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "File include di Lazarus"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID della lingua di Lazarus (es.: en, de, br)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nome della lingua Lazarus (e.g. english, deutsch)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opzioni] <nomefile-progetto>"
#: lazarusidestrconsts.lislazarusotherfile
msgid "Lazarus other file"
msgstr ""
#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Pacchetto di Lazarus"
#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Progetto Lazarus"
#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "File di informazione di progetto Lazarus"
#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Sorgente del progetto Lazarus"
#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Unit di Lazarus"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Azione"
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Scegli la cartella di output dell'eseguibile dell'IDE"
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "vuoi davvero cancellare questo profilo di costruzione?"
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr ""
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Impostazioni comuni"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Conferma prima di costruire"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Conferma la cancellazione"
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Define"
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Define senza -d"
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Edita i define"
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Edita la lista dei define che si possono usare da ogni profilo"
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Errore nella scrittura del file"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild non è interattivo, sto terminando."
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Gestisci profili di costruzione"
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Gestisci i profili"
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Nome del profilo attivo"
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Aggiungi nuovo profilo"
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Le opzioni di costruzione attuali saranno associate a:"
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opzioni:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Opzioni passate al compilatore"
#: lazarusidestrconsts.lislazbuildprofile
#, fuzzy
#| msgid "Profile to Build"
msgid "Profile to build"
msgstr "Profilo da costruire"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Rinomina profilo"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Nuovo nome per il profilo:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Rilancia l'IDE dopo averla costruita"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Rilancia automaticamente Lazarus dopo aver costruito l'IDE (non ha effetto se si costruiscono altre parti)"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Seleziona profilo da costruire"
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Chiedi conferma quando si costruisce direttamente dal menu Strumenti"
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "CPU di destinazione:"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Cartella di destinazione"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "SO di destinazione:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Impossibile scrivere il file \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Aggiorna revision.inc"
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Aggiorna informazioni di revisione nella dialog \"Informazioni su Lazarus\""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Pulisci e costruisci tutto"
#: lazarusidestrconsts.lislclwidgettype
#, fuzzy
#| msgid "LCL Widget Type"
msgid "LCL widget type"
msgstr "Tipo di widget LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Aggiungi link da ereditare"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copia dall'ereditato"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Muovi le voci a inherited"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "La unit %s non è parte di nessun package o progetto.%sAggiungere la unit a un package o a un progetto.%sImpossibile creare il file fpdoc."
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Sinistra"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Spazio del bordo sinistro. Questo valore viene aggiunto allo spazio bordo base, ed è usato per lo spazio a sinistra del controllo."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ancoraggio a sinistra"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Questo è il controllo compagno a cui il lato sinistro è ancorato. Lasciare vuoto per il controllo padre."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Lato sinistro"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Spazia a sinistra equidistante"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr ""
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Livelli"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "File LFM"
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr ""
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "File LFM danneggiato"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "File LFM funzionante"
#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<descrizione>%sCopyright (C) <anno><nome dell'autore><contatto>%sQuesto sorgente è software libero; potete ridistribuirlo e/o modificarlo sotto le condizioni stabilite dalla GNU General Public License, come è edita dalla Free Software Foundation; potete usare o la versione 2 della licenza oppure, a vostra scelta, una versione successiva. %sQueso codice è distribuito con la speranza che vi sia utile, ma SENZA NESSUNA GARANZIA; senza nemmeno l'implicita garanzia di COMMERCIABILITA' e di IDONEITA' PER UN PARTICOLARE SCOPO. Leggete la GNU General Public License per ulteriori dettagli. %sUna copia della GNU General Public License è disponibile sul World Wide Web sul sito <http://www.gnu.org/copyleft/gpl.html>. Potete anche ottenerla scrivendo a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "cammino libreria"
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr ""
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Riga:"
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Riga/lunghezza"
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Link:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "opzioni compilatore"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Destinazione di link"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "elenco di tutti i valori CASE"
#: lazarusidestrconsts.lisloadedsuccessfully
msgid "Loaded successfully"
msgstr ""
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Caricamento di %s fallito."
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr ""
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "Locali"
#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr ""
#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr ""
#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr ""
#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr ""
#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "Valuta espressione"
#: lazarusidestrconsts.lislogmessage
#, fuzzy
#| msgid "Log message"
msgid "Log Message"
msgstr "Registra messaggio"
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "stringa in minuscolo"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "Stringa in minuscolo data come parametro"
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr ""
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr ""
#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr "file include lrs"
#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr ""
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Macro %s"
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Inserire i dati"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Inserire i parametri di esecuzione"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
#, fuzzy
#| msgid "Main Unit has Application.CreateForm statements"
msgid "Main unit has Application.CreateForm statements"
msgstr "La unit principale ha comandi Application.CreateForm"
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
#, fuzzy
#| msgid "Main Unit has Application.Title statements"
msgid "Main unit has Application.Title statements"
msgstr "La unit principale usa comandi Application.Title"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
#, fuzzy
#| msgid "Main Unit has Uses Section containing all Units of project"
msgid "Main unit has Uses section containing all units of project"
msgstr "La sezione Uses della unit principale ha tutte le unità del progetto"
#: lazarusidestrconsts.lismainunitispascalsource
#, fuzzy
#| msgid "Main Unit is Pascal Source"
msgid "Main unit is Pascal source"
msgstr "La unit principale è sorgente Pascal"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Crea l'eseguibile"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make non trovato"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Crea ResourceString"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Aggiungi in fondo alla sezione"
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "La resourcestring %s%s%s esiste già.%sScegliere un'altro nome.%sUsare Ignora per aggiungerlo comunque."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opzioni di conversione"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identificatore personalizzato"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identificatore"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Lunghezza identificatore:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Prefisso identificatore:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Inserisci in ordine alfabetico"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Inserisci in ordine di contesto"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Sezione Resourcestring non valida"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Scegliere una sezione resourcestring dalla lista."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "La resourcestring esiste già"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Sezione resourcestring:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Anteprima del sorgente"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Costante stringa nel sorgente"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Stringhe con lo stesso valore:"
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr ""
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Massimo %d"
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr ""
#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "Azione"
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Dump della memoria"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Interrompi la costruzione"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Informazioni su FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
#, fuzzy
#| msgid "Add breakpoint"
msgid "Add &Breakpoint"
msgstr "Aggiungi breakpoint"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr ""
#: lazarusidestrconsts.lismenuaddjumppointtohistory
#, fuzzy
#| msgid "Add jump point to history"
msgid "Add Jump Point to History"
msgstr "Aggiungi punto di salto nello storico"
#: lazarusidestrconsts.lismenuaddtoproject
#, fuzzy
#| msgid "Add editor file to Project"
msgid "Add Editor File to Project"
msgstr "Aggiungi un file dell'editor al progetto"
#: lazarusidestrconsts.lismenuaddwatch
#, fuzzy
#| msgid "Add watch ..."
msgid "Add &Watch ..."
msgstr "Aggiungi watch ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
#, fuzzy
#| msgid "Break Lines in selection"
msgid "Break Lines in Selection"
msgstr "Spezza le righe nella selezione"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Costruisci il file"
#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus with current profile"
msgid "Build Lazarus with Current Profile"
msgstr "Costruisci Lazarus con il profilo corrente"
#: lazarusidestrconsts.lismenubuildlazarusprof
#, fuzzy
#| msgid "Build Lazarus with profile: %s"
msgid "Build Lazarus with Profile: %s"
msgstr "Costruisci Lazarus con il profilo: %s"
#: lazarusidestrconsts.lismenuchecklfm
#, fuzzy
#| msgid "Check LFM file in editor"
msgid "Check LFM File in Editor"
msgstr "Controlla file LFM nell'editor"
#: lazarusidestrconsts.lismenucleandirectory
#, fuzzy
#| msgid "Clean directory ..."
msgid "Clean Directory ..."
msgstr "Pulisci cartella ..."
#: lazarusidestrconsts.lismenucleanupcompiled
msgid "Clean up Build Files ..."
msgstr ""
#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close A&ll Editor Files"
msgid "Close A&ll"
msgstr "Chiudi tutti i fi&le dell'editor"
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr ""
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Chiudi il progetto"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
#, fuzzy
#| msgid "CodeTools defines editor ..."
msgid "CodeTools Defines Editor ..."
msgstr "Editor dei define dei CodeTool ..."
#: lazarusidestrconsts.lismenucommentselection
#, fuzzy
#| msgid "Comment selection"
msgid "Comment Selection"
msgstr "Commenta la selezione"
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Completa codice"
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configura Costruisci+Lancia… "
#: lazarusidestrconsts.lismenuconfigcustomcomps
#, fuzzy
#| msgid "Configure custom components ..."
msgid "Configure Custom Components ..."
msgstr "Configura componenti personalizzati ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
#, fuzzy
#| msgid "Configure external tools ..."
msgid "Configure External Tools ..."
msgstr "Configurare tool esterni ..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configura \"Costruisci Lazarus\" ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Aiuto sensibile al contesto"
#: lazarusidestrconsts.lismenuconvertdelphipackage
#, fuzzy
#| msgid "Convert Delphi package to Lazarus package ..."
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Converti un pacchetto Delphi in pacchetto Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project ..."
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Converti un progetto Delphi in progetto Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit ..."
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Converti unit Delphi in unit Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert binary DFM to text LFM + check syntax ..."
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "Converti file DFM in LFM ..."
#: lazarusidestrconsts.lismenuconvertencoding
#, fuzzy
#| msgid "Convert encoding of projects/packages ..."
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Converti codifica dei progetti/pacchetti..."
#: lazarusidestrconsts.lismenudebugwindows
#, fuzzy
#| msgid "Debug windows"
msgid "Debug Windows"
msgstr "Finestre di debug"
#: lazarusidestrconsts.lismenudiff
#, fuzzy
#| msgid "Diff"
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff ..."
msgstr "Diff"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Modifica"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Templates di codice ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Edita aiuto sensibile al contesto"
#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Install/Uninstall packages ..."
msgid "Install/Uninstall Packages ..."
msgstr "Configura i pacchetti installati ..."
#: lazarusidestrconsts.lismenueditor
#, fuzzy
#| msgid "Menu Editor..."
msgid "Menu Editor ..."
msgstr "Editor di menu..."
#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Crea sottomenu"
#: lazarusidestrconsts.lismenueditordeletefromtemplate
#, fuzzy
#| msgid "Delete From Template..."
msgid "Delete From Template ..."
msgstr "Cancella dai modelli..."
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Cancella voce"
#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Gestisci evento OnClick"
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
#, fuzzy
#| msgid "Insert From Template..."
msgid "Insert From Template ..."
msgstr "Inserisci dai modelli..."
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Inserisci nuova voce (dopo)"
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Inserisci nuova voce (prima)"
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor menu"
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Sposta in giù (o a destra)"
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Sposta in su (o a sinstra)"
#: lazarusidestrconsts.lismenueditornewtemplatedescription
#, fuzzy
#| msgid "New Template Description..."
msgid "New Template Description ..."
msgstr "Nuova descrizione modello..."
#: lazarusidestrconsts.lismenueditorsaveastemplate
#, fuzzy
#| msgid "Save As Template..."
msgid "Save As Template ..."
msgstr "Salva come modello..."
#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Seleziona menu:"
#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Seleziona modello:"
#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Anteprima modello"
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr ""
#: lazarusidestrconsts.lismenuencloseselection
#, fuzzy
#| msgid "Enclose selection ..."
msgid "Enclose Selection ..."
msgstr "Chiusura selezione ..."
#: lazarusidestrconsts.lismenuevaluate
#, fuzzy
#| msgid "Evaluate/Modify ..."
msgid "E&valuate/Modify ..."
msgstr "Valuta/modifica..."
#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr ""
#: lazarusidestrconsts.lismenuextractproc
#, fuzzy
#| msgid "Extract procedure ..."
msgid "Extract Procedure ..."
msgstr "Estrai procedura ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&File"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Trova"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Trova..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
#, fuzzy
#| msgid "Find other end of code block"
msgid "Find Other End of Code Block"
msgstr "Trova l'altro capo del blocco di codice"
#: lazarusidestrconsts.lismenufindcodeblockstart
#, fuzzy
#| msgid "Find code block start"
msgid "Find Start of Code Block"
msgstr "Trova l'inizio del blocco di codice"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
#, fuzzy
#| msgid "Find Declaration at cursor"
msgid "Find Declaration at Cursor"
msgstr "Trova dichiarazione al cursore"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Trova identificatore riferimenti ..."
#: lazarusidestrconsts.lismenufindinfiles
#, fuzzy
#| msgid "Find &in files ..."
msgid "Find &in Files ..."
msgstr "Trova &nei file ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Trova &successivo"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Trova &precedente"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr ""
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Opzioni ..."
#: lazarusidestrconsts.lismenugotoincludedirective
#, fuzzy
#| msgid "Goto include directive"
msgid "Goto Include Directive"
msgstr "Vai alla direttiva di include"
#: lazarusidestrconsts.lismenugotoline
#, fuzzy
#| msgid "Goto line ..."
msgid "Goto Line ..."
msgstr "Vai alla linea ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced IFDEF/ENDIF"
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Indovina IFDEF/ENDIF malposizionati"
#: lazarusidestrconsts.lismenuguessunclosedblock
#, fuzzy
#| msgid "Guess unclosed block"
msgid "Guess Unclosed Block"
msgstr "Indovina blocco aperto"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Aiuto"
#: lazarusidestrconsts.lismenuideinternals
#, fuzzy
#| msgid "IDE internals"
msgid "IDE Internals"
msgstr "Meccanismi dell'IDE"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Trova incrementale"
#: lazarusidestrconsts.lismenuindentselection
#, fuzzy
#| msgid "Indent selection"
msgid "Indent Selection"
msgstr "Indenta selezione"
#: lazarusidestrconsts.lismenuinsertchangelogentry
#, fuzzy
#| msgid "ChangeLog entry"
msgid "ChangeLog Entry"
msgstr "Voce Changelog"
#: lazarusidestrconsts.lismenuinsertcharacter
#, fuzzy
#| msgid "Insert from Character Map"
msgid "Insert from Character Map ..."
msgstr "Inserire dalla mappa caratteri"
#: lazarusidestrconsts.lismenuinsertcvskeyword
#, fuzzy
#| msgid "Insert CVS keyword"
msgid "Insert CVS Keyword"
msgstr "Comando CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
#, fuzzy
#| msgid "Current date and time"
msgid "Current Date and Time"
msgstr "Data e ora correnti"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr ""
#: lazarusidestrconsts.lismenuinsertgeneral
#, fuzzy
#| msgid "General"
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Generale"
#: lazarusidestrconsts.lismenuinsertgplnotice
#, fuzzy
#| msgid "GPL notice"
msgid "GPL Notice"
msgstr "Nota GPL"
#: lazarusidestrconsts.lismenuinsertlgplnotice
#, fuzzy
#| msgid "LGPL notice"
msgid "LGPL Notice"
msgstr "Nota LGPL"
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
#, fuzzy
#| msgid "Modified LGPL notice"
msgid "Modified LGPL Notice"
msgstr "Licenza LGPL modificata"
#: lazarusidestrconsts.lismenuinsertusername
#, fuzzy
#| msgid "Current username"
msgid "Current Username"
msgstr "Nome utente corrente"
#: lazarusidestrconsts.lismenuinspect
#, fuzzy
#| msgid "Inspect ..."
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Analizza ..."
#: lazarusidestrconsts.lismenujumpback
#, fuzzy
#| msgid "Jump back"
msgid "Jump Back"
msgstr "Salta indietro"
#: lazarusidestrconsts.lismenujumpforward
#, fuzzy
#| msgid "Jump forward"
msgid "Jump Forward"
msgstr "Salta avanti"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Salta a"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr ""
#: lazarusidestrconsts.lismenujumptonextbookmark
#, fuzzy
#| msgid "Jump to next bookmark"
msgid "Jump to Next Bookmark"
msgstr "Salta al prossimo segnalibro"
#: lazarusidestrconsts.lismenujumptonexterror
#, fuzzy
#| msgid "Jump to next error"
msgid "Jump to Next Error"
msgstr "Salta al prossimo errore"
#: lazarusidestrconsts.lismenujumptoprevbookmark
#, fuzzy
#| msgid "Jump to previous bookmark"
msgid "Jump to Previous Bookmark"
msgstr "Salta al precedente segnalibro"
#: lazarusidestrconsts.lismenujumptopreverror
#, fuzzy
#| msgid "Jump to previous error"
msgid "Jump to Previous Error"
msgstr "Salta all'errore precedente"
#: lazarusidestrconsts.lismenulowercaseselection
#, fuzzy
#| msgid "Lowercase selection"
msgid "Lowercase Selection"
msgstr "Selezione in minuscolo"
#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr ""
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Crea stringa risorse ..."
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Nuovo componente"
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nuova form"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nuovo ..."
#: lazarusidestrconsts.lismenunewpackage
#, fuzzy
#| msgid "New package ..."
msgid "New Package ..."
msgstr "Nuovo package ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nuovo progetto ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
#, fuzzy
#| msgid "New Project from file ..."
msgid "New Project from File ..."
msgstr "Nuovo progetto da file ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nuova unit"
#: lazarusidestrconsts.lismenuok
#, fuzzy
#| msgid "&Ok"
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&Ok"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Aiuto in linea"
#: lazarusidestrconsts.lismenuopen
#, fuzzy
#| msgid "Open ..."
msgid "&Open ..."
msgstr "&Apri ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
#, fuzzy
#| msgid "Open filename at cursor"
msgid "Open Filename at Cursor"
msgstr "A&pri nomefile al cursore"
#: lazarusidestrconsts.lismenuopenpackage
#, fuzzy
#| msgid "Open loaded package ..."
msgid "Open Loaded Package ..."
msgstr "Apri pacchetto &caricato ..."
#: lazarusidestrconsts.lismenuopenpackagefile
#, fuzzy
#| msgid "Open package file (.lpk) ..."
msgid "Open Package File (.lpk) ..."
msgstr "Apri il file del pacchetto (.lp&k) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
#, fuzzy
#| msgid "Open package of current unit"
msgid "Open Package of Current Unit"
msgstr "Apri pacchetto della &unit corrente"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Apri pro&getto ..."
#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open &Recent ..."
msgid "Open &Recent"
msgstr "Apri &recenti ..."
#: lazarusidestrconsts.lismenuopenrecentpkg
#, fuzzy
#| msgid "Open recent package"
msgid "Open Recent Package"
msgstr "Apri pacchetto recente ..."
#: lazarusidestrconsts.lismenuopenrecentproject
#, fuzzy
#| msgid "Open Recent Project ..."
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Apri progetto recente ..."
#: lazarusidestrconsts.lismenupackage
#, fuzzy
#| msgid "&Package"
msgid "Pa&ckage"
msgstr "&Package"
#: lazarusidestrconsts.lismenupackagegraph
#, fuzzy
#| msgid "Package Graph ..."
msgid "Package Graph"
msgstr "Pacchetto grafico ..."
#: lazarusidestrconsts.lismenupackagelinks
#, fuzzy
#| msgid "Package links ..."
msgid "Package Links ..."
msgstr "Link del package"
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr ""
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "&Elenco procedure ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Progetto"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "&Analizzatore progetti"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "&Opzioni progetto ..."
#: lazarusidestrconsts.lismenuprojectrun
#, fuzzy
#| msgid "Run"
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "&Esegui"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "&Pubblica progetto ..."
#: lazarusidestrconsts.lismenuquickcompile
#, fuzzy
#| msgid "Quick compile"
msgid "Quick Compile"
msgstr "&Compilazione veloce"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
#, fuzzy
#| msgid "Quick syntax check"
msgid "Quick Syntax Check"
msgstr "Controllo veloce di &sintassi"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Controllo veloce di sintassi OK"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "&Togli dal progetto ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Rinomina identificatore ..."
#: lazarusidestrconsts.lismenureportingbug
#, fuzzy
#| msgid "Reporting a bug"
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Segnalare un bug..."
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
#, fuzzy
#| msgid "Rescan FPC source directory"
msgid "Rescan FPC Source Directory"
msgstr "Rileggi la cartella dei sorgenti FPC"
#: lazarusidestrconsts.lismenuresetdebugger
#, fuzzy
#| msgid "Reset debugger"
msgid "Reset Debugger"
msgstr "&Inizializza debugger"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "&Ripristina"
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Esegui"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Esegui il file"
#: lazarusidestrconsts.lismenurunparameters
#, fuzzy
#| msgid "Run Parameters ..."
msgid "Run &Parameters ..."
msgstr "Parametri di esecuzione..."
#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Run to &Cursor"
msgid "Step over to &Cursor"
msgstr "Esegui fino al cursore"
#: lazarusidestrconsts.lismenusave
#, fuzzy
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Salva"
#: lazarusidestrconsts.lismenusaveas
#, fuzzy
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Salva &come ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Salva progetto"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Salva progetto come ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Cerca"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Seleziona"
#: lazarusidestrconsts.lismenuselectall
#, fuzzy
#| msgid "Select all"
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Seleziona tutto"
#: lazarusidestrconsts.lismenuselectcodeblock
#, fuzzy
#| msgid "Select code block"
msgid "Select Code Block"
msgstr "Seleziona in blocco di codice"
#: lazarusidestrconsts.lismenuselectline
#, fuzzy
#| msgid "Select line"
msgid "Select Line"
msgstr "Seleziona riga"
#: lazarusidestrconsts.lismenuselectparagraph
#, fuzzy
#| msgid "Select paragraph"
msgid "Select Paragraph"
msgstr "Seleziona paragrafo"
#: lazarusidestrconsts.lismenuselecttobrace
#, fuzzy
#| msgid "Select to brace"
msgid "Select to Brace"
msgstr "Seleziona in graffe"
#: lazarusidestrconsts.lismenuselectword
#, fuzzy
#| msgid "Select word"
msgid "Select Word"
msgstr "Seleziona la parola"
#: lazarusidestrconsts.lismenusetfreebookmark
#, fuzzy
#| msgid "Set a free bookmark"
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Imposta un segnalibro libero"
#: lazarusidestrconsts.lismenushowexecutionpoint
#, fuzzy
#| msgid "S&how execution point"
msgid "S&how Execution Point"
msgstr "Mostra punto di esecuzione"
#: lazarusidestrconsts.lismenusortselection
#, fuzzy
#| msgid "Sort selection ..."
msgid "Sort Selection ..."
msgstr "Ordina selezione ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr ""
#: lazarusidestrconsts.lismenustepinto
#, fuzzy
#| msgid "Step in&to"
msgid "Step In&to"
msgstr "Passo interno"
#: lazarusidestrconsts.lismenustepintocontext
#, fuzzy
#| msgid "Step into (Context)"
msgid "Step Into (Context)"
msgstr "Entra dentro (Contesto)"
#: lazarusidestrconsts.lismenustepintoinstr
#, fuzzy
#| msgid "Step into instruction"
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "Entra nell'istruzione"
#: lazarusidestrconsts.lismenustepintoinstrhint
#, fuzzy
#| msgid "Step into instruction"
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "Entra nell'istruzione"
#: lazarusidestrconsts.lismenustepout
#, fuzzy
#| msgid "Step o&ut"
msgid "Step O&ut"
msgstr "Esci fuori"
#: lazarusidestrconsts.lismenustepover
#, fuzzy
#| msgid "&Step over"
msgid "&Step Over"
msgstr "Passa oltre"
#: lazarusidestrconsts.lismenustepovercontext
#, fuzzy
#| msgid "Step over (Context)"
msgid "Step Over (Context)"
msgstr "Passa oltre (Contesto)"
#: lazarusidestrconsts.lismenustepoverinstr
#, fuzzy
#| msgid "Step over instruction"
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "Passa oltre l'istruzione"
#: lazarusidestrconsts.lismenustepoverinstrhint
#, fuzzy
#| msgid "Step over instruction"
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "Passa oltre l'istruzione"
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutabstospacesselection
#, fuzzy
#| msgid "Tabs to spaces in selection"
msgid "Tabs to Spaces in Selection"
msgstr "Trasforma tabulazioni nella selezione in spazi"
#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Informazioni"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Contenuti"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Menu modifica standard"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Menu file standard"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Menu aiuto standard"
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Trova"
#: lazarusidestrconsts.lismenutemplatefindnext
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
msgid "Find Next"
msgstr "Trova il prossimo"
#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Apri recenti"
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Tutorial"
#: lazarusidestrconsts.lismenutogglecomment
#, fuzzy
#| msgid "Toggle comment"
msgid "Toggle Comment in Selection"
msgstr "Mostra/nascondi commenti"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "S&trumenti"
#: lazarusidestrconsts.lismenuuncommentselection
#, fuzzy
#| msgid "Uncomment selection"
msgid "Uncomment Selection"
msgstr "De-commenta la selezione"
#: lazarusidestrconsts.lismenuunindentselection
#, fuzzy
#| msgid "Unindent selection"
msgid "Unindent Selection"
msgstr "De-indenta selezione"
#: lazarusidestrconsts.lismenuuppercaseselection
#, fuzzy
#| msgid "Uppercase selection"
msgid "Uppercase Selection"
msgstr "Selezione in maiuscolo"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr ""
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Visualizza"
#: lazarusidestrconsts.lismenuviewanchoreditor
#, fuzzy
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "mostra editor àncore"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Breakpoint"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Stack di chiamata"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Browser del codice"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Ispettore del codice"
#: lazarusidestrconsts.lismenuviewcomponentpalette
#, fuzzy
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Tavolozza dei componenti"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Componenti"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Log degli eventi"
#: lazarusidestrconsts.lismenuviewdebugoutput
#, fuzzy
#| msgid "Debug output"
msgid "Debug Output"
msgstr "Segnalazioni di debug"
#: lazarusidestrconsts.lismenuviewforms
#, fuzzy
#| msgid "Forms..."
msgid "Forms ..."
msgstr "Form..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lismenuviewidespeedbuttons
#, fuzzy
#| msgid "IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE Speed Buttons"
msgstr "Visualizza gli speed buttons dell'IDE"
#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump History ..."
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Visualizza storico salti ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Variabili locali"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Messaggi"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Analizzatore oggetti"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr ""
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgid "Terminal Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registri"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Registro delle restrizioni"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Risultati della ricerca"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor sorgente"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr ""
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.lismenuviewtoggleformunit
#, fuzzy
#| msgid "Toggle form/unit view"
msgid "Toggle Form/Unit View"
msgstr "Abilita/disabilita viste form/unit"
#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "Unit Dependencies ..."
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Visualizza dipendenze unit"
#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "Unit Information"
msgid "Unit Information ..."
msgstr "Mostra informazioni sulla unit"
#: lazarusidestrconsts.lismenuviewunits
#, fuzzy
#| msgid "Units..."
msgid "Units ..."
msgstr "Unit..."
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Viste di watch"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr ""
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Finestre"
#: lazarusidestrconsts.lismeother
#, fuzzy
#| msgid "Other"
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Varie"
#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr ""
#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr "Il messaggio non dà informazioni sulla posizione nel file:%s%s"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor di messaggi"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Metodo di classe non trovato"
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Eventi non trovati"
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Identificatori non trovati"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Mancano pacchetti"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Potete scegliere fra:"
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Commenta via"
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Solo per Delphi"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Commentare le unit selezionate"
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Usare le unit solo per Delphi."
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Cercare le unit. I path trovati saranno aggiunti alle impostazioni di progetto."
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Lasciar perdere, installare package o correggere il path e riprovare."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Path di ricerca delle unit"
#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr ""
#: lazarusidestrconsts.lismitnotice
msgid "<description>%sCopyright (c) <year> <copyright holders>%sPermission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:%sThe above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.%sTHE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr ""
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr ""
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr ""
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr ""
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr ""
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr ""
#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
msgid "expected \":=\" after macro name, but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
msgid "expected macro name, but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmfromto
msgid "From %s to %s"
msgstr ""
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr ""
#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgid "Move selected item down"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemup
msgid "Move selected item up"
msgstr ""
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr ""
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr ""
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr ""
#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr ""
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr ""
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr ""
#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmwas
msgid "(was \"%s\")"
msgstr ""
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<descrizione>%sCopyright (C) <anno><nome dell'autore><contatto>%sQuesto sorgente è software libero; potete ridistribuirlo e/o modificarlo sotto le condizioni stabilite dalla GNU General Public License, come è edita dalla Free Software Foundation; potete usare o la versione 2 della licenza oppure, a vostra scelta, una versione successiva con le seguenti modifiche:%sCome eccezione speciale, i detentori del copyright di questa libreria vi accordano il permesso di linkare questa libreria con moduli indipendenti per produrre un eseguibile, a prescindere dai termini di licenza dei suddetti moduli indipendenti, e di copiare e distribuire l'eseguibile prodotto sotto una licenza di vostra scelta, posto che essa soddisfi, per ciascun modulo indipendente linkato, i termini e condizioni della licenza di quel modulo. Un modulo indipendente è un modulo che non è derivato da o basato su questa libreria.Se modificate questa libreria, potete estendere questa eccezione alla vostra versione della libreria, ma non siete obbligati a farlo. Se non volete farlo, cancellate questa dichiarazione di eccezione dalla vostra versione.%sQuesto codice è distribuito con la speranza che sia utile, ma SENZA NESSUNA GARANZIA; senza nemmeno l'implicita garanzia di COMMERCIABILITA' e di IDONEITA' PER UN PARTICOLARE SCOPO. Leggete la GNU General Public License per ulteriori dettagli. %sUna copia della GNU General Public License è disponibile sul World Wide Web sul sito <http://www.gnu.org/copyleft/gpl.html>. Potete anche ottenerla scrivendo a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Modifica"
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Altro"
#: lazarusidestrconsts.lismoresub
#, fuzzy
#| msgid "More ..."
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More >>"
msgstr "Ancora ..."
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Muovi \"%s\" una posizione più giù"
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Muovi \"%s\" una posizione più su"
#: lazarusidestrconsts.lismovepage
#, fuzzy
#| msgid "Move Page ..."
msgid "Move Page"
msgstr "Spostare pagina ..."
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr ""
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr ""
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr ""
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Salva i messaggi in un file (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Nome"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Conflitto di nomi"
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr ""
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nome della nuova procedura"
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Mai"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Nuovo"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nuova classe"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nuova applicazione console"
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Crea un nuovo file.%sScegliere il tipo."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Crea un file di testo vuoto."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Crea un nuovo progetto.%sScegliere il tipo."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Crea un nuovo packege standard.%sUn package è un insieme di unit e componenti."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Crea una nuova unit con un modulo dati."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Crea una nuova unit con un frame."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Crea una nuova unit con una form LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr ""
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nessuna voce selezionata"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Selezionare prima una voce."
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nuova codifica:"
#: lazarusidestrconsts.lisnewmacroname
msgid "Macro %d"
msgstr ""
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr ""
#: lazarusidestrconsts.lisnewproject
#, fuzzy
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "%s - (nuovo progetto)"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr ""
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
#, fuzzy
#| msgid "New units are added to uses sections:"
msgid "New units are added to uses sections"
msgstr "Aggiunte nuove unit alla sezione uses:"
#: lazarusidestrconsts.lisno
msgid "No"
msgstr "No"
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Non fare il backup dei file"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Non è selezionato alcun profilo da costruire."
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Nessun cambiamento"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nessun codice selezionato"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Nessuna opzione di compilazione ereditata."
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "Nessun consiglio"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Nessuna finestra IDE selezionata"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Nessun file LFM"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Nessuna macro selezionata"
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "senzanome"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%snessuno"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "nessuno, clicca per sceglierne uno"
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "nessun nodo selezionato"
#: lazarusidestrconsts.lisnopascalfile
#, fuzzy
#| msgid "No pascal file"
msgid "No Pascal file"
msgstr "Nessun file Pascal"
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Nessun file programma %s%s%s trovato."
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nessuna sezione ResourceString trovata"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
#, fuzzy
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalmente il filtro è un'espressione regolare. Nella Simple Syntax un . è un normale carattere, un * sta per qualsiasi cosa, un ? sta per qualsiasi caratterre singolo, e la virgola ed il punto e virgola separano le alternative. Per esempio: la Simple Syntax *.pas *pp corrisponde all'espressione regolare ^(.*\\pas|.*\\.pp)$ "
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nessuna stringa costante trovata"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr ""
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Non è l'installazione di un package"
#: lazarusidestrconsts.lisnotavalidpascalidentifier
#, fuzzy
#| msgid "Not a valid pascal identifier"
msgid "Not a valid Pascal identifier"
msgstr "Non è in identificatore Pascal valido"
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Basso"
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Sinistra"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Cima"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "Nota: impossibile creare il modello define per sorgenti Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "Nota: impossibile creare il modello define per sorgenti Lazarus"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr ""
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Non implementato"
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Ancora non implementato:%s%s"
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Non ora"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr ""
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Crea"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Crea un nuovo progetto"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Numero di files da convertire: %s"
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "cammino oggetto"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Passa ai tab Favorites dell'Object Inspector"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr "Passa ai tab Favorites dell'Object Inspector dopo aver chiesto il nome del componente"
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr ""
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Classe %s%s%s non trovata."
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "autoinstallato dinamico"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "autoinstallato statico"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Descrizione: "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sDescrizione: %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Nome file: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "installato dinamico"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "installato statico"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "mancante"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "modificato"
#: lazarusidestrconsts.lisoipopenloadedpackage
#, fuzzy
#| msgid "Open loaded package"
msgid "Open Loaded Package"
msgstr "Apri pacchetto caricato"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nome pacchetto"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Selezionare un pacchetto"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "solalettura"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Stato"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sQuesto pacchetto è installato ma il file lpk non è stato trovato"
#: lazarusidestrconsts.lisok
#, fuzzy
#| msgid "ok"
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "ok"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Vecchia classe"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr ""
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Su riga di break (es. tasto return o enter)"
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Ricerca solo parole intere"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Su incolla da appunti"
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Apri"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Apri come file XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Apri il designer quando apri una unit"
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Apri un file già esistente"
#: lazarusidestrconsts.lisopenfile
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Apri file"
#: lazarusidestrconsts.lisopenfile2
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Apri file"
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Apri %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Aprire il pacchetto?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Aprire il pacchetto %s"
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Apri file pacchetto"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Aprire il progetto?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Apri progetto"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Apri di nuovo il progetto"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Apri file progetto"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Apri symlink"
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Apri destinazione"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Apri il file come sorgente normale"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Aprire il pacchetto %s?"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Aprire il progetto %s?"
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr ""
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr ""
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "oppure"
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Imposta la lingua usata. Per esempio --language=de. Per i possibili valori vedi i files nella cartella languages."
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%signora il compilatore di default (es. ppc386 ppcx64 ppcppc ecc.). il valore è salvato in environmentoptions.xml"
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
#, fuzzy
#| msgid "%soverride the project build mode."
msgid "%soverride the project or IDE build mode."
msgstr "%signora il modo di costruzione del progetto."
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%signora la CPU del progetto (es. i386 x86_64 powerpc ecc.). Default: %s"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%signora il sistema operativo del progetto (es. win32, linux). Default: %s"
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%signora il set di widget del progetto (es. gtk2 qt win32 ecc.). Default: %s"
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Sovrascrivere il file?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Sovrascrivi il file su disco"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Owner' è già usato da TReader/TWriter. Scegliete un altro nome."
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Pacchetto"
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "pacchetto %s"
#: lazarusidestrconsts.lispackageinfo
#, fuzzy
#| msgid "Package Info"
msgid "Package info"
msgstr "Informazioni sul pacchetto"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Il nome del pacchetto inizia con ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Il nome del Pacchetto contiene ..."
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Il pacchetto necessita di installazione"
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr ""
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr ""
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "unit del package "
#: lazarusidestrconsts.lispage
msgid "Page"
msgstr ""
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", analizzato"
#: lazarusidestrconsts.lispascalfile
msgid "Pascal file"
msgstr ""
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Conteggio dei passi"
#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Incolla"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "incolla dagli appunti"
#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr "Incolla testo dagli appunti"
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Percorso"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Esplora"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr ""
#: lazarusidestrconsts.lispatheditmovepathdown
#, fuzzy
#| msgid "Move path down"
msgid "Move path down (Ctrl+Down)"
msgstr "Sposta il cammino giù"
#: lazarusidestrconsts.lispatheditmovepathup
#, fuzzy
#| msgid "Move path up"
msgid "Move path up (Ctrl+Up)"
msgstr "Sposta il cammino su"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr ""
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr ""
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr ""
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Modelli di cammino"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Percorsi di ricerca:"
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr ""
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Cartella dell'utility make"
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Cartella della Instance fallita:"
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "&Pausa"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr ""
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr ""
#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Aggiungi una voce"
#: lazarusidestrconsts.lispckeditaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Aggiungere al progetto"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Applica i cambiamenti"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Chiama %sregistra%s la procedura della unit selezionata"
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr ""
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Cancella nome del file delle dipendenze preferito/di default"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Compilare tutto?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compila il pacchetto"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Opzioni del compilatore per il pacchetto %s"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr ""
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Crea il Makefile"
#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr ""
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Proprietà delle dipendenze"
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Modifica opzioni generali"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Proprietà del file"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Installa"
#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Installa pacchetto nell'IDE"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Versione massima non valida"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Versione minima non valida"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Versione massima:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Versione minima:"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Modificato: %s"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Sposta dipendenza in giè¹"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Sposta dipendenza in su"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Pacchetto %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Il pacchetto %s%s%s è cambiato.%sSalvare il pacchetto?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "pacchetto %s non salvato"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Pagina: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Ri-aggiungi dipendenza"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Ri-aggiungi file"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Sola lettura: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
#, fuzzy
#| msgid "Recompile all required"
msgid "Recompile All Required"
msgstr "Ricompila tutto quello che serve"
#: lazarusidestrconsts.lispckeditrecompileclean
#, fuzzy
#| msgid "Recompile clean"
msgid "Recompile Clean"
msgstr "Ricompila dopo un clean"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Ri-compilare questo e tutti i pacchetti richiesti?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Plugin registrati"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registra la unit"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Rimuovi dipendenza"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Rimuovere la dipendenza?"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Rimuovere le dipendenze %s%s%s%sdal pacchetto %s%s%s?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Pacchetti richiesti rimossi"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Rimuovi file"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Rimuovere il file?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Rimuovere il file %s%s%s%sdal pacchetto %s%s%s?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Rimuovi voce selezionata"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Pacchetto richiesto"
#: lazarusidestrconsts.lispckeditsavepackage
#, fuzzy
#| msgid "Save package"
msgid "Save Package"
msgstr "Salva il pacchetto"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Salva il nome del file come default per questa dipendenza"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Salva il nome del file come preferito per questa dipendenza"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La versione massima %s%s%s non è una versione di pacchetto valida.%s(un esempio valido è 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La versione minima %s%s%s non è una versione di pacchetto valida.%s(un esempio valido è 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Disinstalla"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Mostra sorgente del pacchetto"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr ""
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Installato"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Installa alla prossima partenza"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sStato: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
#, fuzzy
#| msgid "Uninstall on next start"
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Disinstalla alla prossima partenza"
#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr ""
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Aggiungi opzioni ai pacchetti e progetti dipendenti"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Aggiungi percorsi ai pacchetti/progetti dipendenti"
#: lazarusidestrconsts.lispckoptsauthor
#, fuzzy
#| msgid "Author:"
msgid "Author"
msgstr "Autore:"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Esegui automaticamente il build se necessario"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Quando ricostruisci tutto, fallo automaticamente"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Personalizzato"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
#, fuzzy
#| msgid "Description/Abstract"
msgid "Description / Abstract"
msgstr "Descrizione/Sommario"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
#, fuzzy
#| msgid "Designtime and Runtime"
msgid "Designtime and runtime"
msgstr "Progettazione e esecuzione"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrazione IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Include"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Tipo pacchetto non valido"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Libreria"
#: lazarusidestrconsts.lispckoptslicense
#, fuzzy
#| msgid "License:"
msgid "License"
msgstr "Licenza:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Maggiore"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Compilazione manuale (mai automaticamente)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minore"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Oggetto"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Opzioni pacchetto"
#: lazarusidestrconsts.lispckoptspackagetype
#, fuzzy
#| msgid "PackageType"
msgid "Package type"
msgstr "Tipo pacchetto"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Fornisce"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Versione"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Il pacchetto %s%s%s ha la flag di auto installazione.%sCiè² significa che sarà installato nell'IDE. I pacchetti di installazione%sdevono essere pacchetti di progettazione."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr ""
#: lazarusidestrconsts.lispckoptsupdaterebuild
#, fuzzy
#| msgid "Update/Rebuild"
msgid "Update / Rebuild"
msgstr "Aggiorna/Ricostruisci"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Uso"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr ""
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr ""
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr ""
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr ""
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Interrompi"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progressione"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr ""
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Trovato un conflitto"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Edita unit virtuale"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr ""
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Nome del file:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Ripara il case dei file"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nome del file della unit non valido"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nome della unit non valido"
#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr ""
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr ""
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgid "No files missing. All files exist."
msgstr ""
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr ""
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr ""
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr ""
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr ""
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr ""
#: lazarusidestrconsts.lispesortfiles
#, fuzzy
#| msgid "Sort Files"
msgid "Sort Files Permanently"
msgstr "Ordina i file"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr ""
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr ""
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nome della Unit:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr ""
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr ""
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr ""
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Aggiunta cammino sorgenti compilatore"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Cartella risultati"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Marca cartella sorgenti pacchetto"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Percorso unit"
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Vuoi veramente eliminare tutti i cambiamenti al pacchetto %s e ricaricarlo dal file?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nuova unit non nel cammino unit"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Pubblica package"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Ripristina pacchetto?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, fuzzy
#| msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
msgstr "Il file %s%s%s%snon è attualmente nel cammino unit del pacchetto.%s%sAggiungere %s%s%s al cammino unit?"
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Ci sono altre funzioni nel menu a scomparsa"
#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Binario"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "File include"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Problemi con il file XML"
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - form di testo Lazarus"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - risorsa Lazarus"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Unit principale"
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Testo"
#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Unit virtuale"
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sAggiunta nuova dipendenza per il pacchetto %s: pacchetto %s%s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sAggiunta nuova dipendenza per il progetto %s: pacchetto %s%s"
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Aggiunta unit al comando uses del pacchetto. Disabilitarlo solo per le unit che non debbano essere sempre compilate."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Trovata unit ambigua"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Pacchetti installati automaticamente"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sEntrambi i pacchetti sono connessi. Ciè² significa che un pacchetto usa l'altro o che entrambi sono usati da un terzo pacchetto."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dipendenza errata"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr ""
#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr "Compilazione del package %s"
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Cancellazione non riuscita"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Cancellare il vecchio file pacchetto?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Cancellare il vecchio file pacchetto %s%s%s?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Dipendenza senza proprietario: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Errore nella lettura del file"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Errore durante la lettura del pacchetto"
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Errore: aggiornamento dei file po fallito per il package %s"
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Errore nella scrittura del file"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Errore nella scrittura del pacchetto"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Il file è già nel pacchetto"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Il file è nel progetto"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Il nome del file differisce dal nome del pacchetto"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Il nome del file è in uso da un altro pacchetto"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Il nome del file è in uso dal progetto"
#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "File %s%s%s non trovato."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "File non salvato"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "L'installazione del pacchetto %s installerà automaticamente il pacchetto:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "L'installazione del pacchetto %s installera automaticamente i seguenti pacchetti:"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "nome file compilatore non valido"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Estensione del file non valida"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Estensione file pacchetto non valida"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nome file pacchetto non valido"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nome pacchetto non valido"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nome pacchetto non valido"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Caricando il pacchetto %s si sostituirà il pacchetto %s%sdal file %s.%sIl vecchio pacchetto è stato modificato.%s%sSalvare il vecchio pacchetto %s?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "Nuovo pacchetto"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Pacchetto: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Conflitti di pacchetto"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
#, fuzzy
#| msgid "Package is no designtime package"
msgid "Package is not a designtime package"
msgstr "Il pacchetto non è un pacchetto di progettazione"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Il pacchetto è necessario"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "file sorgente principale del pacchetto"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Il nome del pacchetto esiste già"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Il pacchetto deve avere l'estensione .lpk"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Salvare il file prima di aggiungerlo ad un pacchetto."
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Progetto: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Ricostruire Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Rinominare il file in minuscolo?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Sostituire file esistente %s%s%s?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Sostituisci file"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackage
#, fuzzy
#| msgid "Save Package?"
msgid "Save package?"
msgstr "Salvare il pacchetto?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Salva il pacchetto %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Rinomina del pacchetto in minuscolo in%s%s%s%s?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Salta questo pacchetto"
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "file configurazione pacchetti statici"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Il file compilatore per il pacchetto %s non è un eseguibile valido:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Il file %s%s%s%sè già nel pacchetto %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, fuzzy
#| msgid "The file %s%s%s is not a lazarus package."
msgid "The file %s%s%s is not a Lazarus package."
msgstr "Il file %s%s%s non è un pacchetto lazarus."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Il nome del file %s%s%s non corrisponde ad un nome pacchetto %s%s%s nel file.%sCambiare il nome del pacchetto in %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Il nome file %s%s%s è parte del progetto corrente.%sProgetti e pacchetti non devono condividere file."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Il nome del file %s%s%s è in uso dal%spacchetto %s%s%s%snel file %s%s%s."
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Il seguente pacchetto non è stato caricato: "
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "I seguenti pacchetti non sono stati caricati:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sLe seguenti unit saranno aggiunte alla sezione uses di%s%s:%s%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Il pacchetto %s%s%s non è stato compilato.%sLo tolgo dalla lista delle installazioni? "
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, fuzzy
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
msgstr "Il nome del pacchetto %s%s%s in%s%s%s%s non è valido per lazarus."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, fuzzy
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Il pacchetto %s è un pacchetto di sola esecuzione.%s Questi package non possono essere installati nell'IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, fuzzy
#| msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Il pacchetto %s%s%s è marcato per l'installazione ma non lo trovo.%sTolgo la dipendenza dall'elenco installazione pacchetti?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Il pacchetto %s è richiesto da %s, che è marcato per l'installazione.%sVedere il grafico pacchetto."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Il nome del package %s%s%s non è valido.%sScegliere un altro nome (es. pacchetto1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Il nome del pacchetto %s%s%s del%sfile %s%s%s%s non è valido."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, fuzzy
#| msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Il pacchetto %s%s%s è stato marcato.%sAttualmente lazarus supporta solo pacchetti con link statico. La vera disinstallazione necessita della ricostruzione e del rilancio di lazarus.%s%sVuoi ricostruirlo subito?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, fuzzy
#| msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Il pacchetto %s%s%s è marcato per l'installazione.%sAttualmente lazarus supporta solo pacchetti con link statico. L'installazione dovà ricostruire Lazarus e riavviarlo.%s%sVuoi ricostruire Lazarus ora?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Il progetto richiede il pacchetto %s%s%s.%sMa non è stato trovato, Vedere progetto -> Analizzatore progetti."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Ci sono due unit con lo stesso nome:%s%s1. %s%s%s da %s%s2. %s%s%s da %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Esiste una unit FPC con lo stesso nome del pacchetto:%s%s%s%s%s%s"
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Esiste una unit FPC con lo stesso nome di:%s%s%s%s%s da %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "C'è già un pacchetto con il nome %s%s%s.%sConflitto fra pacchetti. %s%s%s%sFile: %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, fuzzy
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Esiste già un pacchetto %s%s%s caricato%sdal file %s%s%s.%sVedere Componenti -> Grafico pacchetto.%sImpossibile sostituirlo."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "C'è un pacchetto non salvato fra quelli richiesti. Vedere il grafico pacchetti."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "C'è una unit con lo stesso nome di un pacchetto:%s%s1. %s%s%s da %s%s2. %s%s%s%s"
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Questo è un pacchetto virtuale. Non ha ancora sorgente. Salvare prima il pacchetto."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Impossibile creare la cartella"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Impossibile creare la cartella di output %s%s%s%sper il pacchetto %s."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Impossibile creare la cartella dei sorgenti del pacchetto %s%s%s%sper il pacchetto %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, fuzzy
#| msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Impossibile creare la cartella destinazione per lazarus:%s%s%s%s.%sLa cartella è necessaria per il nuovo IDE lazarus ricostruito con i pacchetti personalizzati."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Impossibile cancellare il file %s%s%s."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Impossibile cancellare il file"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Impossibile cancellare il vecchio file di stato %s%s%s%sper il pacchetto %s."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Impossibile caricare il package"
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Impossibile aprire il pacchetto %s%s%s.%sIl pacchetto è marcato per l'installazione."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Impossibile leggere il file stato %s%s%s%sdel pacchetto %s.%sErrore: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Impossibile scrivere il pacchetto %s%s%snel file %s%s%s.%sErrore: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Impossibile scrivere il file stato %s%s%s%sdel pacchetto %s.%sErrore: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Disinstallare pacchetto?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Disinstallare pacchetto %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Pacchetto non salvato"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Usa unit"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Attenzione: il file %s%s%s%sappartiene al progetto corrente."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "mantieni"
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "nuovo"
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "rimuovere"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr ""
#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "Installato"
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
#, fuzzy
#| msgid "Can not register components without unit"
msgid "Cannot register components without unit"
msgstr "Impossibile registrare componenti senza una unit"
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Classe componenti %s%s%s già definita"
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sNome file: %s%s%s"
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Classe componenti non valida"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Nome unit non valido: %s"
#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "File pacchetto non trovato"
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr ""
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "La procedura di registrazione è vuota"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RegisterUnit è stata chiamata ma nessun pacchetto è in registrazione."
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr ""
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Il pacchetto %s%s%s è installato, ma non c'è un file di pacchetto (.lpk) valido. %sE' stato creato un finto pacchetto incompleto. "
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Questo è il pacchetto predefinito. Usato solo per componenti senza un pacchetto. Questi componenti sono obsoleti."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Il pacchetto è installato, ma il suo file lpk non c'è: tutti i suoi componenti sono disattivati. Pregasi risolvere il problema."
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sNome unit: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr ""
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr ""
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options / Additions and Overrides%s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Questo file non è in nessun pacchetto caricato."
#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr ""
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Non riesco a leggere il file del pacchetto %s%s%s.%sErrore: %s"
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr ""
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Globale"
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Riferimenti del package"
#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Mostra riferimenti globali"
#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Mostra riferimenti utente"
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Utente"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgstr ""
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Aprire una unit prima di eseguire."
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Selezionare codice per estrarre una nuova procedura/metodo."
#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<TUTTI>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Cambia Carattere"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copia nome del metodo negli Appunti"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtra confrontando ogni parte del metodo"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtra confrontando l'inizio del metodo"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Salta alla Selezione"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Nessuno>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Oggetti"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Elenco procedure"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Scegliere la cartella dei file .po"
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Non salvare alcuna informazione di sessione"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Puntatore"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Salva nella cartella IDE config"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Salva nel file .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Salva nel file .lps nella cartella del progetto"
#: lazarusidestrconsts.lisposavesessionfoldstate
msgid "Save fold info"
msgstr ""
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Salva l'informazione di sessione in "
#: lazarusidestrconsts.lisposavesessionjumphistory
msgid "Save jump history"
msgstr ""
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Parola precedente"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "cartella di configurazione primaria, sede dei file di configurazione di Lazarus. Di default è "
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr ""
#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr ""
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Priorità"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Privato"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Metodo privato"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Forse devi installare alcuni package prima di continuare. %s%sAttenzione:%sIl progetto usa per l'esecuzione i seguenti pacchetti, che probabilmente sono necessari per aprire i suoi form nel form editor. Se continui adesso, potresti ricevere errori di componenti mancanti e il form editor mostrerà controlli incompleti o impossibili (non ci saranno conseguenze per i file sorgente) %s%sSi consiglia di annullare l'operazione, installare nell'IDE i componenti mancanti e riprovare.%s%s"
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedura"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedura con interfaccia"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programma"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Rilevato programma"
#: lazarusidestrconsts.lisprogramnotfound
msgid "Program %s not found"
msgstr ""
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr ""
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
#, fuzzy
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "I sorgenti del programma devono avere un'estensione tipo pascal come .pas, .pp o .lpr"
#: lazarusidestrconsts.lisprojaddaddfilestoproject
#, fuzzy
#| msgid "Add files to project"
msgid "Add Files to Project"
msgstr "Aggiungi file al progetto"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "La dipendenza esiste già"
#: lazarusidestrconsts.lisprojaddeditorfile
#, fuzzy
#| msgid "Add editor files"
msgid "Add Editor Files"
msgstr "Aggiungi file editor"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Versione Min-Max non valida"
#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Nome pacchetto non valido"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
#, fuzzy
#| msgid "Invalid pascal unit name"
msgid "Invalid Pascal unit name"
msgstr "Nome unit pascal non valida"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Versione non valida"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Versione massima (opzionale):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Versione minima (opzionale):"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nuovo requisito"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nome pacchetto:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Pacchetto non trovato"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "La dipendenza %s%s%s non è stata trovata.%sScegliere un pacchetto esistente."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "La versione massima %s%s%s non è valida.%sUsare il formato major.minor.release.build%sPer esempio: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La versione massima è più bassa della versione minima."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "La versione minima &s%s%s non è valida.%sUsare il formato major.minor.release.build%sPer esempio: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Il nome pacchetto %s%s%s non è valido.%sPrego scegliere un pacchetto esistente."
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Il progetto ha già una dipendenza per il pacchetto %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Il nome unit %s%s%s esiste già nel progetto%scon file: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Il nome unit %s%s%s esiste già nella selezione%scon file: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The unit name %s%s%s is not a valid pascal identifier."
msgid "The unit name %s%s%s is not a valid Pascal identifier."
msgstr "Il nome unit %s%s%s non è un identificatore valido pascal."
#: lazarusidestrconsts.lisprojaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to Project"
msgstr "Aggiungi al progetto"
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Il nome unit esiste già"
#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr ""
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Il progetto è cambiato"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "I file del progetto su disco sono cambiati"
#: lazarusidestrconsts.lisprojectcount
msgid "%d projects"
msgstr ""
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Cartella progetto"
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Il titolo nella taskbar mostra anche la cartella del progetto"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nome file progetto"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Percorso degli include del progetto"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Rilevato file di informazioni sul progetto"
#: lazarusidestrconsts.lisprojectinformation
#, fuzzy
#| msgid "Project Information"
msgid "Project information"
msgstr "Informazione sul progetto"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Il progetto è eseguibile"
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Proprietà delle macro del progetto"
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Cartella di output del progetto (es. la cartella ppu)"
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr ""
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Cartella del file principale del progetto"
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr ""
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr ""
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Il progetto %s ha sollevato una eccezione di classe '%s'."
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Il progetto %s ha sollevato una eccezione di classe '%s' con messaggio:%s%s."
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Percorso dei sorgenti del progetto"
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#, fuzzy
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "Il progetto %s%s%s è stato costruito con successo. :)"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "unit del progetto"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Percorso della unit del progetto"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Wizard dei progetti"
#: lazarusidestrconsts.lisprojfiles
msgid "Files:"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Conferma la cancellazione della dipendenza"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Conferma la rimozione del file"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Cancella la dipendenza di %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Analizzatore progetti - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Pacchetti richiesti rimossi"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Rimuovo il file %s dal progetto?"
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Non posso leggere il file di stato %s del progetto %s%s Errore: %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Non posso scrivere lo stato del progetto %s%s Errore: %s"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Costruisci sempre (anche se nulla è cambiato)"
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Errore"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Impossibile cambiare l'elenco form autogenerate nei sorgenti del programma.%sCorreggere prima gli errori."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Simbolo di cartella dei sorgenti di progetto"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Prompt di richiesta dato"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Proprietà (togli o cambia)"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protetto"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Metodo protetto"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Metodo pubblico"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Metodo pubblicato"
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Pubblica cartella progetto"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr ""
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
#, fuzzy
#| msgid "Invalid Exclude filter"
msgid "Invalid exclude filter"
msgstr "Filtro exclude non valido"
#: lazarusidestrconsts.lispublprojinvalidincludefilter
#, fuzzy
#| msgid "Invalid Include filter"
msgid "Invalid include filter"
msgstr "Filtro include non valido"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Salva file .lrs nella cartella di output"
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
#, fuzzy
#| msgid "A pascal unit must have the extension .pp or .pas"
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Una unit pascal deve avere un'estensione .pp o .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Edita unit virtuale"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "C'è già una unit con questo nome.%sFile: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The unitname is not a valid pascal identifier."
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Il nome della unit non è un identificatore pascal valido"
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
#, fuzzy
#| msgid "The unitname is used when the IDE extends uses clauses."
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "Il nome della unit è usato quando la IDE estende la clausola 'uses'."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Il nome della Unit e del file non corrispondono.%sEsempio: unit1.pas e Unit1"
#: lazarusidestrconsts.lispwconvertproject
#, fuzzy
#| msgid "Convert Delphi Project"
msgid "Convert &Delphi Project"
msgstr "Convertire un progetto Delphi"
#: lazarusidestrconsts.lispwnewproject
#, fuzzy
#| msgid "New Project"
msgid "&New Project"
msgstr "Nuovo Progetto"
#: lazarusidestrconsts.lispwopenproject
#, fuzzy
#| msgid "Open Project"
msgid "&Open Project"
msgstr "Apri progetto"
#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent Project"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Apri recenti"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr ""
#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr "Crea variabile locale"
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Rimedi veloci"
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Rimedio veloce: togli la unit"
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Cerca l'identificatore"
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Esci"
#: lazarusidestrconsts.lisquitlazarus
#, fuzzy
#| msgid "Quit Lazarus"
msgid "&Quit Lazarus"
msgstr "Esci da Lazarus"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Errore di lettura"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr ""
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr ""
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Record"
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr ""
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Record/Struttura"
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Ripristina"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Registri"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Espressione regolare"
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Percorsi relativi"
#: lazarusidestrconsts.lisremove
#, fuzzy
#| msgid "remove"
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "rimuovere"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Elimina tutte le proprietà non valide"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Togli tutte le unit"
#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Togli dalla lista di installazione"
#: lazarusidestrconsts.lisremovefromproject
#, fuzzy
#| msgid "Remove from project"
msgid "Remove from Project"
msgstr "Togli dal progetto"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Togli dal cammino di ricerca"
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr ""
#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Elimina la variabile locale %s"
#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr "Elimina la variabile locale"
#: lazarusidestrconsts.lisremovenonexistingfiles
#, fuzzy
#| msgid "Remove non existing files"
msgid "Remove nonexistent files"
msgstr "Rimuovi file non esistenti"
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Rimuovi le unit scelte"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Rimuovili"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Rimuovi i cammini da \"Altri sorgenti\""
#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr "Rimuovi la unit dalla sezione 'uses'"
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr ""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Rinomina"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr ""
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Rinomina il file?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Rinomina del file fallita"
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr ""
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Rinomina a %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Rinomina in minuscolo"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Riapri il progetto"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Riaprire con altra codifica"
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Ripeti conteggio:"
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "&Sostituisci"
#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacedtypeswiths
msgid "Replaced type \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Sostituzione"
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Sostituisci funzioni"
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Sostituzioni"
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Ripara unità e tipi sconosciuti"
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr ""
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Sostituzione della selezione fallita."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr ""
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr "Necessario FPC 2.4 o più recente. Risorse in formato Delphi"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Ri-ricerca"
#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr ""
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr ""
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr ""
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Errore di salvataggio risorsa"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
#, fuzzy
#| msgid "Resource type of project:"
msgid "Resource type of project"
msgstr "Tipo delle risorse del progetto:"
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "&Riavvia"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Risultato:"
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "ritorna lalista di tutti i valori della variabile case a fronte della variabile"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Ripristino fallito"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Destra"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Ancoraggio a destra"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Spazio del bordo destro. Il valore è sommato allo spazio base del bordo e usato per lo spazio a sinistra del controllo."
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Questo è il controllo compagno a cui il lato destro è ancorato. Lasciare vuoto per il controllo padre."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Lato destro"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Spazia a destra equidistante"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Radice"
#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr ""
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Esegui"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr ""
#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Esegui"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "%s (in esecuzione...)"
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "File non eseguibile"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "L'applicazione host %s%s%s non è eseguibile"
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Esegui"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr ""
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr ""
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgstr ""
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Fallito \"esegui fino a\""
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
#, fuzzy
#| msgid "Abstract methods - not yet overridden"
msgid "Abstract Methods - not yet overridden"
msgstr "Metodo astratto - non ancora overloadato"
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Metodo astratto di %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Il cursore non è nella dichiarazione di classe"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "L'IDE è occupata"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s è una classe astratta e ha %s metodi astratti."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Nessun metodo astratto trovato"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Sovrascrivi tutta la selezione"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Sovrascrivi il primo selezionato"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Selezione nulla"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Ci sono %s metodi astratti da sovrascrivere.%sScegliere i metodi per cui creare degli stub:"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Non ci sono altri metodi astratti da sovrascrivere"
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Non si può sovrascrivere un metodo con un altro nella stessa classe"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Non posso mostrare i metodi astratti della classe attuale, perché"
#: lazarusidestrconsts.lissave
#, fuzzy
#| msgid "Save ..."
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Salva ..."
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Salva tutto"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr ""
#: lazarusidestrconsts.lissaveallmessagestofile
#, fuzzy
#| msgid "Save all messages to file"
msgid "Save All Messages to File"
msgstr "Salva tutti i messaggi su file"
#: lazarusidestrconsts.lissaveallmodified
#, fuzzy
#| msgid "save all modified files"
msgid "Save all modified files"
msgstr "salva tutti i file modificati"
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Salva e esci dalla finestra"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Salva e ricostruisci l'IDE"
#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Salva come"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr ""
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Salvare i cambiamenti?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Salva i cambiamenti al progetto %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
#, fuzzy
#| msgid "save current editor file"
msgid "Save current editor file"
msgstr "salva file dell'editor corrente"
#: lazarusidestrconsts.lissavedsuccessfully
msgid "Saved successfully"
msgstr ""
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr ""
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr ""
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Salva le informazioni dell'editor per i file non di progetto"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Salva con nome"
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Salva il file %s%s%s%sprima di chiudere la form %s%s%s?"
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Salva l'informazione dei file dell'editor chiusi"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr ""
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Salva il progetto %s (*%s)"
#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr ""
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Salva le impostazioni"
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Salva "
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Fattore di scala:"
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr ""
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr ""
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr ""
#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr "Cerca unit"
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "cartella di configurazione secondaria, dove Lazarus cerca i modelli di file di configurazione. Di default è "
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr ""
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Vedi messaggi."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sVedi progetto -> Analizzatore progetti"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Seleziona una voce di aiuto:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Seleziona un nodo"
#: lazarusidestrconsts.lisselectanotherlclwidgetsetmacrolclwidgettype
msgid "Select another LCL widget set (macro LCLWidgetType)"
msgstr ""
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Seleziona file form Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Selezionato"
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr ""
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(selezionato vicino sotto) "
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr ""
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr ""
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(selezionato vicino a sinistra) "
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(selezionato vicino a destra) "
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(selezionato vicino sopra) "
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Scegli il file"
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "La selezione è più lunga della costante stringa"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Strumento di selezione"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr ""
#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr ""
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Imposta default"
#: lazarusidestrconsts.lissetupdefaultindentation
#, fuzzy
#| msgid "(Setup default indentation)"
msgid "(Set up default indentation)"
msgstr "(imposta indentazione di default)"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Breve:"
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr ""
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Mostra suggerimenti di dichiarazione"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Mostra differenze fra modi ..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Mostra unit/package vuoti"
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr "Mostra Glifi per:"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Mostra separatore"
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr ""
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Mostra suggerimenti nell'analizzatore oggetti"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Mostra gli identificatori"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Mostra box informazioni"
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr ""
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview Gutter"
msgstr ""
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Mostra i pacchetti"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr ""
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr ""
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr ""
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Mostra caratteri speciali"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr "Mostra barra di stato"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Mostra le unit"
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr ""
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Mostra i suggerimenti sui valori nel debugging"
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "Mostra versione ed esci"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Riduci al più piccolo"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Fratello"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr ""
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr ""
#: lazarusidestrconsts.lissimplesyntax
#, fuzzy
#| msgid "Simple Syntax"
msgid "Simple syntax"
msgstr "Sintassi semplice"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr ""
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Salta file"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Salta il file e continua a caricare"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Non caricare l'ultimo progetto"
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr ""
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Corrispondenze"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Spiacente, questo tipo non è ancora implementato"
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Ascendente"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "Maiuscolo/Minuscolo"
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Discendente"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Dominio"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignora gli spazi"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Righe"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opzioni"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragrafi"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Anteprima"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Accetta"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Ordina selezione"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Parole"
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Sorgente e destinazione sono uguali:%s%s"
#: lazarusidestrconsts.lissourcebreakpoint
#, fuzzy
#| msgid "&Source Breakpoint..."
msgid "&Source Breakpoint ..."
msgstr "Breackpoint &sorgente"
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Le cartelle sorgente %s%s%s%se destinazione%s%s%s%s coincidono.%s%s%sForse non avete ben capito questa funzione:%sla cartella destinazione sarà svuotata e il suo contenuto cancellato (se esiste: se non esiste sarà creata ex novo)%s e il package/progetto sarà copiato dentro di essa."
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "La cartella sorgente %s%s%s non esiste."
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr ""
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Sorgente modificato"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Il sorgente della pagina %s%s%s è cambiato. Salvarlo?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr "I sorgenti di più pagine sono stati modificati. Salvare la pagina%s%s%s? (altre %d)"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Percorsi dei sorgenti"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Spazia equidistante"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Cerca SO"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Sto cercando"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Trova il testo"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Inizia la conversione"
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Inizia con un nuovo progetto"
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Stop"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Fermare il debugging corrente e ricostruire il progetto?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Fermo il debug?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Fermo il debug?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Fermati per le eccezioni"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Fermo il debug?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr ""
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "File lpi sospetto"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Errore di streaming"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Stringa"
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Stile"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Sub procedura"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Sub procedura sullo stesso livello"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Successo"
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr ""
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Cammino di include sospetto"
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Cammino delle unit sospetto"
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Revisione SVN:"
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nome variabile non valido"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s non è un identificatore valido"
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Sovrascrivi variabile di sistema"
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Modo sintassi"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr ""
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr ""
#: lazarusidestrconsts.listaborderof
#, fuzzy
#| msgid "Tab Order of"
msgid "Tab Order of %s"
msgstr "Ordine di tabulazione di "
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr ""
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr ""
#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr ""
#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr ""
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr ""
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "CPU di destinazione"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Nome file destinazione: (-o, vuoto = usa cartella di output delle unit)"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Nome file di destinazione (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Nome file di destinazione del progetto"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Nome file di destinazione e parametri"
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "SO di destinazione"
#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Errore interno del compilatore ! (%d)"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Cella editabile"
#: lazarusidestrconsts.listemplateeditparamcellhelp
#, fuzzy
msgid "Inserts an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgstr ""
"Inserisci una cella editabile con un valore di default\n"
"\"\",Sync=n (,S=n), per Sync con una cella precedente (n=1 per la cella precedente più alta\n"
"\"default\",Sync, per Sync con una cella con lo stesso valore di default\n"
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Cartella di test"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "Creato Application Bundle per \"%s\""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, fuzzy
#| msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "La classe %s%s%s è un TControl e può essere incollata solo su un controllo.%sImpossibile incollare."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "I codetools hanno trovato un errore:%s%s%s"
#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Il comando dopo %s%s%s non è eseguibile."
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Il comando dopo la pubblicazione non è valido:%s%s%s%s"
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Non si può cancellare il componente %s, perché non è posseduto da %s."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "L'editor di componenti della classe %s%s%s ha creato l'errore:%s%s%s%s"
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "L'editor componente della classe %s%s%s%sinvocata con il verbo #%s %s%s%s%sha prodotto l'errore:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Il componente %s è ereditato da %s.%sDeve essere cancellato dall'interno del componente antenato."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Il componente %s è ereditato da %s.%sDeve essere rinominato dall'interno del componente antenato."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
#, fuzzy
#| msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "Il nome del componente deve essere unico in tutti i componenti del formo del datamodule. Il nome è trattato senza fare differenze tra maiuscole e minuscole come i normali identificatori pascal."
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr ""
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
msgid "The %s contains a nonexistent directory:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr ""
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr ""
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
#, fuzzy
#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "La cartella sorgenti del Free Pascal corrente %s%s%snon sembra corretta.%sScegliere Ok per impostare la predefinita %s%s%s.%sAltrimenti controllare Ambiente -> Opzioni di ambiente -> File"
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
#, fuzzy
#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "La cartella Lazarus corrente %s%s%s%snon sembra corretta.%sSenza di essa non si potranno creare applicazioni LCL.%sScegliere Ok per impostare la predefinita %s%s%s.%sAltrimenti controllare Ambiente -> Opzioni di ambiente -> File"
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, fuzzy
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
msgstr "Il debugger %s%s%s%snon esiste o non è eseguibile.%s%sVedere Ambiente -> Opzioni di debug"
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr ""
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "La cartella di destinazione%s%s%s%s non esiste."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "La cartella di destinazione%s%s%s%s non esiste.%sControllate il nome file di destinazione in Menu -> Progetto -> Opzioni progetto."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "La cartella %s%s%s non è più usata nel cammino delle unit.%s La rimuovo?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr "La cartella %s%s%s non è scrivibile."
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "La cartella %s%s%s non è ancora presente nel cammino dei moduli. %La aggiungo?"
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "La cartella %s non è stata trovata."
#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Il file %s%s%s"
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Il file %s non sembra essere un file .lpi."
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "L'indice del file serve per funzioni come 'trova dichiarazione' Durante la ricerca potete modificare e compilare i sorgenti, ma le funzioni come 'trova dichiarazione' mostreranno errori di 'unit non trovata'. Ci vorrà un minuto o due."
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Il file %s%s%s è un symlink.%s%sApro %s%s%s al suo posto?"
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, fuzzy
#| msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgid "The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?"
msgstr "Il file %s%s%s non è un progetto Lazarus.%sCreo un nuovo progetto per questo %s?"
#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, fuzzy
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Il file %s%s%s%ssembra essere un programma. Chiudere il progetto corrente e creare un nuovo progetto Lazarus per questo programma?%s\"No\" caricherà il file come sorgente normale."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, fuzzy
#| msgid "The file %s seems to be the program file of an existing lazarus Project."
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Il file %s sembra essere un programma o un progetto di Lazarus già esistente."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Il file %s%s%s%s è stato trovato nella cartella dei sorgenti del package %s e sembra una unit compilata. Per cui dovrebbe invece stare nella cartella di output del package, altrimenti altri package che usano questo avranno dei problemi.%s%sCancello il file ambiguo?"
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Il file %s%s%s%snon è stato trovato.%svolete cercarlo da soli?%s"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Il file %s%s%s%snon è stato trovato.%sIgnora continuerà a caricare il progetto, %sAnnulla fermerà il caricamento."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "I seguenti metodi usati da %s non sono nel sorgente%s%s%s%s%s%sRimuovere i riferimenti errati?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "L'identificatore è una unit. Usate la funzione File -> Salva per rinominare una unit."
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "Il tasto %s%sè già assegnato a %s.%s%sSostituire il vecchio assegnamento con la nuova funzione?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "L'Application Bundle %s%snecessario per l'esecuzione non esiste oppure non è eseguibile.%sNe volete creare uno?%s%sVedi Progetto -> Opzioni progetto -> Applicazione per le impostazioni necessarie."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "L'applicazione di partenza %s%s%s%snon esiste o non è eseguibile.%s%sVedere Esegui -> parametri di esecuzione -> Locale"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "Il file (form Lazarus) LFM contiene proprietà non valide. Ciò significa per esempio che contiene proprietà/classi che non esistono nella LCL corrente. Il rimedio classico è di eliminare queste proprietà dall'LFM e aggiustare il codide pascal manualmente."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, fuzzy
#| msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgid "The new include file is not yet in the include search path.%sAdd directory %s to build modes?"
msgstr "Il nuovo file include non è ancora nel cammino di ricerca degli include.%sAggiungo la cartella %s al cammino di ricerca?"
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, fuzzy
#| msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgid "The new unit is not yet in the unit search path.%sAdd directory %s to build modes?"
msgstr "La nuova unit non è ancora nel cammino di ricerca delle unit.%sAggiungo la cartella %s al cammino di ricerca?"
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr ""
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\"Altri sorgenti\" contiene una cartella che è già in \"Altri file di unit\".%s%s"
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "Manca la cartella di output %s%s%s"
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "La cartella di output di %s è elencata nel cammino di ricerca degli include di %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "La cartella di output di %s è elencata nel cammino di ricerca degli include ereditato di %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "La cartella di output di %s è elencata nel cammino di ricerca delle unit ereditato di %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "La cartella di output di %s è elencata nel cammino di ricerca delle unit di %s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "La cartella di output dovrebbe essere diversa da quella dei sorgenti, e non contenere nessun sorgente."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "La classe proprietaria ha questo nome"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Il proprietario ha questo nome"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Il package aggiunge il cammino \"%s\" q quello degli include dell'IDE.%sProbabilmente il package non è ben configurato."
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Il package aggiunge il cammino \"%s\" q quello delle unit dell'IDE.%sProbabilmente il package non è ben configurato."
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Il package contiene già una unit con questo nome"
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "Il package %s è necessario all'IDE e non può essere disinstallato."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Il package \"%s\" non ha nessuna procedura \"Register\". Questo significa in genere che noncontiene nessun addon per l'IDE stessa. Installarlo nell'IDE servirà solo ad aumentarne la dimensione in RAM e forse a renderla instabile.%s%sConsiglio: se volete solo usare il package nel vostro progetto, usate il comando da menu \"Aggiungi al progetto\"."
#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr ""
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr ""
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, fuzzy
#| msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
msgstr "Il programma %smake%s non è stato trovato.%sQuesto strumento è necessario per il build di Lazarus.%s"
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Le opzioni per compilatore del progetto e le direttive nel sorgente principale sono diverse. Per le nuove unit sono usati questa stringa di opzioni e questo modo di costruzione:"
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, fuzzy
#| msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "Il progretto non usa le unit di interfaccia LCL, ma sembra averne bisogno.%sSe non usate le interfacce LCL avrete strani errori dal linker in fase di costruzione del progetto."
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Il progetto non ha un sorgente principale."
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Il file informazioni di progetto %s%s%s%sè uguale al file sorgente principale del progetto!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "Il file informazioni di progetto%s%s%s%sè stato modificato sul disco."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, fuzzy
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Il progetto deve essere salvato prima della costruzione%sSe si imposta la cartella di test nelle opzioni di ambiente,%ssi possono creare nuovi progetti e costruirli tutti insieme.%sSalvare il progetto? "
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Il progetto ha destinazioni OS=%s e CPU=%s.%sLa unit system.ppu per queste destinazioni non è stata trovata nelle cartelle binarie di FPC. %sAssicuratevi che FPC sia installato correttamente per queste destinazioni e che fpc.cfg contenga le cartelle giuste."
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "Il progetto una le nuove risorse FPC, quindi necessita di FPC 2.4 o più recente"
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Ci sono altri file con lo stesso nome nella cartella,%sche differiscono solo per le maiuscole:%s%s%sVuoi cancellarli?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "C'è un file con lo stesso nome ed estensione simile su disco%sFile: %s%sFile ambiguo: %s%s%sCancellare il file ambiguo?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "C'è già un componente con questo nome"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "C'è già una form con il nome %s%s%s"
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "C'è già una macro IDE con il nome \"%s\""
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "C'è già una unit con il nome %s%s%s. Gli identificativi Pascal devono essere unici."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "C'è già una unit con nome %s%s%s nel progetto.%sScegliere un altro nome."
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr ""
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Deve esistere almeno un modo di costruzione."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "La classe di risorse %s%s%s discende da %s%s%s. Forse è solo un errore di battitura per TForm."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "C'è stato un errore nella scrittura del componente selezionato %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "C'è stato un errore nella conversione dello stream binario del componente selezionato %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "C'è stato un errore nella copia dello stream del componente sugli appunti:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
#, fuzzy
#| msgid "The root component can not be deleted."
msgid "The root component cannot be deleted."
msgstr "Il componente radice non può essere cancellato."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr ""
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Queste impostazioni sono salvate con il progetto."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Queste unit non sono state trovate:"
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit %s%s%s already exists."
msgstr ""
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "La unit appartiene al package %s."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "La unit %s esiste due volte nel cammino delle unit di %s:"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "La unit ha questo nome"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, fuzzy
#| msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "Il nome di file della unit non è in minuscolo.%sIl compilatore Freepascal cerca solo nomi in minuscolo. Si consiglia di usare un nome in minuscolo.%sRinomino il file in minuscolo?"
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr ""
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "La unit %s è usata da altri file.%sAggiorno automaticamente i riferimenti?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "La unit stessa ha già il nome %s%s%s. Gli identificatori Pascal devono essere unici."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "Il cammino di ricerca unit di %s%s%s contiene la cartella dei sorgenti %s%s%s del package %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "La cartella di lavoro %s%s%s non esiste.%sControllate la cartella di lavoro in Menu -> Esegui -> Comandi di esecuzione."
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Per questa funzione serve un file .LFM aperto nell'editor sorgente."
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "questo messaggio di aiuto"
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, fuzzy
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Questo sembra un file pascal. %sSi raccomanda di utilizzare nomi di file in minuscolo per evitare problemi in altri filesystem e compilatori. %sRinominare in minuscolo?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Questo progetto non ha un sorgente principale."
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr ""
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Questo gruppo di opzioni per costruire Lazarus non è supportato da questa installazione.%sLa cartella %s%s%s non è scrivibile.%sVedi il sito web di Lazarus per informazioni su altri modi di installarlo."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Questo comando non può essere estratto.%sSelezionare del codice per estrarre una nuova procedura/metodo."
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr ""
#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Corrente"
#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "Funzione"
#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr ""
#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Riga"
#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr ""
#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Sorgente"
#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Stato"
#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr "Chiudi &automaticamente se riesci"
#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr "Compilazione:"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "Titolo"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Il titolo nella taskbar mostra per esempio: progetto1.lpi - Lazarus"
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Titolo (lasciare vuoto per usare il default)"
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funzione: aggiunge in fondo il delimitatore di cammino"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
#, fuzzy
#| msgid "Function: chomp path delimiter"
msgid "Function: remove trailing path delimiter"
msgstr "Funzione: elimina i delimitatori di cammino"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funzione: estrae estensione file"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funzione: estrae nome del file+estensione"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funzione: estrae solo il nome file"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funzione: estrae cammino file"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(macro sconosciuta: %s)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Cammino:"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Scambia i nomi di file mostrati con il cammino completo o relativo"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Ancoraggio superiore"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Spazio del bordo superiore. Questo valore viene aggiunto allo spazio bordo base, ed è usato per lo spazio sopra il controllo."
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Cime"
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Questo è il controllo compagno a cui il bordo superiore è ancorato. Lasciare vuoto per il controllo padre."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Spazia in cima equidistante"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "L'albero necessita di refresh"
#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr ""
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Tipi (non rimossi se non sostituibili)"
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr ""
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr ""
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr ""
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr ""
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr ""
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr ""
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr ""
#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr ""
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr ""
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr ""
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr ""
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr ""
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr ""
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr ""
#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Non mostrare più questo messaggio"
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Errore nell'espressione regolare"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Carattere senza UTF-8"
#: lazarusidestrconsts.lisuegotoline
#, fuzzy
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Vai alla riga:"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr ""
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Non trovato"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Sostituisci questa occorrenza di %s%s%s%s con %s%s%s?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "In cerca di: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "La stringa '%s' non è stata trovata!"
#: lazarusidestrconsts.lisuethecurre
#, fuzzy
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Il vostro sistema sembra usare UTF-8, ma l'attuale font dell'editor non lo supporta.%sE' possibile che i caratteri ASCII vengano visualizzati male.%sDovreste scegliere un font diverso nelle opzioni dell'editor."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Pulisci la cache degli include"
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s byte"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Incluso da:"
#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "In progetto:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Righe:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "no"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Dimensione:"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Tipo"
#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "sì"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Mostra valori CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Impossibile convertire lo stream binario in testo"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Impossibile copiare i componenti negli appunti"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Impossibile aggiungere una intestazione di commento al file risorse %s%s%s%s.%sE' probabilmente un errore di sintassi."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Impossibile aggiungere la risorsa T%s:FORMDATA al file risorse %s%s%s%s.%sE' probabilmente un errore di sintassi."
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread2
msgid "Unable to add the dependency %s, because the package %s has already a dependency to %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Impossibile aggiungere %s al progetto: contiene già una unit con lo stesso nome."
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Backup del file %s%s%s in %s%s%s impossibile!"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sImpossibile cambiare classe da %s a %s"
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Impossibile pulire la cartella di destinazione"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Impossibile pulire %s%s%s.%sControllare i permessi."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Impossibile convertire il testo del componente in formato binario:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Impossibile convertire il file %s%s%s%sErrore: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Impossibile convertire dati di form testo del file %s%s%s%s%sin formato di stream binario. (%s)"
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Impossibile copiare il file"
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Impossibile copiare il file %s%s%s%sin %s%s%s"
#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Impossibile copiare il file %s%s%s%ssu %s%s%s."
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Impossibile creare una cartella di backup %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Impossibile creare la cartella %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Impossibile creare la cartella %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Impossibile creare il file %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Impossibile creare il file %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefile4
msgid "Unable to create file %s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Impossibile creare il file %s%s%s."
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Impossibile creare link %s%s%s con destinazione %s%s%s"
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file, because there is already a directory with this name."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Impossibile creare un buffer temporaneo lfm."
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Impossibile cancellare"
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Impossibile cancellare il file ambiguo %s%s%s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Impossibile trovare una sezione ResourceString in questa o in altre unit usate."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Impossibile trovare un nome classe valido in %s%s%s"
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Impossibile trovare il file %s%s%s."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, fuzzy
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Impossibile trovare il file %s%s%s.%sSe esso appartiene al vostro progetto, controllate il cammino di ricerca in%sProgetto -> Opzioni del compilatore -> Cammini di ricerca ->Altri file unit. Se questo file appartiene a un package, controllate le opzioni del compilatore per i package. Se appartiene a Lazarus, accertatevi di compilare dopo aver pulito tutto. Se il file appartiene a FPC; controllate fpc.cfg. Se non siete sicuri, controllate Progetto -> Opzioni del compilatore ... -> Test"
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Impossibile trovare %s nello stream LFM."
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr ""
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, fuzzy
#| msgid "Unable to find Pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s%s%s%s"
msgstr "Impossibile trovare una unit pascal (.pas, .pp) per il file .lfm%s%s%s%s"
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Impossibile raccogliere i cambiamenti dell'editor."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Impossibile ottenere il sorgente per il designer."
#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr "Impossibile caricare il file:%s%s%s"
#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Impossibile caricare il pacchetto %s%s%s"
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Non posso caricare la classe componente %s%s%s, perché dipende da se stessa."
#: lazarusidestrconsts.lisunabletoopen
msgid "Unable to open \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Non posso aprire il componente antenato."
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Impossibile aprire il form designer.%sLa classe %s non discende da una classe editabile dal designer come TForm o TDataModule."
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Impossibile leggere %s"
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Impossibile leggere il file %s%s%s."
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Impossibile leggere il file %s%s%s!"
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Impossibile leggere il file %s%s%s%sErrore: %s"
#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Impossibile leggere il file %s%s%s."
#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Impossibile leggere il file di informazioni di progetto %s%s%s%s."
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Impossibile leggere il file di informazioni di progetto %s%s%s%s."
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Impossibile rimuovere il vecchio file di backup %s%s%s!"
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Impossibile rinominare il file ambiguo %s%s%s in %s%s%s"
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Impossibile rinominare il file"
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Impossibile rinominare il file %s%s%s in %s%s%s!"
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Impossibile rinominare il file %s%s%s%sin %s%s%s."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Impossibile rinominare form nel sorgente."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Impossibile rinominare il metodo. Correggere l'errore mostrato nella finestra messaggi."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Impossibile rinominare variabile nel sorgente."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Impossibile eseguire"
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Impossibile impostare il controllo AnchorSide"
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr ""
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Impossibile fare uno stream dei componenti selezionati"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Impossibile fare uno stream dei componenti selezionati."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Impossibile fare lo streaming %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Impossibile trasformare lo stream componente binario di %s:T%s in testo."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Impossibile aggiornare il comando CreateForm nel sorgente del progetto"
#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Impossibile scrivere %s%s%s%s%s."
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Impossibile scrivere %s%s%s"
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Impossibile scrivere il file"
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Impossibile scrivere il file %s%s%s%sErrore: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr "Impossibile scrivere il file di informazioni di progetto %s%s%s%s.%sErrore: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Impossibile scrivere il file di sessione di progetto%s\"%s\".%sErrore: %s"
#: lazarusidestrconsts.lisunabletowritetofile
#, fuzzy
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Impossibile scrivere sul file %s%s%s!"
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "Impossibile scrivere sul file \"%s\"."
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Impossibile scrivere uno stream xml su %s%sErrore: %s"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr ""
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Annulla"
#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "disinstallazione impossibile"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Disinstalla la selezione"
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "L'Unit %s%s%s è cambiata. Salvare?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Esiste l'identificatore della unit"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s unit %s nel package %s%s"
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Nome unit già nel progetto"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Il nome della Unit inizia con ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Il nome della Unit contiene ..."
#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Cartella risultati unit"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "cammino unit"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Path di ricerca delle Unit"
#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr ""
#: lazarusidestrconsts.lisunusedunitsof
msgid "Unused units of %s"
msgstr ""
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr ""
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Su"
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr ""
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr ""
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Aggiorno i riferimenti?"
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr ""
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "stringa maiuscola"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "Stringa in maiuscolo passata come parametro"
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Messaggio di aiuto (opzione -h)"
#: lazarusidestrconsts.lisuseandclose
msgid "Use and close"
msgstr ""
#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Usa Ansistring"
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr ""
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr ""
#: lazarusidestrconsts.lisuseexcludefilter
#, fuzzy
#| msgid "Use Exclude Filter"
msgid "Use exclude filter"
msgstr "Usa il filtro di esclusione"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Usa identificatore"
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Usa identificatore %s in %s a %s"
#: lazarusidestrconsts.lisuseincludefilter
#, fuzzy
#| msgid "Use Include Filter"
msgid "Use include filter"
msgstr "Usa il filtro di inclusione"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Sto lanciando l'applicazione"
#: lazarusidestrconsts.lisusemessagefile
msgid "Use message file:"
msgstr ""
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Usa il package %s nel package %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Usa package nel package"
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Usa il package %s nel progetto"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Usa il package nel progetto"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Cartella home dell'utente"
#: lazarusidestrconsts.lisusesub
#, fuzzy
#| msgid "Use..."
msgctxt "lazarusidestrconsts.lisusesub"
msgid "Use >>"
msgstr "Usa..."
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr ""
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Usa la unit %s nella unit %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 con BOM"
#: lazarusidestrconsts.lisvalue
#, fuzzy
#| msgid "Value:"
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Valore:"
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Valore/i"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr ""
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Valori"
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Variabile"
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Verifica chiamate a metodi"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versione"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr ""
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Verticale"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Copiare le info di versione nella clipboard"
#: lazarusidestrconsts.lisviewbreakpointproperties
#, fuzzy
#| msgid "Breakpoint Properties..."
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Vedi proprietà del breakpoint"
#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr ""
#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "Inverti vista assembler"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Mostra il sorgente (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr ""
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Attenzione: trovato file ambiguo: %s%s%s. Il file sorgente è: %s%s%s"
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sAttenzione: questa è la unit principale. La nuova unit principale sarà %s.pas"
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Osserva"
#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr ""
#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr ""
#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr ""
#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr ""
#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr ""
#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Osserva proprietà"
#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr ""
#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "Globale"
#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr ""
#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr ""
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%s%sThere is already a configuration from version %s in%s%s%s"
msgstr ""
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr ""
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
#, fuzzy
#| msgid "When a unit is renamed, update references ..."
msgid "When a unit is renamed, update references"
msgstr "Quando si rinomina una unit, aggiorna riferimenti..."
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "Quando abilitata le opzioni attuali vengono salvate nel modello, che sarà usato quando verranno creati nuovi progetti"
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Quando il cursore dell'editor sorgenti si sposta, mostra il nodo corrente nel browser del codice"
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", con include"
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr ""
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr ""
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Con i Pacchetti richiesti"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "Cance&lla Tutto"
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "D&isabilita Tutto"
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "A&bilita tutto"
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Espressione"
#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr ""
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Proprietà"
#: lazarusidestrconsts.liswlwatchlist
#, fuzzy
#| msgid "Watch list"
msgid "Watch List"
msgstr "Elenco delle viste di Watch"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Parola al cursore nell'editor corrente"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Cartella di lavoro per la costruzione"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Cartella di lavoro per l'esecuzione"
#: lazarusidestrconsts.lisworkingdirectorynotfound
msgid "Working directory %s not found"
msgstr ""
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Errore di scrittura"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Errore di scrittura: %s%sFile: %s%s%s"
#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr ""
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Errore XML"
#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "Files XML"
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Errore del parser XML nel file%s%sErrore: %s"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Può essere disabilitato per singoli form per mezzo del menu popup dell'ispettore progetti"
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
#, fuzzy
#| msgid "You can not build lazarus while debugging or compiling."
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Impossibile costruire lazarus durante un debug o una compilazione."
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor sorgente"
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr ""
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldunabletodeletefile
msgid "Unable to delete file \"%s\""
msgstr ""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr ""
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr ""
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Aggiungi unit del package alla sezione uses"
#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Binario"
#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Decimale"
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr ""
#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr ""
#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr ""
#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr ""
#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Aggiungi inverso"
#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr ""
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Autoincrementa il numero di costruzione"
#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "Scansori disponibili"
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "&Costruzione:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Set di caratteri:"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Chiudere la pagina corrente"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Define condizionali"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Crea un nuovo define"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Abilita i18n"
#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr ""
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr ""
#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Sorgente del form (*.dfm)|*.dfm"
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "Trovati, ma non elencati qui:"
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Opzioni i18n"
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
#, fuzzy
#| msgid "Include Version Info in executable"
msgid "Include version info in executable"
msgstr "Includi informazioni di versione nell'eseguibile"
#: lazarusidestrconsts.rsiwpcolumnnameshint
msgid "Column Names"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
msgid "Strategy for saving Columns"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnwidthhint
msgid "Column Width"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomgeometry
msgid "Custom geometry"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomgeometryhint
msgid "User can define window's position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
msgid "Fixed default geometry"
msgstr ""
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
msgid "Always the same fixed position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
msgid "Let windowmanager decide"
msgstr ""
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
msgid "System windowmanagers have different strategies for positioning windows"
msgstr ""
#: lazarusidestrconsts.rsiwppositionwindowlisthint
msgid "Windows that have been open. They may be closed now."
msgstr ""
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Ripristina la geometria della finestra"
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
msgid "Use previous position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplittercustomposition
msgid "Custom Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterdefault
msgid "Default Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
msgid "Restore with window"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
msgid "Restore Size"
msgstr ""
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikaans"
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabo"
#: lazarusidestrconsts.rslanguageautomatic
#, fuzzy
#| msgid "Automatic (or english)"
msgid "Automatic (or English)"
msgstr "Automatico (o inglese)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalano"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Cinese"
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Ceco"
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Olandese"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Inglese"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finnico"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Francese"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Tedesco"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Ebraico"
#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr ""
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonesiano"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italiano"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Giapponese"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Lituano"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Opzioni della lingua"
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polacco"
#: lazarusidestrconsts.rslanguageportuguese
msgctxt "lazarusidestrconsts.rslanguageportuguese"
msgid "Portuguese"
msgstr "Portoghese"
#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr ""
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Russo"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Selezione lingua:"
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Slovacco"
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Spagnolo"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Turco"
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ucraino"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "Versione &Maggiore:"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Versione mi&nore:"
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Altre info"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Cartella di output dei file PO:"
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr ""
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr ""
#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr ""
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revisione:"
#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "Scansori"
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Scegli una voce ereditata"
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Inizia una nuova ricerca"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Numerazione di versione"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Comandi per il menu aiuto"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Comandi di comandi"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Comandi dei CodeTool"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Comandi di selezione colonne di testo"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Comandi movimento cursore"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Comandi di modifica testo"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Comandi del menu file"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Comandi di collassatura testo"
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Macro"
#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Comandi della selezione del testo"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Comandi del menu dei package"
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Comandi del menu progetto"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Comandi del menu esecuzione"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Comandi di ricerca e sostituzione testo"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Comandi di selezione testo"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Comandi sorgenti appunti"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Edit sincrono"
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Edit sincrono (non in cella)"
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Edit sincrono (durante selezione)"
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Edit di modelli"
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Edit di modelli (non in cella)"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Comandi per il menu strumenti"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Comandi del menu visualizza"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Comando:"
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Conflitto"
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "annulla costruzione"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
#, fuzzy
#| msgid "Add jump point"
msgid "Add Jump Point"
msgstr "Aggiungi un punto di salto"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "aggiungi osservata"
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr ""
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Completamento modello di codice"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Copia blocco"
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Cancella blocco"
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Vai a inizio blocco"
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Vai a fine blocco"
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Nascondi blocco"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Indenta blocco"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Muovi blocco"
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Marca inizio blocco"
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Marca fine blocco"
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Mostra blocco"
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Scambia blocco"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Disindenta blocco"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "costruisci il programma/progetto"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "costruisci il file"
#: lazarusidestrconsts.srkmecbuildlazarus
#, fuzzy
#| msgid "Build lazarus"
msgid "Build Lazarus"
msgstr "Costruisci Lazarus"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Char"
#: lazarusidestrconsts.srkmeccleanupcompiled
msgid "clean up build files"
msgstr ""
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Cancella tutto il testo"
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr ""
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr ""
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Seleziona colonna in basso"
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Seleziona colonna fino alla fine"
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Seleziona colonna fino all'inizio"
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Seleziona colonna a sinistra"
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Seleziona colonna a fine riga"
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Seleziona colonna a inizio riga"
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Seleziona colonna all'inizio del testo nella riga"
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Seleziona colonna a pagina sotto"
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Seleziona colonna a pagina in fondo"
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Seleziona colonna a pagina in cima"
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Seleziona colonna a pagina su"
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Seleziona colonna a destra"
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Seleziona colonna in alto"
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Seleziona colonna parola a sinistra"
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Seleziona colonna parola a destra"
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Modalità selezione a colonne"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr ""
#: lazarusidestrconsts.srkmeccompletecode
#, fuzzy
#| msgid "Complete code"
msgctxt "lazarusidestrconsts.srkmeccompletecode"
msgid "Complete Code"
msgstr "Completa il codice"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "file di configurazione costruzione"
#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Copia la selezione negli appunti"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Copia editor in una nuova finestra"
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Copia editor nella prossima finestra libera"
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Copia editor nella precedente finestra libera"
#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Taglia la selezione negli appunti"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Cancella fino all'inizio della riga"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Cancella il carettere al cursore"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Cancella fino alla fine della riga"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Cancella l'ultimo carattere"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Cancella fino all'inizio della parola"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Cancella la riga corrente"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Cancella fino alla fine della parola"
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr ""
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diff"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr ""
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Sposta il cursore alla fine"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Sposta il cursore all'inizio"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Opzioni IDE"
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "valuta/modifica"
#: lazarusidestrconsts.srkmecextractproc
#, fuzzy
#| msgid "Extract procedure"
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Estrai procedura"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Strumento esterno %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Impostazioni degli strumenti esterni"
#: lazarusidestrconsts.srkmecfind
#, fuzzy
#| msgid "Find text"
msgid "Find Text"
msgstr "Trova testo"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Trova la fine del blocco"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Trova l'inizio del blocco"
#: lazarusidestrconsts.srkmecfinddeclaration
#, fuzzy
#| msgid "Find declaration"
msgid "Find Declaration"
msgstr "Trova dichiarazione"
#: lazarusidestrconsts.srkmecfindidentifierrefs
#, fuzzy
#| msgid "Find identifier references"
msgid "Find Identifier References"
msgstr "Trova i riferimenti dell'identificatore"
#: lazarusidestrconsts.srkmecfindinfiles
#, fuzzy
#| msgid "Find in files"
msgid "Find in Files"
msgstr "Trova nei file"
#: lazarusidestrconsts.srkmecfindnext
#, fuzzy
#| msgid "Find next"
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Trova prossima occorrenza"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
#, fuzzy
#| msgid "Find next word occurrence"
msgid "Find Next Word Occurrence"
msgstr "Trova la prossima occorrenza della parola"
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr ""
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
#, fuzzy
#| msgid "Find previous"
msgid "Find Previous"
msgstr "Trova occorrenza precedente"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
#, fuzzy
#| msgid "Find previous word occurrence"
msgid "Find Previous Word Occurrence"
msgstr "Trova la precedente occorrenza della parola"
#: lazarusidestrconsts.srkmecfindproceduredefinition
#, fuzzy
#| msgid "Find procedure definiton"
msgid "Find Procedure Definiton"
msgstr "Trova definizione di procedura"
#: lazarusidestrconsts.srkmecfindproceduremethod
#, fuzzy
#| msgid "Find procedure method"
msgid "Find Procedure Method"
msgstr "Trova metodo di procedura"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Collassa al cursore"
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Collassa al livello %d"
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Vai all'editor %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
#, fuzzy
#| msgid "Go to to include directive of current include file"
msgid "Go to include directive of current include file"
msgstr "Vai alla direttiva include del file include corrente"
#: lazarusidestrconsts.srkmecgotolinenumber
#, fuzzy
#| msgid "Go to line number"
msgid "Go to Line Number"
msgstr "Vai alla riga numero"
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Vai al marcatore %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Vai a XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced $IFDEF"
msgid "Guess Misplaced $IFDEF"
msgstr "Indovina $IFDEF malposti"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor half-word left"
msgstr ""
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor half-word right"
msgstr ""
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Str Ime"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Inserisci voce Changelog"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Inserire dalla mappa caratteri"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Inserisci autore chiave CVS"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Inserisci data chiave CVS"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Inserisci intestazione chiave CVS"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Inserisci ID chiave CVS"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Inserisci log chiave CVS"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Inserisci nome chiave CVS"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Inserisci revisione chiave CVS"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Inseriche sorgente chiave CVS"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Inserisci data e ora correnti"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr ""
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Inserisci nota GPL"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Inserisci un GUID"
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Inserisci nota LGPL"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Spezza la riga e lascia il cursore dov'è"
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Modalità inserimento"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Inserisci licenza LGPL modificata"
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Inserisci in nome corrente"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "analizza"
#: lazarusidestrconsts.srkmecinvertassignment
#, fuzzy
#| msgid "Invert assignment"
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Inverti assegnamento"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr ""
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Spezza la riga e sposta il cursore"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Sposta il cursore fino alla fine della riga"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Modalità selezione a righe"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Sposta il cursore alla linea di partenza"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Muovi il cursore all'inizio del testo nella riga"
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Blocca l'editor"
#: lazarusidestrconsts.srkmecmakeresourcestring
#, fuzzy
#| msgid "Make resource string"
msgid "Make Resource String"
msgstr "Risorsa stringa di make"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Vai alla parentesi corrispondente"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Sposta l'editor a sinistra"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Sposta l'editor tutto a sinistra"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Muovi editor in una nuova finestra"
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Muovi editor nella prossima finestra libera"
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Muovi editor nella precedente finestra libera"
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Sposta l'editor a destra"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Sposta l'editor tutto a destra"
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Segnalibro successivo"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Vai all'editor successivo"
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Vai al successivo editor con lo stesso sorgente"
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Vai alla prossima finestra"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Modalità di selezione normale"
#: lazarusidestrconsts.srkmecopenfileatcursor
#, fuzzy
#| msgid "Open file at cursor"
msgid "Open File at Cursor"
msgstr "Apri il file al cursore"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Modalità sovrascrittura"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Sposta il cursore alla fine della pagina"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Sposta il cursore in basso di una pagina"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Sposta il cursore a sinistra di una pagina"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Sposta il cursore a destra di una pagina"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Sposta il cursore in cima alla pagina"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Sposta il cursore in alto di una pagina"
#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Incolla la selezione nella posizione corrente"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "poni in pausa il programma"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Segnalibri precedente"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Vai all'editor precedente"
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Vai all'editor precedente con lo stesso sorgente"
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Vai alla finestra precedente"
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "compilazione veloce, senza linking"
#: lazarusidestrconsts.srkmecremovebreakpoint
#, fuzzy
#| msgid "remove break point"
msgid "remove breakpoint"
msgstr "elimina break point"
#: lazarusidestrconsts.srkmecremoveemptymethods
#, fuzzy
#| msgid "Remove empty methods"
msgid "Remove Empty Methods"
msgstr "Elimina metodi vuoti"
#: lazarusidestrconsts.srkmecremoveunusedunits
#, fuzzy
#| msgid "Remove unused units"
msgid "Remove Unused Units"
msgstr "Rimuovi le unit inutilizzate"
#: lazarusidestrconsts.srkmecrenameidentifier
#, fuzzy
#| msgid "Rename identifier"
msgid "Rename Identifier"
msgstr "Rinomina identificatore"
#: lazarusidestrconsts.srkmecreplace
#, fuzzy
#| msgid "Replace text"
msgid "Replace Text"
msgstr "Rinpiazza con testo"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Segnala un bug"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "reimposta debugger"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr ""
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "Esegui programma"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "esegui file"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "parametri di esecuzione"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Scorri in basso di una riga"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Scorri a sinistra di un carattere"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Scorri a sinistra di un carattere"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Scorri in alto di una riga"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Seleziona in basso"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Seleziona tutto"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Converte i tab in spazi nella selezione"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Seleziona fino alla fine"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Seleziona fino all'inizio"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Seleziona fino a XY"
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select half-word left"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select half-word right"
msgstr ""
#: lazarusidestrconsts.srkmecselleft
#, fuzzy
#| msgid "SelLeft"
msgid "Select Left"
msgstr "Seleziona a sinistra"
#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Seleziona fino alla fine della riga"
#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Selezione fino all'inizio riga"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Seleziona all'inizio del testo nella riga"
#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Seleziona fino alla fine della pagina"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Seleziona la pagina in giè¹"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Seleziona la pagina a sinistra"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Seleziona la pagina a destra"
#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Seleziona fino alla cima della pagina"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Seleziona la pagina in su"
#: lazarusidestrconsts.srkmecselright
#, fuzzy
#| msgid "SelRight"
msgid "Select Right"
msgstr "Seleziona a destra"
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Seleziona in alto"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Seleziona la parola a sinistra"
#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Seleziona la parola a destra"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Imposta un segnalibro libero"
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Imposta il marcatore %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Maiusc Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
#, fuzzy
#| msgid "Show abstract methods"
msgid "Show Abstract Methods"
msgstr "Mostra metodi astratti"
#: lazarusidestrconsts.srkmecshowcodecontext
#, fuzzy
#| msgid "Show code context"
msgid "Show Code Context"
msgstr "Mostra il contesto del codice"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "Mostra punto di esecuzione"
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "ferma il programma"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Vai all'ultima posizione nella cella"
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Vai alla prima posizione nella cella"
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Seleziona cella"
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Prossima cella"
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Prossima cella (tutte selezionate)"
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Cella precedente"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Cella precedente (tutte selezionate)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Inizia edit sincrono"
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Vai all'ultima pos nella cella"
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Vai alla prima pos nella cella"
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Seleziona cella"
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Fine"
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Prossima cella"
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Prossima cella (rotazione)"
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Prossima cella (tutte selezionate)"
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Prossima cella (rotazione/tutte selezionate)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Cella precedente"
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Cella precedente (tutte selezionate)"
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsyntaxcheck
#, fuzzy
#| msgid "Syntax check"
msgid "Syntax Check"
msgstr "Controllo sintassi"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Vedi assembler"
#: lazarusidestrconsts.srkmectogglebreakpoint
#, fuzzy
#| msgid "toggle break point"
msgid "toggle breakpoint"
msgstr "Inverti breakpoint"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Mostra i breakpoint"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Mostra lo stack chiamate"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Visualizza il code browser"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Mostra l'esplorer del codice"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Visualizza la palette dei componenti"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Mostra il risultato del debugger"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Passa dalla form alla unit"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Visualizza l'editor della Documentazione"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Visualizza gli speed buttons dell'IDE"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Mostra le variabili locali"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "Inverti marker %d"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Inverti evidenziazione della parola corrente"
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Mostra messaggi"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Cambia modalità"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Mostra l'analizzatore oggetti"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Vedi registri"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Vedi registro delle restrizioni"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Mostra risultati della ricerca"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Mostra l'editor dei sorgenti"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Mostra i watch"
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Espandi tutto"
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Espandi al cursore"
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "comando editor sconosciuto"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr ""
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr ""
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Mostra editor delle àncore"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Mostrare i componenti"
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr ""
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Mostra le form"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr ""
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Mostra le dipendenze delle unit"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Mostra le informazioni sulle unit"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Mostra le unit"
#: lazarusidestrconsts.srkmecwordcompletion
#, fuzzy
#| msgid "Word completion"
msgid "Word Completion"
msgstr "Completamento parole"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Sposta il cursore di una parola a sinistra"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Sposta il cursore di una parola a destra"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Edita i tasti dei comandi"
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr ""
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Collassa i commenti nella selezione"
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr ""
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Nascondi i commenti nella selezione"
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Espandi tutto"
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldallinselection
#, fuzzy
#| msgid "Unfold all in Selection"
msgid "Unfold all in selection"
msgstr "Espandi tutto nella selezione"
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr ""
#: lazarusidestrconsts.synfunfoldcommentsinselection
#, fuzzy
#| msgid "Unfold comments in Selection"
msgid "Unfold comments in selection"
msgstr "Espandi i commenti nella selezione"
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Il file è a sola lettura"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Il file \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" non è scrivibile."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Bloccato"
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr ""
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr ""
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Aggiungi &watch al cursore"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr ""
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Segnalibro"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Chiudi le &altre pagine"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Chiudi pagina"
#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Copia nome del file"
#: lazarusidestrconsts.uemcopytonewwindow
#, fuzzy
#| msgid "Clone to new Window"
msgid "Clone to New Window"
msgstr "Clona su nuova finestra"
#: lazarusidestrconsts.uemcopytootherwindow
#, fuzzy
#| msgid "Clone to other Window"
msgid "Clone to Other Window"
msgstr "Clona su altra finestra"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nuova finestra"
#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Codifica"
#: lazarusidestrconsts.uemevaluatemodify
#, fuzzy
#| msgid "&Evaluate/Modify..."
msgid "&Evaluate/Modify ..."
msgstr "&Valuta/modifica..."
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "Trova dichiarazione"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr ""
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "Vai al segnalibro"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Evidenziatore"
#: lazarusidestrconsts.ueminspect
#, fuzzy
#| msgid "&Inspect..."
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "&Ispeziona..."
#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Inverti assegnamento"
#: lazarusidestrconsts.uemlineending
#, fuzzy
#| msgid "Line ending"
msgid "Line Ending"
msgstr "Fine riga"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "B&locca pagina"
#: lazarusidestrconsts.uemmovepageleft
#, fuzzy
#| msgid "Move page left"
msgid "Move Page Left"
msgstr "Muovi pagina a sinistra"
#: lazarusidestrconsts.uemmovepageleftmost
#, fuzzy
#| msgid "Move page leftmost"
msgid "Move Page Leftmost"
msgstr "Muovi pagina tutta a sinistra"
#: lazarusidestrconsts.uemmovepageright
#, fuzzy
#| msgid "Move page right"
msgid "Move Page Right"
msgstr "Muovi pagina a destra"
#: lazarusidestrconsts.uemmovepagerightmost
#, fuzzy
#| msgid "Move page rightmost"
msgid "Move Page Rightmost"
msgstr "Muovi pagina tutto a destra"
#: lazarusidestrconsts.uemmovetonewwindow
#, fuzzy
#| msgid "Move to new Window"
msgid "Move to New Window"
msgstr "Muovi a nuova finestra"
#: lazarusidestrconsts.uemmovetootherwindow
#, fuzzy
#| msgid "Move to other Window"
msgid "Move to Other Window"
msgstr "Muovi ad altra finestra"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nuova finestra"
#: lazarusidestrconsts.uemnextbookmark
#, fuzzy
#| msgid "Goto next Bookmark"
msgid "Goto Next Bookmark"
msgstr "Vai al prossimo segnalibro"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Modificato"
#: lazarusidestrconsts.uemopenfileatcursor
#, fuzzy
#| msgid "&Open file at cursor"
msgid "&Open File at Cursor"
msgstr "&Apri file al cursore"
#: lazarusidestrconsts.uemprevbookmark
#, fuzzy
#| msgid "Goto previous Bookmark"
msgid "Goto Previous Bookmark"
msgstr "Vai al segnalibro precedente"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Salta alla procedura"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Sola lettura"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "Esegui fino al cu&rsore"
#: lazarusidestrconsts.uemsetfreebookmark
#, fuzzy
#| msgid "Set a free Bookmark"
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Imposta un segnalibro libero"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Mostra i numeri di riga"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Sorgente"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Inverti segnalibro"
#: lazarusidestrconsts.uemtogglebreakpoint
#, fuzzy
#| msgid "&Toggle Breakpoint"
msgid "Toggle &Breakpoint"
msgstr "&Inverti breakpoint"
#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Mostra lo stack delle chiamate"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Non ancora implementato"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "Ins"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "Sov"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Sola lettura"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informazioni di versione"