lazarus/languages/lazaruside.uk.po

msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2012-04-26 19:31+0200\n"
"Last-Translator: Igor Paliychuk <mansonigor@gmail.com>\n"
"Language-Team: \n"
"Language: uk\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"

#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr "Виберіть групи"

#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr "Виберіть групи для вимкнення при задіянні точки зупинки"

#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr "Виберіть групи для ввімкнення при задіянні точки зупинки"

#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr "Деякі групи в списку ввімкнення/вимкнення не існують.%0:sСтворити їх?%0:s%0:s%1:s"

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Попередньо визначена користувачем схема"

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Скинути всі налашування"

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Скинути всі налаштування канавок"

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Скинути всі текстові налашування"

#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Додати точку історії"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Контекстне меню"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Контекстне меню (дебаг)"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Контекстне меню (вкладка)"

#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Стрибає до реалізації"

#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Стрибає до кінця блоку реалізації/іншого"

#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Назад  по історії"

#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Преред по історії"

#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Нічого/Типово"

#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Вставити"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Продовжити %0:s (Пов'язано з: %1:s)"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr "Продовжити %0:s"

#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Вибрати текст"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
#, fuzzy
#| msgid "Select text (Columns)"
msgid "Select text (Column mode)"
msgstr "Вибрати текст (Графи)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectline
#, fuzzy
#| msgid "Select text (Lines)"
msgid "Select text (Line mode)"
msgstr "Вибрати текст (Рядки)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Встановити вільну закладку"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Вибрати поточний Рядок (Увесь)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Вибрати поточний Рядок (Текст)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Вибрати поточний Абзац"

#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Вибрати поточне Слово"

#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Скинути масштаб"

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Ця сторінка не відображає ваші поточні налаштування. Див. сторінку з додатковими параметрами. Використовуйте цю сторінку для скидання будь-яких їх змін"

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Загальне"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
#| msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Стандартне, Всі дії (точка зупинки, згортання) при натисканні кнопки Миші"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
#| msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Розширене, Дії - при відпуск. кнопки Миші. Виділення - при натиск. і переміщ."

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Канавка"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "Переміщувати курсор за правою кнопкою миші"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl Колесо"

#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt Колесо"

#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Ctrl Колесо"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
#| msgid "Drag Selection (copy/paste)"
msgid "Drag selection (copy/paste)"
msgstr "Копіювати/Вставляти перетягуванням"

#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Extra-1 Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Extra-2 Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt Подвійне"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl Подвійне"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Подвійний"

#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Shift Подвійне"

#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Почетвірний"

#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Потрійний"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Середня Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Середня"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Екстра 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Екстра 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Ліва 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Ліва 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Справа"

#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Колесо"

#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Права Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Shift-Alt-Ctrl Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Shift-Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Shift-Alt Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Shift-Alt Колесо"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Shift-Ctrl Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Shift-Ctrl Колесо"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Shift Кнопка"

#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Колесо"

#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Shift Колесо"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Ви маєте незбережені зміни. Використання цієї сторінки скине зміни на сторінці розширених параметрів"

#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Прокрутка горизонтально (Системна швидкість)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Прокрутка горизонтально (Один рядок)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Прокрутка горизонтально (Сторінка)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Прокрутка горизонтально (Півсторінки)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Прокрутка горизонтально (Сторінка, менше рядка)"

#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Нічого/Типово"

#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Прокрутка (Системна швидкість)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Прокрутка (Один рядок)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Прокрутка (Сторінка)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Прокрутка (Півсторінки)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Прокрутка (Сторінка, менше рядка)"

#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Масштаб"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Немає >"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Лише для читання"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Нижній регістр, з великої букви"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Додавати оператор присвоєння :="

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Підсвічування дужок"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Дерево згортань коду"

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Текст за замовчуванням"

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Вимкнена точка зупинки"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Ввімкнена точка зупинки"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Рядок з помилкою"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Точка виконання"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Маркер згорнутого коду"

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Глобально"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Канавка"

#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Рядок"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Синхронне Редагування"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Редагування Шаблону"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Канавковий Розділювач"

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Інкрементальні інші"

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Підсвічувати поточне слово"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Інкрементальний пошук"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Невірна точка зупинки"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Підсвітка поточного рядка"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Номер рядка"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Змінений рядок"

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Посилання при наведенні мишки"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Виділена Область"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Активна Клітинка"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Інші Клітинки"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Синхронізовані Клітинки"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Активна Клітинка"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Інші Клітинки"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Синхронізовані Клітинки"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Текстовий блок"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Невідома точка зупинки"

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Квадратні дужки"

#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Візуалізація Спеціальних Символів"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Додавати символ 'крапка з комою'"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Вирівняти верхній рядок за рахунок коментаря попереду"

#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Всі файли"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "За алфавітом"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Завжди видимий курсор"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Двозначна дія з файлом:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Попередж. при компіляції"

#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr ""

#: lazarusidestrconsts.dlgapplicationsettings
#| msgid "Application Settings"
msgid "Application settings"
msgstr "Параметри додатку"

#: lazarusidestrconsts.dlgassertcode
#| msgid "Include Assertion Code"
msgid "Include assertion code"
msgstr "Включити assert-код"

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Автостворювані форми:"

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "При створенні нових форм додати їх до автостворюваних"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Автом. видалити файл"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "Сховати мишку при наборі тексту"

#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Автоматичний відступ"

#: lazarusidestrconsts.dlgautoindentlink
#, fuzzy
#| msgid "(Setup smart indent)"
msgid "(Set up smart indent)"
msgstr "(Налаштувати розумні відступи)"

#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Автоматичний відступ"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Автом. видаляти порожні методи"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Автоперейменування в нижній регістр"

#: lazarusidestrconsts.dlgautosave
#| msgid "Auto save"
msgid "Auto Save"
msgstr "Автозбереження"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Доступні форми:"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Тло"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(немає підтеки)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Та ж сама назва (в підтеці)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Після методів"

#: lazarusidestrconsts.dlgblockgroupoptions
#| msgid "Selection:"
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Виділення"

#: lazarusidestrconsts.dlgblockindent
#| msgid "Block indent"
msgid "Block indent (spaces)"
msgstr "Відступ блоку (пробіли)"

#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr ""

#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Пробіл/Таб як в попередньому рядку"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Лише позиція"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Пробіли"

#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr ""

#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Відступ блоку (таби)"

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Підсвічування дужок"

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr "Підбір пар дужок"

#: lazarusidestrconsts.dlgcasesensitive
#| msgid "&Case Sensitive"
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Чутливий до регістру"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Перевіряю параметри компілятора"

#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr "втрачений файл знайдений: %s"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Результати"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Тест"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Тест: Перевіряю компілятор ..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Тест: Перевіряю конфігурацію компілятора ..."

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Тест: Перевіряю дату компілятора ..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Тест: Компілюю порожній файл ..."

#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Тест: Перевіряю відсутній fpc ppu ..."

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Тест: Перевіряю поч. код за шляхами пошуку fpc ppu ..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Тест: Компілюю порожній файл"

#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr "використовую файл конфігурації %s"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Порядок класів"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Остання"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "нижній регістр"

#: lazarusidestrconsts.dlgcdtpreview
#| msgid "Preview (Max line length = 1)"
msgid "Preview (max line length = 1)"
msgstr "Попередній перегляд (max довжина=1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Префікс READ"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Префікс STORED"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "ВЕРХНІЙ РЕГІСТР"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Префікс змінної"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Префікс WRITE"

#: lazarusidestrconsts.dlgcentercursorline
#| msgid "Center Cursor Line"
msgid "Center cursor line"
msgstr "Рядок з курсором в центрі"

#: lazarusidestrconsts.dlgcharcasefileact
#, fuzzy
#| msgid "Save As - auto rename pascal files lower case"
msgid "Save As - auto rename Pascal files lower case"
msgstr "Зберегти як - автоперейменування в нижній регістр"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Перевірити пакунки при створенні форми"

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Виберіть файл шаблонів коду (*.dci)"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Кнопки закриття в записнику"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Кольорова схема"

#: lazarusidestrconsts.dlgcmacro
#| msgid "C Style Macros (global)"
msgid "C style macros (global)"
msgstr "Макроси стилю C (глобально)"

#: lazarusidestrconsts.dlgcoansistr
#, fuzzy
#| msgid "Use ansi strings"
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Використовувати рядки ansi"

#: lazarusidestrconsts.dlgcoasmstyle
#, fuzzy
#| msgid "Assembler style:"
msgid "Assembler style"
msgstr "Стиль Асемблера:"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Повідомлення"

#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr ""

#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr ""

#: lazarusidestrconsts.dlgcocops
#| msgid "C Style Operators (*=, +=, /= and -=)"
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Оператори стилю C (*=, +=, /= and -=)"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Створити Makefile"

#: lazarusidestrconsts.dlgcodebugging
#, fuzzy
#| msgid "Debugging info"
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Налагоджувальні дані"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Додавання до шляхів налагоджувача (порожньо):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Створення коду"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Обидва"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Згорнути"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Сховати"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Зворотній порядок згортання в спливаючому меню"

#: lazarusidestrconsts.dlgcogdb
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "Створити інформацію для GDB (повільніше / зібільшує розмір exe)"

#: lazarusidestrconsts.dlgcoheaptrc
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Викор-ти модуль Heaprc (перевіряє витоки пам'яті)"

#: lazarusidestrconsts.dlgcoincfiles
#| msgid "Include Files (-Fi):"
msgid "Include files (-Fi):"
msgstr "Включені файли (-Fi):"

#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr ""

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Бібліотеки (-F1)"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Компонування"

#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Завант./Зберегти"

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Колір"

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Змінити Колір)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Не змінено"

#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Кольори"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Параметри командного рядка (без назви програми)"

#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Make default indent for new line if comment opens at column:"
msgstr ""

#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr ""

#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr ""

#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments"
msgstr ""

#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend, if matched or not matched"
msgstr ""

#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend, if matched or not matched (not at EOL)"
msgstr ""

#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend, if matched"
msgstr ""

#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgstr ""

#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr ""

#: lazarusidestrconsts.dlgcompilermessage
#| msgid "Compiler Messages"
msgid "Compiler messages"
msgstr "Повідомлення компілятора"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr "Мовний файл повідомлень компілятора"

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Параметри компілятора"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Завершити властивості"

#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr ""

#: lazarusidestrconsts.dlgconfigfiles
#| msgid "Config Files:"
msgid "Config files"
msgstr "Файли налаштувань"

#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Інше"

#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr ""

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Переповн."

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Обробка"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Копіювати/Вставляти зі звернутістю"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Копіювати слово при порожньому копіюванні"

#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Діапазон"

#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Переміщуваний"

#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr ""

#: lazarusidestrconsts.dlgcoshowerr
#| msgid "Show Errors"
msgid "Show errors"
msgstr "Показувати помилки"

#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "По&казувати Параметри"

#: lazarusidestrconsts.dlgcosmartlinkable
#| msgid "Smart Linkable"
msgid "Smart linkable"
msgstr "Розумна компіл."

#: lazarusidestrconsts.dlgcosources
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Інші коди (.pp/.pas-файли, що використовуються IDE, але не компілятором)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Стек"

#: lazarusidestrconsts.dlgcostrip
#| msgid "Strip Symbols From Executable"
msgid "Strip symbols from executable"
msgstr "Вирізати символи з виконуваного файлу"

#: lazarusidestrconsts.dlgcosymboltype
#, fuzzy
#| msgid "Choose type of debug info"
msgid "Type of debug info"
msgstr "Вибрати тип налаг. даних"

#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Автоматично"

#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr "Dwarf2"

#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr "Dwarf з наборами"

#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr "Dwarf3 (бета)"

#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Удари"

#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr ""

#: lazarusidestrconsts.dlgcounitstyle
#| msgid "Unit Style"
msgid "Unit style"
msgstr "Стиль модуля"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Створити код для valgrind"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Подробиці виводу"

#: lazarusidestrconsts.dlgcppinline
#| msgid "C++ Styled INLINE"
msgid "C++ styled INLINE"
msgstr "INLINE стилю C++"

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "Натискання Ctrl-Середня Кнопка Миші на вкладці закриває інші"

#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr ""

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Курсор за межею рядка"

#: lazarusidestrconsts.dlgcursorgroupoptions
#| msgid "Cursor:"
msgid "Cursor"
msgstr "Курсор"

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Курсор пропускає виділення"

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "Курсор пропускає Таби"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Розширення користувача (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Редактор Шляху"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Тип налагоджувача і шлях"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Типовий шрифт редактора"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Типове значення"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Видалити шаблон "

#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Робочий Стіл"

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Кнопки - "

#: lazarusidestrconsts.dlgdesktopfiles
#| msgid "Desktop files"
msgid "Desktop Files"
msgstr "Файли робочого столу"

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Підказки"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Меню - "

#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr "Інші Параметри"

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Напрямок"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Вимкнути згладжування"

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Використовувати колір правої межі"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Малювати рівень роздільника"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Колір вкладеного рядка"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Колір лінії"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Початок/Кінець"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Процедура/Функція"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (локальні)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Секції модуля"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Вираз Uses"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (локальні)"

#: lazarusidestrconsts.dlgedadd
msgid "Add ..."
msgstr "Додати..."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Назад"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Жирний"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Підтека"

#: lazarusidestrconsts.dlgedcodetempl
#| msgid "Code templates"
msgid "Code Templates"
msgstr "Кодові Шаблони"

#: lazarusidestrconsts.dlgedcompleteblocks
#, fuzzy
#| msgid "Add close statement for pascal blocks"
msgid "Add close statement for Pascal blocks"
msgstr "Додавати до блоків Паскаля завершальний оператор"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Розшир. користувача"

#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(%s сек затримка)"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Відображення"

#: lazarusidestrconsts.dlgededit
msgid "Edit ..."
msgstr "Редагувати ..."

#: lazarusidestrconsts.dlgedfiles
#| msgid "Editor files"
msgid "Editor Files"
msgstr "Файли Редактора"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Завершення ідентифікаторів"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Інвертувати"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ігнорувати Фіксування, використати найдовше невикористовуаний редактор"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ігнорувати Фіксування якщо редактор є поточним"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ігнорувати Фіксування якщо редактор в поточниму вікні"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Фіксовано якщо тест в області перегляду"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Розблоковано"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Незафіксований якщо текст в центрі області перегляду"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Нова вкладка, існуюче або нове вікно"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Нова вкладка в новому вікні"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Нова вкладка в існуючому вікні"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Опція вибирає найдовше не використовуваний редактор для файлу, навіть якщо він зафіксований і/або потребує прокрутки. При цьому не враховується порядок переведення фокусу у вікна, навіть якщо вибраний параметр \"той самий порядок критеріїв\". Ця опція завжди працює, наступні за нею не аналізуються."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Опція перевіряє чи поточний активний редактор має цільовий файл. Якщо так то він використає поточний редактор, навіть якщо той зафіксований і/або потребує прокрутки."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Опція перевіряє чи існує редактор для цльового файлу в поточному вікні. Якщо так то він використає цей редактор, навіть якщо той зафіксований і/або потребує прокрутки."

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Опція вибирає зафіксований (і лише зафіксований) Редактор, який не потребує прокрутки для відображння цільової точки переходу (вона вже знаходиться в видимій області)."

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Опція вибирає будь-який не зафіксований Редактор."

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Опція вибирає незафіксований редактор, якому не потрібна прокрутка для відображення цільової точки переходу (вона вже знаходиться в центрі області перегляду, виключаючи 2-5 рядків зверху і знизу)."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Опція відкриває нову Вкладку в існуючому або новому Вікні, якщо не знайдено незафіксованої вкладки. Опція завжди спрацює, наступні за нею не перевіряються."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Якщо не знайдено незафіксованої вкладки, використання цієї опції призводить до відкриття нової Вкладки в новому Вікні (навіть якщо для цього можуть бути використані існуючі вікна).  Опція завжди спрацює, наступні за нею не перевіряються."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "Якщо не знайдено незафіксованої вкладки, використання цієї опції призводить до відкриття нової Вкладки в існуючому (і лише в існуючому) Вікні. Вкладка відкривається лише при наявності вікна, що не має редактора для цільового файлу."

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Курсив"

#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Розмір шрифта редактора"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Налаштування редактора"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Глобальні параметри схеми"

#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "Різне"

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Викл"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Вкл"

#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr ""

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Підкреслений"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Атрибути Елементу"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "End переводить до найближчого кінця"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Запитати"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "ЗАУВАЖЕННЯ: Файлами проектів вважаються всі файли в теці проектів"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Резервування"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Файли"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Сітка"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Мова"

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Лінійки допомоги"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Різне"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Відсутнє"

#: lazarusidestrconsts.dlgenvotherfiles
#| msgid "Other files"
msgid "Other Files"
msgstr "Інші Файли"

#: lazarusidestrconsts.dlgenvproject
#| msgid "Project"
msgid "Tabs for project"
msgstr "Вкладки для проекту"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Тип"

#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Сфокусуватись на повідомленнях після компілювання"

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Додат. міжсимвольний інтервал"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Міжрядковий інтервал"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Використовувати зовнішній файл налагоджувальних символів gdb"

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Файлові розширення"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Знайти текст над курсором"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Шматок"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Вибір шматка"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Коментар"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Вузол"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Елемент"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Список <>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Об'єкт (успадкований, вбудований)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (локальні)"

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Коментар (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (вкладені)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Коментар { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"

#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Вкладений Коментар"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (процедура)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Процедура"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Програма"

#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"

#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Коментар //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Модуль"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Секції модуля"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (глобальні)"

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Коментар"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Вузол"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Інструкція Обробки"

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Колір переднього плану"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Політика вставки процедур"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Залишати порядок процедур"

#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Шлях до компілятора (%s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Тека кодів FPC"

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Відмітка"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Редактор форм"

#: lazarusidestrconsts.dlgfrombeginning
#| msgid "From B&eginning"
msgid "From b&eginning"
msgstr "З по&чатку"

#: lazarusidestrconsts.dlgfromcursor
#| msgid "&From Cursor"
msgid "&From cursor"
msgstr "&Від курсора"

#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Параметри"

#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Задіяти позицію"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Глобально"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Створити код для gprof"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Колір виділення"

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Колір сітки"

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Розмір X сітки"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Крок сітки по горизонталі"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Розмір Y сітки"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Вертикальний крок сітки"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Провідник Коду"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Налагоджувач"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Редактор"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Середовище"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Ґруповий відкат"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Показувати лінійки"

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Канавка"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Згорнуто"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Колір поля "

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Колір краю Канавки"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Показник канавкового роздільника"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Прокрутка на півсторінки"

#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Розміри купи і стеку"

#: lazarusidestrconsts.dlgheapsize
#| msgid "Heap Size"
msgid "Heap size"
msgstr "Розмір купи"

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Висота:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Приховати вікна IDE при пуску"

#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr "Приховувати Значки Повідомлень"

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Ховати заголовок одиничної вкладки"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Підсвічувати Колір"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Підсвічувати Колір Шрифту"

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "Зліва від курсора"

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "Справа від курсора"

#: lazarusidestrconsts.dlghintsparametersendernotused
#| msgid "Show Hints for parameter \"Sender\" not used"
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Показ порад до параметру \"Відправник\" не використаний"

#: lazarusidestrconsts.dlghintsunused
#| msgid "Show Hints for unused units in main source"
msgid "Show hints for unused units in main"
msgstr "Довідки для непотрібних модулів в головному коді"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home переводить до найближчого старту"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Основна програма"

#: lazarusidestrconsts.dlgidentifiercompletion
#| msgid "Identifier completion"
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Завершення ідентифікаторів"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Політика ідентифікаторів"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Параметри IDE"

#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr ""

#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr ""

#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr ""

#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr ""

#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr ""

#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr ""

#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ігнорувати"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Включити системні змінні"

#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr ""

#: lazarusidestrconsts.dlgindentstabsgroupoptions
#, fuzzy
#| msgid "Indent and Tabs"
msgid "Tabs"
msgstr "Відступи і Табуляція"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Перед методами"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Конструктор має бути 'init' (деструктор має бути 'done')"

#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Вставити частини класу"

#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Реалізація"

#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Інтерфейс"

#: lazarusidestrconsts.dlginsertmethods
msgid "Insert methods"
msgstr "Вставляти методи"

#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Вставити в секцію Uses в"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Вставляти пробіл після"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Вставляти пробіл перед"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Інтервал в сек"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Перехід (напр. Метод Переходу)"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Зберігати позицію курсору по осі X"

#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr ""

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Клавіші"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Помилки комбінацій клавіш"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Політика ключових слів"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Дозволити LABEL і GOTO"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Мова"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Останній (напр. в кінці коду)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Тека Lazarus (за замовчуванням для всіх проектів)"

#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Зліва:"

#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "Guid lines Left,Top"
msgid "Guide lines Left,Top"
msgstr "Орієнтирні лінії Ліва,Верхня"

#: lazarusidestrconsts.dlglevel1opt
#, fuzzy
#| msgid "Level 1 (quick and debugger friendly)"
msgid "1 (quick, debugger friendly)"
msgstr "Рівень 1 (швидко та дружньо до налагоджувача)"

#: lazarusidestrconsts.dlglevel2opt
#, fuzzy
#| msgid "Level 2 (Level 1 + quick optimizations)"
msgid "2 (quick optimizations)"
msgstr "Рівень 2 (Рівень 1 + швидкі оптимізації)"

#: lazarusidestrconsts.dlglevel3opt
#, fuzzy
#| msgid "Level 3 (Level 2 + slow optimizations)"
msgid "3 (slow optimizations)"
msgstr "Рівень 3 (Рівень 2 + повільні оптимізації)"

#: lazarusidestrconsts.dlglevelnoneopt
#, fuzzy
#| msgid "Level 0 (no extra optimizations)"
msgid "0 (no optimization)"
msgstr "Рівень 0 (без екстра-оптимізації)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Розчіплювання рядка"

#: lazarusidestrconsts.dlglinksmart
#| msgid "Link Smart"
msgid "Link smart"
msgstr "Розумне компонування"

#: lazarusidestrconsts.dlglnumsbct
#| msgid "Display Line Numbers in Run-time Error Backtraces"
msgid "Display line numbers in run-time error backtraces"
msgstr "Вивести номери рядків в помилках часу виконання"

#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Завант. налашт. роб. столу з файлу"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Головне меню"

#: lazarusidestrconsts.dlgmainviewforms
#| msgid "View project forms"
msgid "View Project Forms"
msgstr "Показувати Форми Проекту"

#: lazarusidestrconsts.dlgmainviewframes
#| msgid "View project frames"
msgid "View Project Frames"
msgstr "Переглянути Каркаси Проекту"

#: lazarusidestrconsts.dlgmainviewunits
#| msgid "View project units"
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Показувати Модулі Проекту"

#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Шлях до Make"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Додатковий відступ зліва на сторінці для палітурки"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Колір Maker"

#: lazarusidestrconsts.dlgmarkupgroup
#| msgid "Word under Caret Highlight"
msgid "Highlight of Word under Caret"
msgstr "Підсвітка Слова під Курсором"

#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Вилучити"

#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Назва"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr "Шукати межі для слів не довше:"

#: lazarusidestrconsts.dlgmarkupwordnokeyword
#| msgid "Ignore Keywords"
msgid "Ignore keywords"
msgstr "Ігнорувати ключові слова"

#: lazarusidestrconsts.dlgmarkupwordnotimer
#| msgid "Disable Timer for Markup Current Word"
msgid "Disable timer for markup current word"
msgstr "Вимкнути таймер для підсвітки поточного слова"

#: lazarusidestrconsts.dlgmarkupwordtrim
#| msgid "Trim Spaces (when highlighting current selection)"
msgid "Trim spaces (when highlighting current selection)"
msgstr "Обрізати пробіли (при підсвічуванні поточного виділення)"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Максимум лічильника"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Максимальна довжина рядка"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Максимум останніх файлів"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Максимум останніх файлів проектів"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Змішування методів і властивостей"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr "Одинарний"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Подвійний"

#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Потрійний"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Почетвірний"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Будь-який"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Екстра 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Екстра 2"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Ліворуч"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Середина"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Зробити Відкат"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Справа"

#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Колесо вниз"

#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Колесо вверх"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Захоплення"

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Перемістити курсор (додатково)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "При відпусканні кнопки"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Дія"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Клацання"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Параметри Мишки"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Дублювати Запис"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Цей елемент суперечить вже існуючому"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Кнопка"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "Каретка"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Контекст"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Клацання"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Дія"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Вверх/Вниз"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Параметр"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Порядок"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Пріоритет"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Мишка"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Розширені"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Команда IDE"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"

#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Всі"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Канавка"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Згорнути Дерево"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Згорнуто [+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Розгорнуто [-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Номери Рядів"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Виділення"

#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Опц"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Інші дії з використанням тієї ж кнопки"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Вони можуть бути виконані в залежності від натискання клавіш-модифікаторів, параметрів провалювання, Один/Два натискання, Вверх/Вниз ..."

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Фільтрувати Кнопки-модифікатори"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Пріоритет"

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Повідомлення"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Множинний Вибір"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
#| msgid "Find editor for jump targets"
msgid "Find Editor for Jump Targets"
msgstr "Знайти Редактор для Цілей Переходу"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Порядок використання редакторів, що відповідають однаковим критеріям"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Останній вибраний редактор для даного файлу"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Редактор (для файлу) в останньому вибраному вікні"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Список критеріїв вибору редактора за пріоритетом:"

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Сторінки та Вікна"

#: lazarusidestrconsts.dlgmultiwintabgroup
#| msgid "Notebook Tabs:"
msgid "Notebook Tabs"
msgstr "Вкладки Блокноту"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Надання назви"

#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Без автоперейменування"

#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Немає наявних модулів щоб додати."

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Без Підсвічування"

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Початкове положення вкладок блокноту"

#: lazarusidestrconsts.dlgnotsplitlineafter
#| msgid "Do not split line after:"
msgid "Do not split line after"
msgstr "Не розривати рядок після"

#: lazarusidestrconsts.dlgnotsplitlinefront
#| msgid "Do not split line In front of:"
msgid "Do not split line in front of"
msgstr "Не розривати рядок перед"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Інспектор Об'єктів"

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Висота елемента"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Різне"

#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Параметри"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Параметри Швидкості"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Викор. типові параметри Delphi"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Викор. типові параметри Lazarus"

#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr ""

#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr ""

#: lazarusidestrconsts.dlgotherunitfiles
#| msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgid "Other unit files (-Fu) (delimiter is semicolon):"
msgstr "Інші файли модулів (-Fu) (роздільником є двокрапка):"

#: lazarusidestrconsts.dlgoverwriteblock
#| msgid "Overwrite Block"
msgid "Overwrite block"
msgstr "Переписати блок"

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Довідки до палітри компонентів"

#: lazarusidestrconsts.dlgpasext
#, fuzzy
#| msgid "Default pascal extension"
msgid "Default Pascal extension"
msgstr "Стандартне розширення паскаля"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Підсвічувати оператори управління як ключові слова"

#: lazarusidestrconsts.dlgpasextkeywordsgroup
#| msgid "Extended Pascal keyword options"
msgid "Extended Pascal Keyword Options"
msgstr "Розширені Параметри Ключових слів Паскаля"

#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr ""

#: lazarusidestrconsts.dlgpassoptslinker
#, fuzzy
#| msgid "Pass options to linker (delimiter is space)"
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Передати параметри компонувальнику (відділяти пробілами)"

#: lazarusidestrconsts.dlgpasstringkeywords
#| msgid "Highlight String keyword(s)"
msgid "Highlight \"String\" keyword(s)"
msgstr "Підсвічувати ключові слова \"String\""

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Типовий"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Відсутнє"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Лише \"String\""

#: lazarusidestrconsts.dlgpersistentblock
#| msgid "Persistent Block"
msgid "Persistent block"
msgstr "Постійний блок"

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Постійний курсор"

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Програма"

#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "як викликач (asInvoker)"

#: lazarusidestrconsts.dlgpoclearicon
#| msgid "Clear Icon"
msgid "&Clear Icon"
msgstr "&Очистити Значок"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Створити Пакет Програм"

#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr ""

#: lazarusidestrconsts.dlgpodpiaware
#| msgid "Dpi aware application (for Vista+)"
msgid "Enabled DPI Awareness (for Vista+)"
msgstr "Програма з DPI (для Vista+)"

#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Рівень Виконання"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Форми"

#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "найвищий доступний (highestAvailable)"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Значок:"

#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(розмір: %d:%d, bpp: %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(немає)"

#: lazarusidestrconsts.dlgpoloadicon
#| msgid "Load Icon"
msgid "&Load Icon"
msgstr "&Завантажити Значок"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Різне"

#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "потрібен адміністратор (requireAdministrator)"

#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr ""

#: lazarusidestrconsts.dlgposaveicon
#| msgid "Save Icon"
msgid "&Save Icon"
msgstr "&Зберегти Значок"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Сесія"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Заголовок:"

#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "Доступ UI (uiAccess)"

#: lazarusidestrconsts.dlgpouseappbundle
#| msgid "Use Application Bundle for running and debugging (darwin only)"
msgid "Use Application Bundle for running and debugging (Darwin only)"
msgstr "Використовувати Пакет Програм для запуску і налагодження (лише Darwin)"

#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Використовувати manifest-файл для ввімкнення тем (лише Windows)"

#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr ""

#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Проект"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Параметри проекту"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Параметри для Проекту: %s"

#: lazarusidestrconsts.dlgprojfiles
#| msgid "Project files"
msgid "Project Files"
msgstr "Файли Проекту"

#: lazarusidestrconsts.dlgpromptonreplace
#| msgid "&Prompt On Replace"
msgid "&Prompt on replace"
msgstr "Пи&тати при заміні"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Розширення властивості"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Назва властивості"

#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr "Автоматично закривати діалог компілювання"

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "При старті відкрити останній проект"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Показувати ширину бордюру"

#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Показувати діалог компілювання"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Показувати сітку"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Вирівнювати по сітці"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Посилання"

#: lazarusidestrconsts.dlgregularexpressions
#| msgid "Regular E&xpressions"
msgid "Regular e&xpressions"
msgstr "&Регулярні вирази"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Замінити &Всі"

#: lazarusidestrconsts.dlgreplacewith
#| msgid "&Replace With"
msgid "&Replace with"
msgstr "&Замінити на"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Звіт"

#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Орієнтирні лінії Права,Нижня"

#: lazarusidestrconsts.dlgrightclickselects
#| msgid "Right Click selects"
msgid "Right click selects"
msgstr "Вибір правим клацанням"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Праве поле"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Робоча тека"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Вибрати онука"

#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Створення Гумки"

#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Вибір Гумки"

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Дисплей (не для win32, напр., 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Середовище"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Місцевий"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Системні змінні"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Використовувати дисплей"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Overrides користувача"

#: lazarusidestrconsts.dlgrunparameters
#| msgid "Run parameters"
msgid "Run Parameters"
msgstr "Параметри Виконання"

#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Збер. робочий стіл у файл"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Збережений рядок"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Зберігати відомості про закриті файли"

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Зберігати відомості тільки про файли проекту"

#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Контекст"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Прокрутити на один вниз"

#: lazarusidestrconsts.dlgscrollgroupoptions
#| msgid "Scrolling:"
msgid "Scrolling"
msgstr "Прокрутка"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Показувати пораду з прокрут."

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Прокрутити до кінця файлу"

#: lazarusidestrconsts.dlgscrollpastendline
msgid "Caret past end of line"
msgstr "Каретку в кінець рядка"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Тека пошуку \"%s\" не знайдена."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Пошук перервано користувачем."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Пошук ..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Шляхи"

#: lazarusidestrconsts.dlgselectedtext
#| msgid "&Selected Text"
msgid "&Selected text"
msgstr "&Виділений текст"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Встановити всі елементи за замовчуванням"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Встановити елемент за замовчуванням"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Встановити змінну властивості"

#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Показати всі модулі"

#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Назви компонентів"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Показувати компільовані процедури"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Показувати номери рядків"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Показувати умови"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Показувати налагоджувальну інф-ю"

#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Довідки редактора"

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Показувати всі"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Показ. викон. інф. (для Win32)"

#: lazarusidestrconsts.dlgshowfullfilenames
msgid "Show full file names"
msgstr ""

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Показувати загальні відомості"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Показувати додаткові довідки"

#: lazarusidestrconsts.dlgshowhint
#| msgid "Show Hints"
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Показувати підказки"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Показувати номери рядків"

#: lazarusidestrconsts.dlgshownotes
#| msgid "Show Notes"
msgid "Show notes"
msgstr "Показувати примітки"

#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Показувати тільки помилки"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Показувати підсумкове"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Показувати випробувальні файли"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Показувати використані файли"

#: lazarusidestrconsts.dlgshowwarnings
#| msgid "Show Warnings"
msgid "Show warnings"
msgstr "Показувати попередження"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Показувати одну кнопку на панелі завдань"

#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Пропускати попередні оголошення класів"

#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr ""

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Розумна табуляція"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Символ позаду (.~pp)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Лічильник (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Символ попереду (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Защіпнутись за лінійками"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Пробіл"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Довідки до командних кнопок (відкрити, зберегти і т.д.)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Редактор Коду"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Походження"

#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Розмір стеку"

#: lazarusidestrconsts.dlgstatickeyword
#| msgid "Static Keyword in Objects"
msgid "Static keyword in objects"
msgstr "Ключове слово Static в об'єктах"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Завершити після купи помилок"

#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr ""

#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr ""

#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr ""

#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr ""

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Вкладені Властивості"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Параметри синтаксису"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "ТАБ зсуває блоки вправо"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Показувати номери вкладок в блокноті"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "ТАБ в пробіли"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Ширина ТАБа"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Сімейство цільового процеса"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Цільова ОС"

#: lazarusidestrconsts.dlgtargetplatform
#| msgid "Target Platform"
msgid "Target platform"
msgstr "Платформа"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Цільовий процесор"

#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr ""

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Тека для побудови пробних проектів"

#: lazarusidestrconsts.dlgtexttofind
#| msgid "&Text to Find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "&Текст для пошуку"

#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Підказка Поточного Класу/Проц"

#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Верх:"

#: lazarusidestrconsts.dlgtrimspacetypecaption
#| msgid "Trim Spaces Style"
msgid "Trim spaces style"
msgstr "Стиль обрізання пробілів"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Курсор або Редагування"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Змінений Рядок"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Залишити рядок"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Лише Позиція"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Обрізати кінцеві пробіли"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Скасування після збереження"

#: lazarusidestrconsts.dlgundogroupoptions
#| msgid "Undo / Redo:"
msgid "Undo / Redo"
msgstr "Повернути / Повторити"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Межа скасувань:"

#: lazarusidestrconsts.dlgunitdepcaption
#| msgid "Unit dependencies"
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "Залежності модуля"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Оновити"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Вихідна тека модулів (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Незбережений рядок"

#: lazarusidestrconsts.dlgusecodefolding
#| msgid "Code folding"
msgid "Code Folding"
msgstr "Згортання коду"

#: lazarusidestrconsts.dlgusecustomconfig
#| msgid "Use additional Compiler Config File"
msgid "Use additional compiler config file"
msgstr "Використовувати додатковий файл налаштувань компілятора"

#: lazarusidestrconsts.dlgusedividerdraw
#| msgid "Divider drawing"
msgid "Divider Drawing"
msgstr "Відображення Роздільника"

#: lazarusidestrconsts.dlgusefpccfg
#| msgid "Use standard Compiler Config File (fpc.cfg)"
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Використовувати стандартний файл налаштувань (fpc.cfg)"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Використовувати програму для запуску"

#: lazarusidestrconsts.dlguseminimumime
msgid "Ime handled by System"
msgstr "Ime обробляються Системою"

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Не вдалося завантажити файл користувацької схеми %s"

#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr "Використовувати (і змінювати) параметри глобальної схеми"

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Використовувати параметри локальної схеми"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Підсвітка синтаксису"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Врахов. історію вкладок при їх закритті"

#: lazarusidestrconsts.dlguseunitcaption
#| msgid "Use a unit from this project"
msgid "Add unit to Uses section"
msgstr "Додати модуль в секцію Uses"

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Значення"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Подробиці при компіляції:"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Видиме поле (лів)"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Права видима границя"

#: lazarusidestrconsts.dlgwholewordsonly
#| msgid "&Whole Words Only"
msgid "&Whole words only"
msgstr "&Лише цілі слова"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Ширина:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Графічний додаток Win32"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Вікно"

#: lazarusidestrconsts.dlgwinpos
#| msgid "Window Positions"
msgid "Window positions"
msgstr "Позиції вікна"

#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Винятки"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Слова"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Попередній перегляд"

#: lazarusidestrconsts.dlgwritefpclogo
#| msgid "Write an FPC logo"
msgid "Write FPC logo"
msgstr "Писати логотип FPC"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Виділені компоненти мають належати одній формі"

#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Вирівняти ..."

#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Стерти Виділення"

#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Горизонтальне Дзеркало"

#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Вертикальне Дзеркало"

#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "На один назад"

#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "На один Вперед"

#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "До попереднього"

#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Перемістити наперед"

#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr ""

#: lazarusidestrconsts.fdmsaveformasxml
#| msgid "Save form as XML"
msgid "Save Form as XML"
msgstr "Зберегти Форму як XML"

#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Масштабувати ..."

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Масштаб"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Виділити всі"

#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Розмір ..."

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Розмір"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Параметр:Кинути на решітку"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Параметр:Прикріпити до лінійок"

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-порядок"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "На Обидвох Сторонах"

#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr "Очистити всі знімки"

#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr "Перемкнути відображення між знімком та поточним"

#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr "Зробити Знімок"

#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr "Ввімкнути/Вимкнути автоматичні знімки"

#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr "Видалити вибраний елемент"

#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr "Переглянути Історію"

#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr "Переглянути Знімок"

#: lazarusidestrconsts.histdlgcolumnloc
msgid "Location"
msgstr "Розміщення"

#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr "Час"

#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr "Історія"

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = немає, 1 = малювати лінії роздільника лише для верхнього рівня, 2 =  малювати лінії для перших двох рівнів, ..."

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Додати файли"

#: lazarusidestrconsts.lisa2paddfilestopackage
#| msgid "Add files to package"
msgid "Add Files to Package"
msgstr "Додати Файли до Пакунку"

#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Додати до пакунку"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Двозначний тип предка"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Двозначна назва класу"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Двозначна назва модуля"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Тип Предок"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
#, fuzzy
#| msgid "A pascal unit must have the extension .pp or .pas"
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Модуль Паскаля повинен мати розширення .pp або .pas"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Порушення залежностей"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Назва класу вже існує"

#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Створити Новий Компонент"

#: lazarusidestrconsts.lisa2pcreatenewfile
#| msgid "Create new file"
msgid "Create New File"
msgstr "Створити Новий Файл"

#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr "Створити нову вимогу"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Залежність"

#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: %s%s%s"
msgstr "Існуючий файл: %s%s%s"

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Файл вже існує"

#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File %s%s%s already exists in the package."
msgstr "Файл %s%s%s вже є в пакунку."

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Файл вже використовується"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Назва файлу"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Файл не є модулем"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Неправильний тип предка"

#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Невірна кругова залежність"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Неправильна назва класу"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Неправильний файл"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Неправильна назва файлу"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Неправильна назва модуля"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s є некоректною назвою модуля"

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Нова назва класу"

#: lazarusidestrconsts.lisa2pnewcomponent
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
msgid "New Component"
msgstr "Новий компонент"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Новий файл"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Не знайдено пакунку для залежності %s%s%s.%sВиберіть існуючий пакунок."

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Задовга назва сторінки"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Сторінка палітри:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Модулі паскаля повинні мати розширення .pp або .pas"

#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Зберегти файл діалогу"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Скоротити або розширити назву файла"

#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Показувати всі"

#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Перемкнути шляхи"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Назва типа предка %s%s%s збігається з%sмодулем %s%s%s"

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, fuzzy
#| msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
msgstr "Тип предка %s%s%s є неправильним ідентифікатором паскаля"

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Назва класу %s%s%s і його предка %s%s%s збігаються."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Назва класу %s%s%s вже є в%sПакунок %s%sФайл: %s%s%s"

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Назва класу %s%s%s збігається з %s назвою модуля %s%s%s."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The class name %s%s%s is not a valid pascal identifier."
msgid "The class name %s%s%s is not a valid Pascal identifier."
msgstr "Назва класу %s%s%s є неприпустимим ідентифікатором паскаля"

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Файл %s%s%s є частиною поточного проекту.%sНе краща ідея ділити файли між проектами і пакунками."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Файл %s%s%s виглядає як подвійний, тому що пакунок не має теки за замовчуванням.%sВкажіть будь ласка назву файлу з повним шляхом."

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Максимальна Версія %s%s%s некоректна.%sВикористовуйте формат основна.другорядна.реліз.збірка%sНаприклад: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Максимальна Версія є меншою за Мінімальну Версію."

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Мінімальна Версія %s%s%s некоректна.%sВикористовуйте формат основна.другорядна.реліз.збірка%sНаприклад: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, fuzzy
#| msgid "The package has already a dependency for the package %s%s%s."
msgid "The package already has a dependency on the package %s%s%s."
msgstr "Пакунок вже має залежність від пакунку %s%s%s"

#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть існуючий пакунок."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Назва пакунку %s%s%s занадто довга (до 100 симв.)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Така назва модуля %s%s%s вже є в цьому пакунку:%s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Така назва модуля %s%s%s вже є в цьому пакунку."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Назва модулю %s%s%s%sі назва файлу %s%s%s різні."

#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Назва модуля %s%s%s не відповідає назві файлу"

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, fuzzy
#| msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Назва модуля збігається із зареєстрованим компонентом.%sЦе може призвести до непередбачуваних повідомлень про помилки."

#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Назва файлу модуля:"

#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Назва модуля:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Назва модуля вже існує"

#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Назва модуля є неприпустимою"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Скасувати зміни?"

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Прервати все"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Прервати всі завантаження"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Перервати завантаження проекту"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Повністю перевати завантаження"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Документація:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Про IDE"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Про проект Lazarus"

#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Ліцензія: GPL/LGPL. Див. початкові коди Lazarus та Free Pascal для деталей ліцензії.%sLazarus це IDE для створення графічних та консольних програм написаних на Free Pascal. Free Pascal це компілятор Pascal та Object Pascal, що працює на Windows, Linux, Mac OS X, FreeBSDта інших.%sLazarus є втраченим шматком пазлу, що дозволить розробляти програми для всіх перелічених платформ в Delphi-подібному оточенні. IDE - це RAD-інструмент що включає в себе дизайнер форм.%sОскільки Lazarus росте нам потрібно більше розробників."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Не можу знайти список авторів"

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Офіційний сайт:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, fuzzy
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgstr "%s не може вміщувати компоненти TControl.%sВ ньому можна розміщувати тільки невізуальні компоненти."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Подяки"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Дія:"

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Дії:"

#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Активувати"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Активувати синтаксис регулярних виразів для тексту і заміни (майже як в perl)"

#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Активувати Вибране"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Активний"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Активний Фільтр"

#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Додати"

#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr ""

#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr ""

#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr ""

#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr ""

#: lazarusidestrconsts.lisaddfilesindirectory
msgid "Add Files in Directory"
msgstr "Додати Файли в Теку"

#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr ""

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Додати новий режим побудови, копіюю налаштування з \"%s\""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Додати новий макрос"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Додати новий набір"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Додати залежності пакунку?"

#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr ""

#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "Додати пакунок %s до проекту?"

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Додати пакунок до проекту"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Додати параметричні дужки"

#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr "Адреса:"

#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr "&Точка зупинки за Адресою ..."

#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Додати %s до проекту?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Додати інтерфейси модулів"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Додати модуль (не рекомендовано)"

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Додати значення в макрос %s"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
#| msgid "Add file to a package"
msgid "Add File to Package"
msgstr "Додати Файл до Пакунку"

#: lazarusidestrconsts.lisaf2pdestinationpackage
#| msgid "Destination Package"
msgid "Destination package"
msgstr "Пакунок призначення"

#: lazarusidestrconsts.lisaf2pfiletype
#| msgid "File Type"
msgid "File type"
msgstr "Тип файлу"

#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Має процедуру Register"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Неправильний пакунок"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Неправильний ідентифікатор пакунку: %s%s%s"

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Пакунок тільки для читання"

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Пакунк %s%s%s не знайдений."

#: lazarusidestrconsts.lisaf2pshowall
#| msgid "Show All"
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Показувати всі"

#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Файл %s%s%s%sвже в пакунку %s."

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Пакунок %s тільки для читання."

#: lazarusidestrconsts.lisaf2punitname
#| msgid "Unit Name: "
msgid "Unit name: "
msgstr "Назва модуля: "

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Файл %s%s%s вже існує.%s Замінити?"

#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Після очищення (очищення всіх або загальних файлів), перейти до чистої автоматично"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Вирівнювання"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Всі блоки виглядають вірно."

#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr ""

#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Всі файли"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Всі успадковані параметри"

#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr ""

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Дозволити Виклики Функцій"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Дозволити пошук для декількох рядків"

#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Всі параметри у виклику даної функції вже визначені. Додавати нічого."

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Всі ваші зміни у %s%s%s%sбудуть загублені і файл відкриється повторно."

#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr ""

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Альтернативна кнопка"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Альтернативна клавіша (або двоклавішна комбінація)"

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Завжди"

#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Завжди конвертувати пропоноване ім'я файлу в нижній регістр"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Завжди ігнорувати"

#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr ""

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Знайдено двозначний файл"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Знайдено двозначний файл: %s%s%s%sЙого може бути переплутано з %s%s%s%s%sВидалити цей файл?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Знайдено двозначні файли"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Знайдено двозначний модуль"

#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Знайдений неоднозначний модуль"

#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Якорити нижній бік до нижньої сторони брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата ігнорується."

#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Якорити нижній бік до верхньої сторони брата. Відстань задається властивостями BorderSpacing цього елемента і брата."

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Редактор Якорів - не вибраний елемент керування"

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Ввімкнено = Включити %s в Якорі"

#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Якорити лівий бік до лівої сторони брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата ігнорується."

#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Якорити лівий бік до правої сторони брата. Відстань задається властивостями BorderSpacing цього елемента і брата."

#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Якорити правий бік до лівої сторони брата. Відстань задається властивостями BorderSpacing цього елемента і брата."

#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Якорити правий бік до правої сторони брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата ігнорується."

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Якорі вибраних елементів керування"

#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Якорити верхній бік до нижньої сторони брата. Відстань задається властивостями BorderSpacing цього елемента і брата."

#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Якорити верхній бік до верхньої сторони брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата ігнорується."

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "При останньому запуску виникла помилка при завантаженні %s!%s%sЗавантажити цей проект знову?"

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "&Ім'я класу програми"

#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr ""

#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Застосувати"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "застосовувати прапори побудови (-B) також до залежностей"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Застосувати умови"

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Модуль проекту не може бути використаний іншими пакунками/проектами"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Ширина бордюру навколо контролу. Інші чотири бордюри додаються до цієї величини."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Запитати перед заміною кожного фрагменту"

#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Запитати перед збереженням сеансу проекту"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "Запитати ім'я компоненту після встановлення його на формі дизайнера"

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Питати ім'я файлу для нового файлу"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Спитати назву при створенні"

#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr ""

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Автозавершення: викл"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Автозавершення: вкл"

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Автопродовження після:"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Розмітка і Співпадіння"

#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Автоматично"

#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Автоматично"

#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr "Автоматично конвертувати файли .lfm в файли заголовків .lrs"

#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "не завершувати виділення"

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Автозаклик після крапки"

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "розрив рядка"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "пробіл"

#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "табуляція"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "кінець слова"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "не додавати символ"

#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Завершення і Підказки"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Автоматичний Показ"

#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr ""

#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr "Доступні режими побудови проекту:"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Зробити резервну копію змінених файлів"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Резервування не вдалося"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Створює резервний каталог в каталозі проекту"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Зміна назви пакунку або версії порушить залежності. Змінити ці залежності як правило?%sВиберіть Так для заміни всіх перерахованих залежностей.%sВиберіть Ігнорувати для розриву залежностей і продовження."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "починається"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Після пов'язаних"

#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "Переглядатиметься найкраще, якщо встановити елемент керування HTML, як напр. turbopoweriprodsgn"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
#| msgid "Always Build before Run"
msgid "Always build before run"
msgstr "Завжди Будувати перед Виконанням"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Побудувати Команду"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Замість виконання після побудови проекту використовуйте коменду Побудувати Файл"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Замість виконання після побудови проекту використовуйте коменду Виконати Файл"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Виконати Команду"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
#| msgid "When this file is active in source editor ..."
msgid "When this file is active in source editor"
msgstr "Коли цей файл активний в редакторі коду"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
#| msgid "Working directory (Leave empty for file path)"
msgid "Working directory (leave empty for file path)"
msgstr "Робоча тека (залишити порожньою для файлового шляху)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Нестандартні значення жирним"

#: lazarusidestrconsts.lisborderspace
#| msgid "BorderSpace"
msgid "Border space"
msgstr "Простір Межі"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Нижній бордюр. Ця величина додається до базового бордюру і використовується для відступу під контролем."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Зафіксувати кнопку"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Нижні"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Це список контролів одного рівня для якого нижня сторона зафіксована. Залишити порожнім для батьківського."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Вниз з еквівалентим відступом"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Перервати"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Властивості Точки зупинки"

#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Додати"

#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Закрити"

#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Видалити"

#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr ""

#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "За&мінити ..."

#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "&Доступний"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Знайти"

#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "Ви&хід"

#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Видалити"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "За&мінити"

#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Побудувати"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "побудувати всі файли проекту/пакунку/IDE"

#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Побудувати"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "будувати IDE з пакунками"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Побудова Lazarus не вдалась"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Відмінності між режимами побудови"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
#, fuzzy
#| msgid "Differences to other build modes"
msgid "Differences from other build modes"
msgstr "Відмінності від інших режимів побудови"

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Режим:"

#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr ""

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Режими побудови"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Побудувати новий проект"

#: lazarusidestrconsts.lisbuildnumber
#| msgid "Build Number"
msgid "Build number"
msgstr "Номер білду"

#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Побудувати"

#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr ""

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Виклик %s для створення Makefile з %s не вдався."

#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr "Стек не оцінений"

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Скасувати"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Скасувати завантаження цього компонету"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Скасувати завантаження модуля"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Скасувати зміну назви"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Не можу скомпілювати проект"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
#, fuzzy
#| msgid "Can not copy top level component."
msgid "Cannot copy top level component."
msgstr "Не можу скопіювати компонент верхнього рівня."

#: lazarusidestrconsts.liscannotcreatefile
#, fuzzy
#| msgid "Can not create file %s%s%s"
msgid "Cannot create file %s%s%s"
msgstr "Не можу створити файл %s%s%s"

#: lazarusidestrconsts.liscannotfindlazarusstarter
#, fuzzy
#| msgid "Cannot find lazarus starter:%s%s"
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Не можу знайти пускач lazarus:%s%s"

#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr ""

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Можу змінити тільки клас TComponetns"

#: lazarusidestrconsts.liscaptiondiff
msgctxt "lazarusidestrconsts.liscaptiondiff"
msgid "Diff"
msgstr "Порівнянти"

#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr "%s (%s файлів)"

#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr "Справді видалити %s файлів з вих. кодом%s%s"

#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Змінити клас для %s"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "немає класу"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Неоднозначний компілятор"

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Перевірте теку Тестів в %sІнструменти -> Параметри -> Файли -> Тека для створення тестових проектів"

#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Компілятор \"%s\" не є виконуваним файлом.%sДетально: %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "містить "

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Копіювати вивід в буфер"

#: lazarusidestrconsts.lisccodatesdiffer
#, fuzzy
#| msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Дати .ppu файлів FPC відрізняються більше однієї години.%sЦе може означати, що вони з двох різних встановлень.%sФайл1: %s%sФайл2: %s"

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Помилка"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ПОМИЛКА: "

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Шлях модуля FPC містить джерело: "

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "символи нового рядка"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "ПІДКАЗКА:"

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Невірний компілятор"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Невірний шлях пошуку"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Невірна Тестова Тека"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Втрачений модуль"

#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "зібраний модуль FPC не знайдено: %s.ppu"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "знайдено кілька конфігурацій компілятора: "

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "Не знайдено fpc.cfg"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "не ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu наявний двічі: %s, %s"

#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "Зібраний модуль FPC %s.ppu не знайдений.%sЦе зазвичай означає, що ваш fpc.cfg має помилку. Або встановлення вашого FPC зламане."

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Існує .ppu файл старший самого компілятора:%s%s"

#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "За вашим шляхом є кілька компіляторів Free Pascal.%s%s%sМожливо ви забули видалити старий компілятор?"

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Пропустити"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "спеціальні символи"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Всі тести виконано успішно."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Не можу створити Тестовий Файл"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, fuzzy
#| msgid "Unable to create Test pascal file \"%s\"."
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Не можу створити Тестовинй файл Паскаля \"%s\"."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "незвичайні символи"

#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Попередження"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ПОПЕРЕДЖЕННЯ: "

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "невірний роздільник шляху"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Категорії"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Складність"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Константи"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Порожні блоки"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Порожні класові секції"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Порожні конструктори"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Порожні процедури"

#: lazarusidestrconsts.liscefilter
#| msgid "(Filter)"
msgid "(filter)"
msgstr "(фільтр)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Слідувати за курсором"

#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s в %s"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Є кореневим елементом керування"

#: lazarusidestrconsts.liscelongparamlistcount
#| msgid "Parameters count treating as \"many\""
msgid "Parameters count treated as \"many\""
msgstr "К-сть параметрів розглядається як \"багато\""

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Довгі процедури"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "К-сть рядків процедури розглядається як \"багато\""

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Багато вкладених процедур"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Багато параметрів"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Показувати Категорії"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Показати Вузли Початкоіого Коду"

#: lazarusidestrconsts.liscenestedproccount
#| msgid "Nested procedures count treating as \"many\""
msgid "Nested procedures count treated as \"many\""
msgstr "К-сть вкладених процедур розглядається як \"багато\""

#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr ""

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
#| msgid "Center control horizontally relative to the given sibling"
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Відцентрувати контрол по горизонталі відносно заданого рівня. BorderSpacing ігнорований."

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
#| msgid "Center control vertically relative to the given sibling"
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Відцентрувати контрол по вертикалі відносно заданого рівня. BorderSpacing ігноровано."

#: lazarusidestrconsts.liscenterform
#| msgid "Center form"
msgid "Center Form"
msgstr "Центрувати Форму"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Центр вікна"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Центри"

#: lazarusidestrconsts.lisceomode
#| msgid "Preferred Exhibition Mode"
msgid "Preferred exhibition mode"
msgstr "Переважний режим відображення"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Категорія"

#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Джерело"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Ніколи, тільки вручну"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Використовується лише в режимі категорій"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "В паузах"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Оновлювати автоматично"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Інше"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Поновити"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Коли перемикається файл в редакторі коду"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Процедури"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Властивості"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Опубліковані властивості без типових"

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr "Показати зауваження з приводу"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Стиль"

#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Навколишні"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Записи ToDo"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Типи"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Неіменовані константи"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Несортовані члени"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Несортовані видимі"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Змінні"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Невірні відступи"

#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occured during deletion of%s\"%s:%s\"%s%s"
msgstr "Стався виняток під час видалення%s\"%s:%s\"%s%s"

#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr "Скасувати завантаження цього ресурсу"

#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr "%s%sКлас \"%s\" не знайдено."

#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr "%s%sКомпонент: %s:%s"

#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr "%s%sКлас Компоненту: %s"

#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr "Продовжити завантаження"

#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Не знаю, як скопіювати цей вибір форми редагування"

#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Не знаю, як вирізати цей вибір форми редагування"

#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Не знаю, як видалити цей вибір форми редагування"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Помилка створення компоненту"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr "Помилка створення компоненту: %s%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Помилка знищення компоненту"

#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Помилка знищення компоненту типу %s модуля %s:%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Помилка знищення посередника"

#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Помилка знищення посередника %s модуля %s:%s%s"

#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr "Помилка читання %s"

#: lazarusidestrconsts.liscfeinfile
msgid "%sIn file %s%s"
msgstr "%sВ файлі %s%s"

#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Неприпустимий власник компоненту"

#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr "%sКореневий=%s:%s"

#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr "Зупинити всі завантаження"

#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr "%sПотік=%s"

#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr "%s%sПозиція потоку: %s"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm вже існує"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Невідомий тип %s"

#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent  Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent  Де знаходиться TCustomNonFormDesignerForm? %s"

#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator вже зареєстрований: %s"

#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "Редактор компоненту класу \"%s\"створив помилку:%s\"%s\""

#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "Компонент типу %s не зміг встановити свого власника на %s:%s"

#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr "Не вдалося очистити вибір форми редагування%s%s"

#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Змінити"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Змінити режим побудови"

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Змінити клас"

#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr ""

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Змінити Кодування"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Змінити файл"

#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Змінити предка"

#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Зміни не були збережені"

#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Змінити на Unix /"

#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Змінити на Windows \\"

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Символ"

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Таблиця символів"

#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Відмітити все"

#: lazarusidestrconsts.lischeckfordiskfilechangesviacontentratherthantimesta
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Перевіряти зміни файлу на диску за вмістом а не міткою часу"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr "перевіряти, чи наступний символ в джерелі є кінцем і, якщо ні то повернути кінецьрядка + кінеь; + кінецьрядка"

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Перевірити параметри"

#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Перевірити ціль (ОС, ЦП, тип віджету LCL). Можливо вам треба перекомпілювати пакет для цієї цілі або встановити іншу ціль для проекту."

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Виберіть іншу назву"

#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr ""

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Виберіть посилання FPDoc"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Виберіть клавішу ..."

#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "Виберіть ім'я для нового компоненту"

#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Виберіть файл прикладу"

#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Виберіть файл повідомлень FPC"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
#, fuzzy
#| msgid "Choose a pascal file for indentation examples"
msgid "Choose a Pascal file for indentation examples"
msgstr "Виберіть файл Паскаля для прикладу відступів"

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Виберіть файл повідомлень компілятора"

#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Виберіть файл компілятора (%s)"

#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Виберіть файл налагоджувача"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Виберіть пакунок Delphi (*.dpk)"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Вибріть проект Delphi (*.dpr)"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Виберіть модуль Delphi (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Виберіть теку"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Виберіть теку коду FPC"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Виберіть теку Lazarus"

#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Виберіть шлях make"

#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Виберіть ім'я"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Виберіть один із цих пунктів для створення нового файлу"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Виберіть один із цих пунктів для створення нового пакунку"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Виберіть один із цих пунктів для створення нового проекту"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Виберіть один із цих елементів для його успадкування "

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Виберіть код програми (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Виберіть структуру для включення в неї виділення"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Виберіть теку для тестів"

#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Виявлена кругова залежність"

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Завершення Класу"

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Класи та властивості існують. Значення не були перевірені."

#: lazarusidestrconsts.lisclassesppunotfoundcheckyourfpccfg
msgid "classes.ppu not found. Check your fpc.cfg."
msgstr "classes.ppu не знайдено. Перевірте ваш fpc.cfg."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Клас %s%s%s не є зареєстрованим класом компонента.%sНе можу вставити."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Клас не знайдено"

#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Клас %s%s%s методу %s%s%s не знайдено."

#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Очистити"

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Очистити теку"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Очистити підтеки"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Залишати всі текстові файли"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Залишати файли, що відпов. фільтру"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Видалити файли за фільтром"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Простий синтаксис (напр., * замість .*)"

#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Очистити все"

#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr "Очистити загальні файли"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Очистити коди Lazarus"

#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Перейти після збирання на автоматично"

#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Очистка"

#: lazarusidestrconsts.liscleanupandbuild
msgid "Clean up and build"
msgstr "Очистити і побудувати"

#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Очистити і побудувати проект"

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Очистити шлях до модулів?"

#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Очистити"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Очистити Теку?"

#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr ""

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Клацніть тут для вибору файлу"

#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr "Клацніть для перегляду можливих варіантів використання"

#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr ""

#: lazarusidestrconsts.lisclose
#| msgid "&Close"
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Закрити"

#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Очистити Все"

#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Закрити всі Відмічені"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Закрити файли"

#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "Сховати вікно"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Закриття вікна Редактора вихідного коду. Ви хочете закрити всі файли чи сховати вікно?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Закрити вікно Редактора Коду"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Параметри LCL, що залежать від інтерфейсу:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Параметр"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Компоненти"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Успадкування"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Список"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Палітра"

#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr ""

#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr ""

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Знайдено двозначний файл налаштування компілятора"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Виклик:"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, fuzzy
#| msgid "%s%sClick OK if you are sure to do that."
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sКлацніть ОК, ящко Ви впевнені це зробити"

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Команда:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Код"

#: lazarusidestrconsts.liscodebrowser
#| msgid "Code browser"
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Браузер Коду"

#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Провідник Коду"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Параметри генерування коду"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Додати шлях"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Огляд"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Підтвердити заміну"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Створити елемент довідки"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Видалити шлях"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Опис"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Помилки"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Приклад"

#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "Параметри FPDoc"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Вставити тег жирності тексту"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Вставити тег форматування тексту програми"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Вставити тег форматування курсивом"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Вставити тег ремарок"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Вставити тег форматування підкресленням"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Вставити тег форматування для змінних"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Наслідуваний"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Вставити посилання ..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Вставити тег абзацу"

#: lazarusidestrconsts.liscodehelpmainformcaption
#| msgid "FPDoc editor"
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(не знайдено успадкованого опису)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<НІЧОГО>"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Дивись також"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Короткий опис для"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Короткий"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Ігнорувати константи в наступних функціях"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Шукати неіменовані константи-символи"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Оглядач Коду"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Ігнорувати наступні неіменовані константи"

#: lazarusidestrconsts.liscodetempladd
#| msgid "Add"
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Додати шаблон"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Додати шаблон коду"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "Елемент %s%s%s вже існує! "

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Автозавершення при"

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Змінити"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Коментар:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Редагувати шаблони коду"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Помилка"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Мітка:"

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Дія: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, fuzzy
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Автостворювані елементи не можуть ані редагуватись,%s ані вміщувати неавтостворювані дочірні елементи"

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, автоматично створене"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
#, fuzzy
#| msgid "Auto generated nodes can not be edited."
msgid "Auto generated nodes cannot be edited."
msgstr "Автостворювані елементи не можуть редагуватись."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Заблокувати"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Редактор Визначень Інструменів Коду"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Шлях до компілятора"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Перетворення елементу"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Створити означення для %s Теки"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Створити означення для компілятора FreePascal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Створити визначення для текстів програми Free Pascal SVN"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Створити означення для %s Проекту"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Створити макроси FPC і шляхи до тек проекту FPC"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Визначення"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Визначає рекурсивно"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Видалити вузол"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Головна тека %s, %sде Borland встановив всі коди %s. %sНаприклад: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Головна тека %s, %sде Borland встановив всі коди %s,використані проектом %s. %sНаприклад: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Опис:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "тека %s"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Інакше"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Вихід без збереження"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Тека програм FPC SVN"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Тека"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Вставити шаблон компілятора Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Вставити шаблон з теки Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Вставити шаблон проекту Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Вставити шаблон компілятора Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Вставити шаблон з теки Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Вставити шаблон проекту Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Вставити шаблон компілятора Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Вставити шаблон з теки Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Вставити шаблон проекту Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Вставити шаблон компілятора FreePascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Вставити шаблон проекту FreePascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Вставте шаблон Free Pascal SVN"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Вставити шаблон компілятора Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Вставити шаблон з теки Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Вставити шаблон проекту Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Вставити елемент як дочірній"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Вставити елемент нижче"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Вставити шаблон"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Неправильний предок"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Неправильний елемент предка"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Неправильний попередній елемент"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Головна тека %s,%sде Borland встановив всі %s коди.%sНаприклад: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Головна тека %s,%sде Borland встановив %s коди,%sякі використовують цей %s проект.%sНаприклад: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Пересунути вузол вниз"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Пересунути вузол на один рівень нижче"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Пересунути вузол на один рівень вище"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Пересунути вузол вверх"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Назва:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Новий вузол"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Вузол лише для читання"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "нічого не вибрано"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
#, fuzzy
#| msgid "Parent node can not contain child nodes."
msgid "Parent node cannot contain child nodes."
msgstr "Елемент предка не може вміщувати дочірніх."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Попередній елемент не може вміщувати дочірніх."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Тека проекту"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "Тека проекту %s"

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Помилка читання"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Зберегти і вийти"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Виділити елемент:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "Тека текстів Free Pascal SVN. Не обов'язково. Це покращить пошук декларацій при налагоджуванні."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Тека проекту FreePascal."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Тека текстів Free Pascal SVN."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Шлях до компілятора Free Pascal.%s Наприклад, %s/usr/bin%s -n%s або %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Шлях до компілятора проекту Free Pascal. Потрібно лише, якщо Ви встановлюєте нижче програму FPC SVN. Використовується для автостворювання макросів."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "Шлях до компілятора Free Pascal для цього джерела.%sВикористаний для автостворення макросів."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Тека %s проекту,%sщо вміщує файли .dpr, dpk."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Зняти визначення"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Зняти визначення зі всіх"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Рекурсивно зняти визначення"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Значення як шляхи до файлів"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Значення як текст"

#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%значення \"%s\" є невірним."

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Змінна:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Помилка запису"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Біля"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Дужка"

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Колонка"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Кома"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Ідентифікатор"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Ключове слово"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Новий рядок"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Відсутнє"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Номер"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Крапка"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Крапка з комою"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Пробіл"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Рядкова конст."

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Символ"

#: lazarusidestrconsts.liscodetoolstemplatefile
msgid "CodeTools template file"
msgstr ""

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Виконати після"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Виконати перед"

#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr ""

#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr ""

#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr "Згорнути все (/)"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Колапс всіх класів"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Колапс всіх пакетів"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Колапс всіх модулів"

#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr ""

#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr ""

#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Команда після"

#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Некоректна команда \"після\" "

#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Команда після установки модуля"

#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Параметри командного рядка"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Параметри командного рядка програми"

#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Компілювати"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Компілятор"

#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Компілятор \"%s\" не підтримує ціль %s-%s"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Помилка: неправильний компілятор:%s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Назва файлу компілятора"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Довідка: Ви можете задати шлях до компілятора в Інструменти->Параметри->Файли->Шлях до компілятора"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "ЗАУВАЖЕННЯ:не знайдено конфігураційного файлу до codetools - працюю за замовчуванням "

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "ЗАУВАЖЕННЯ:завантажую старий файл з налаштуваннями codetools"

#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Компіл."

#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (компілюю ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Відображення довгих підказок"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Подовжувати далеко вліво"

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Подовжувати трохи вліво"

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Ніколи"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Подовжувати лише вправо"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
#, fuzzy
#| msgid "Component name \"%s\" is a pascal keyword."
msgid "Component name \"%s\" is a Pascal keyword."
msgstr "Ім'я компоненту \"%s\" є ключовим словом Паскаля."

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Назву компонента %s%s%s зарезервовано"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Назва компонента %s%s%s є некоректним ідентифікатором"

#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Дивитись все"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Відкриття пакунку"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Відкрити модуль"

#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Тест"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Умова"

#: lazarusidestrconsts.lisconditionals
#| msgid "Conditionals:"
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Умовні"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Тека конфігурації Lazarus"

#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Налаштувати Побудову %s"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Налаштувати %sПобудову Lazarus%s"

#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Налаштувати Lazarus IDE"

#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Підтвердити"

#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Підтвердження"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus буде перезібраний з наступним профілем:%sПродовжити?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Підтвердити зміни"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Підтвердити видалення"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy
#| msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Перебудувати Lazarus з профілем: %s ?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Підтвердіть новий набір пакетів для IDE"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Дія"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Новий набір пакунків"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Старий набір пакунків"

#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Конфлікт"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Консольна програма"

#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr ""

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Код конструктора"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "вміщує"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "З врахуванням контексту"

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Продовжити"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Продовжити і не питати знов"

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Продовжити без завантаження форми"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Учасники"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Елемент управління вимагає \"предка\""

#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr ""

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Зсув додається до координати Верху контролів всередині візуальних контейнерів"

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Зміщення координат"

#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Всі підтеки будуть перевірятися на файли модулів"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "BeginCodeTools не вдався!"

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Категорії:"

#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr "Кодування змінено з %s на UTF-8"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Перетворення Перервано."

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Перетворення Готове."

#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Конвертувати пакунок Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Конвертувати проект Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Конвертувати модуль Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertingfile
msgid "* Converting file %s *"
msgstr "* Конвертую файл %s *"

#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Помилка=\"%s\""

#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr ""

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Помилка конвуртування модуля"

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr "Помилка конвуртування модуля%s%s%s"

#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Виправлений регістр символів модуля \"%s\" на \"%s\"."

#: lazarusidestrconsts.lisconvdelphifixingusedunits
msgid "* Fixing used units for file %s *"
msgstr "* Виправляю використані модулі для файлу %s *"

#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Функція Delphi"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) не знаходить файл включення"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Ім'я Delphi"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Ім'я пакунку існує"

#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr "Знехтуваний модуль %s з проекту"

#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
msgid "Removed unit \"%s\" in uses section."
msgstr "Видалений модуль \"%s\" в секції uses."

#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "* Repairing form file %s *"
msgstr "* Ремонт файлу форми %s *"

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
#, fuzzy
#| msgid "*** Repairing form files ... ***"
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Ремонт файлів форми ... ***"

#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Замінений модуль \"%s\" на \"%s\" в секції uses."

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Вже існує пакунок з іменем \"%s\"%sБудь ласка спочатку виберть пакунок."

#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Модулі для заміни в %s"

#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr ""

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Помилка перетворення"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Конвертувати"

#: lazarusidestrconsts.lisconvertencoding
#| msgid "Convert encoding"
msgid "Convert Encoding"
msgstr "Конвертувати Кодування"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Змінити кодування проектів/пакунків"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Конвертувати проект або пакунок"

#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Ціль"

#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr ""

#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr ""

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Конвертер додає умовну компіляцію для підтримки різних цілей"

#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Використовувати той самий файл DFM форми"

#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Той самий DFM файл для Lazarus та Delphi замість копіювання його в LFM"

#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Підтримувати Delphi"

#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Використання умовної компіляції для підтримки Delphi"

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Заміни Функцій"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Деякі функції Delphi можна замінити функцію LCL"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Функції / процедури для заміни"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Зсув зліва"

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Нове Ім'я"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Батьківський Контейнер"

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Зсув зверху"

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Заміни Типів"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Невідомі типи в файлі форми (DFM/LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Замінювані типи"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Заміни Модулів"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Назви модулів в секції uses джерельного модуля"

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Замінювані модулі"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Невідомі властивості"

#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Копіювати"

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Копіювати Все"

#: lazarusidestrconsts.liscopyallitemstoclipboard
#| msgid "Copy all items to clipboard"
msgid "Copy All Items to Clipboard"
msgstr "Копіювати всі елементи в буфер"

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Копіювати весь вихід в буфер"

#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
#| msgid "Copy all shown and hidden messages to clipboard"
msgid "Copy All Shown and Hidden Messages to Clipboard"
msgstr "Копіювати всі Видимі та Приховані повідомлення в буфер"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
#| msgid "Copy all shown messages to clipboard"
msgid "Copy All Shown Messages to Clipboard"
msgstr "Копіювати всі Видимі повідомлення в буфер"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Копіювати опис в буфер обміну"

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Помилка при копіюванні"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Помилка копіювання"

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr "Копіювати %s%s%s в буфер обміну"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Копіювання всієї форми не реалізоване."

#: lazarusidestrconsts.liscopyitemtoclipboard
#| msgid "Copy item to clipboard"
msgid "Copy Item to Clipboard"
msgstr "Копіювати елемент в буфер"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
#| msgid "Copy selected items to clipboard"
msgid "Copy Selected Items to Clipboard"
msgstr "Копіювати вибрані елементи в буфер обміну"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
#| msgid "Copy selected messages to clipboard"
msgid "Copy Selected Messages to Clipboard"
msgstr "Копіювати вибрані повідомлення в буфер"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Пошук повідомлень FPC"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Пошук повідомлень Make"

#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr "Перевіряти повідомлення:"

#: lazarusidestrconsts.liscoskipcallingcompiler
#| msgid "Skip calling Compiler"
msgid "Skip calling compiler"
msgstr "Пропустити виклик компілятора"

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr "Не можу додати %s{$I %s%s} до основного файлу поч. коду!"

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr "Не можу додати %s{$R %s%s} до основного файлу поч. коду!"

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr "Не можу додати %s%s%s до основного файлу поч. коду!"

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr "Не можу видалити %s%s%s з основного файлу поч. коду!"

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr "Не можу видалити %s{$I %s%s} з основного файлу поч. коду!"

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr "Не можу видалити %s{$R %s%s} з основного файлу поч. коду!"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Увага: додатковий файл налаштувань компілятора має ту ж саму назву, як може називатись один із стандартних файлів налаштувань компілятора Free Pascal. Це призведе до використання додаткового файлу і пропуску стандартного."

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Відкрити Пакунок %s"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Відкрити Модуль %s"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Спочатку створіть проект!"

#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr ""

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Створити теку?"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Створити функцію"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Створити вузол Довідки"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Створити його"

#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Створити новий пакунок)"

#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Створити новий компонент пакунку"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Створити проект"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Створити/оновити .po файл при збереженні lfm файлу"

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Створення файлового індексу джерел FPC %s ..."

#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "Нижній"

#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "Верхній"

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Виберіть теку"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Параметри тек Інструментів Коду"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Визначення шаблонів"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Не вибрано змінних>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Відкрити попередній перегляд"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Інструменти"

#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Змінна: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Назва змінної"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Шаблони"

#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr ""

#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr ""

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "виберіть будь-ласка макрос"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Вибрати Код Макросу"

#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Поточний"

#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Поточний стан: "

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Колонка курсора в цьому редакторі"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Рядок курсора в цьому редакторі"

#: lazarusidestrconsts.liscustomopthint
#, fuzzy
#| msgid "These options are passed directly to the compiler. Macros are replaced, line breaks are replaced with single spaces."
msgid "These options are passed to the compiler after comments are deleted and macros are replaced."
msgstr "Ці опції передаються безпосередньо в компілятор. Макроси заміняються, переходи рядка замінюються одним пропуском."

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "параметри користувача"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Спеціальні параметри"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Спеціальна програма"

#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr ""

#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Вирізати"

#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr ""

#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr ""

#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr ""

#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr ""

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Модуль Даних"

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Дата"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Видалити все"

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Видалити все"

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Вимкнути все"

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Вимкнути все"

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Ввімкнути все"

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Ввімкнути все"

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
#| msgid "Copy to clipboard"
msgid "Copy to Clipboard"
msgstr "Копіювати в буфер"

#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr "Властивості Точки Зупинки ..."

#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr "&Вираз:"

#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr "&Нове значення:"

#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr "&Результат:"

#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Аналіз Точки Зупинки"

#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Досягнення Точки Зупинки"

#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Повідомлення Точки Зупинки"

#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Дамп Стеку для Точки Зупинки"

#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Колір за Замовчуванням"

#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Виник Виняток"

#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Завантаження Модуля"

#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Вивантаження Модуля"

#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Налагоджувальний рядок"

#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Завершення Процесу"

#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Запуск Процесу"

#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Заверщення Ниті"

#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Запуск Ниті"

#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Віконне Повідомлення Додано"

#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Віконне Повідомлення Надіслане"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Вилучити"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Вимкнути"

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Вимкнути"

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Ввімкнути"

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Ввімкнути"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Налагоджувач не визначений"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Встановити точку зупину за будь-яких обставин"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, fuzzy
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Не вказаний Debugger.%sВстановлені точки зупину не будуть задіяні до тих пір поки не буде встановлений Debugger в меню опцій діалогу з debugger."

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Вкл/Викл"

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Вимкнення/Ввімкнення оновлень всього вікна"

#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Налагоджувач"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Помилка налагоджувача%sОпа! Налагоджувач знаходиться в неробочому стані%sЗбережіть работу!%sНатисніть Стоп і сподівайтесь на краще!"

#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr "Помилка Налагоджувача"

#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr "Інформація налагоджувача"

#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr "Попередження Налагоджувача"

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Неправильний налагоджувач"

#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (йде налагодження ...)"

#: lazarusidestrconsts.lisdebughintautotypecastclass
#, fuzzy
#| msgid "Automatic type-cast for objects"
msgid "Automatic typecast for objects"
msgstr "Автоматичний підбір типу для об'єктів"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Додати Виняток"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Додатковий пошуковий шлях"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Точка зупину"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Очищувати log при виконанні"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Налагоджувач"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Загальні опції налагоджувача"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Специфічні опції налагоджувача (залежить від його типу)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Дубльоване ім'я Винятку"

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Введіть ім'я винятку"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Лог-файл подій"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Належить "

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Належить Налагоджувачу"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Належить Програмі"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ігнорувати ці вирази"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Мовні розширення"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Обмежити к-сть рядків до"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Модуль"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "Повідомляти про Винятки Lazarus"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Розширення ОС"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Виведення"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Процес"

#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Скидати Налагоджувач після кожного запуску"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Відновити"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Відновити за Handler`ом"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Відновити Unhandled"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Показувати повідомлення зверху"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Сигнали"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Програмний канал"

#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Використовувати кольори логу подій"

#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Вікна"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Не можу завантажити файл"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Не можу завантажити файл %s%s%s."

#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Десяткове"

#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Типовий"

#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(типово)"

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Затримка виведення довгих підказок у вікні автозавершення"

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Затримка виведення підказок і вікна автозавершення"

#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Вилучити"

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Видалити Все"

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Видалити всі точки зупинки?"

#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Видалити всі точки зупинки в файлі %s%s%s?"

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Видалити Всі в тому ж файлі початкового коду"

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Видалити всі вибрані точки зупинки?"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Видалити всі ці файли?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Видалити файл з неоднозначною назвою?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Видалити Точку Зупинки"

#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Видалити точку зупинки в%s\"%s\" рядок %d?"

#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr "Видалити точку зупинки для адреси %s?"

#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr "Видалити точку спостереження для \"%s\"?"

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Видалення файлу не вдалося"

#: lazarusidestrconsts.lisdeletemacro
#| msgid "Delete macro %s"
msgid "Delete macro %s%s%s?"
msgstr "Видалити макрос %s%s%s?"

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Видалити режим \"%s\""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Видалити старий файл %s%s%s?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Видалити старий файл?"

#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Видалити вибрані файли"

#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr ""

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr "Видалити значення %s%s%s"

#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Видалити значення %s"

#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Видалення файлу  %s%s%s не вдалося."

#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"

#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "Пакунок Delphi"

#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Проект Delphi"

#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "Модуль Delphi"

#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr ""

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Тека призначення"

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Код Деструктора"

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Без урахування регістру"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ігнорувати дод./видал. порожніх рядків"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ігнор. різні заверш. рядків (напр., #10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ігнорувати кількість пробілів"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ігнор. пробіли (без CR)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ігнорувати пробіли в кінці рядка"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ігнорувати пробіли на початку рядка"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Тільки вибране"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Відкрити різницю в редакторі"

#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Текст1"

#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Текст2"

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Розряди:"

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Директиви"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Директиви для нового модуля"

#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr ""

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr "Тека %s%s%s не знайдена."

#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr "тека %s не знайдена"

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Тека не доступна для запису"

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Тека, в якій IDE розміщує .po файли"

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Вимкнути Всі в тому ж файлі початкового коду"

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Вимкнути Точку Зупинки"

#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Вимкнено"

#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr "Вимкнути Групи"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Вимкнути I18N для LFM"

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Асемблер"

#: lazarusidestrconsts.lisdisassgotoaddress
#| msgid "Goto address"
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "ЙтиДо Адреси"

#: lazarusidestrconsts.lisdisassgotoaddresshint
#| msgid "Goto address"
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "ЙтиДо Адреси"

#: lazarusidestrconsts.lisdisassgotocurrentaddress
#| msgid "Goto current address"
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "ЙтиДо поточної Адреси"

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
#| msgid "Goto current address"
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "ЙтиДо поточної Адреси"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Відхилити зміни"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Відхилити всі зміни"

#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Відхилити зміни і відкрити проект"

#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Відхилити зміни і вийти"

#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Відхилити зміни, створити новий проект"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Виберіть один з елементів вище, щоб побачити різницю"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Помилка читання файлу: %s"

#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ігнорувати зміни на диску"

#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Перезавантажити з диска"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Деякі файли змінені на диску:"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Розрізняти регістр букв, наприклад, А і а"

#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr ""

#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr ""

#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr ""

#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Експорт ..."

#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr ""

#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Відкрити ..."

#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Збереження ..."

#: lazarusidestrconsts.lisdoesnotexists
#, fuzzy
#| msgid "%s does not exists: %s"
msgid "%s does not exist: %s"
msgstr "%s не існує: %s"

#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Не змінювати"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Не закривати проект"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "не компілювати залежності"

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Не показувати заставки"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Не показувати цей діалог для цього проекту"

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Не показувати це повідомлення знов"

#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Вниз"

#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Зниження"

#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Конфігурація Зниження"

#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "Ви все ще хочете створити новий проект?"

#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Ви все ще хочете відкрити інший проект?"

#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Ви все ще хочете вийти?"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Малювати лінії сітки"

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Копіювати вибрані компоненти в буфер"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Вирізати вибрані компоненти в буфер"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Пересунути на один компонент назад"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Пересунути на один компонент вперед"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Пересунути компонент в кінець"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Пересунути компонент наперед"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Вставити вибрані компоненти з буфера"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Виділити компонент-предок"

#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Дублікат"

#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr ""

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr "Знайдений дублікат значення %s%s%s."

#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr ""

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Дублювання назви: Компонет з назвою %s%s%s вже існує і в успадкованому компоненті %s"

#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Дубльовані ppu файли. Видаліть один або переконайтеся, що всі шляхи пошуку мають вірний порядок (Підказка: FPC спершу використовує останній шлях)."

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Шлях пошуку дублікату"

#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Дубльовані джерельні коди. Видаліть один або переконайтеся, що всі шляхи пошуку мають вірний порядок (Підказка: FPC спершу використовує останній шлях)."

#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Редагувати"

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Редагувати контекстну допомогу"

#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Змінити довідку"

#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr ""

#: lazarusidestrconsts.liseditorfiletypes
msgid "Editor file types"
msgstr "Файлові типи Редактора"

#: lazarusidestrconsts.liseditormacros
msgid "Editor macros"
msgstr ""

#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Завантажити схему"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Всі пакунки"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Поточний проект"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Всі проекти"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "встановити режим FPC в DELPHI"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "встановити режим FPC на FPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "встановити режим FPC в GPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "встановити режим FPC на MacPas"

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "встановити режим FPC в TP"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "ввімкнути IOCHECKS на"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "ввімкнути OVERFLOWCHECKS на"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "ввімкнути RANGECHECKS на"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "використовувати модуль HeapTrc"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "використовувати LineInfo"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Нормальний інструмент обов'язково має мати заголовок і назву файлу."

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Інструмент правки"

#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr "Сховати основну форму"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Ключ"

#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Макроси"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Параметри:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Назва файлу програми:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Пошук повідомлень компілятора FreePascal в виведенні"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Пошук повідомлень make в виведенні"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Необхідний заголовок і назва файлу"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Робоча тека:"

#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Всі"

#: lazarusidestrconsts.lisemdemptymethods
#, fuzzy
#| msgid "Emtpy Methods"
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Порожні Методи"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Знайдені порожні методи:"

#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Немає класу"

#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr "Немає класу в %s(%s,%s)"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Лише опублікований"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Публічний"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Опублікований"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Видалити методи"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Пошук в цих секціях класу:"

#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Неможливо показати порожні методи поточного класу, тому що%s%s"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Порожньо"

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Ввімкнути Все"

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Ввімкнути Всі в тому ж джерелі"

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Ввімкнути Точку Зупинки"

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Доступний"

#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr "Ввімкнути Групи"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Включити підтримку інтернаціоналізації та перекладів "

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Макрос доступний"

#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = replace whole identifier, Disable = replace prefix"
msgstr "Ввімк = замінити цілий ідентифікатор, Вимк = замінити префікс"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Задужкувати"

#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Вкласти в $IFDEF"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Кодування файлу %s%s%s%sна диску - %s. Нове кодування - %s."

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Кодування файлу %s%s%s%sна диску - %s. Нове кодування - %s."

#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr "Нескінченний цикл в макросі"

#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr ""

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Змінна оточення, ім'я як параметр"

#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr "Перейти від повідомл. до рядка коду подвійним клацанням(інакше: однинарним)"

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Теки не існує"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Некоректна назва файлу налагоджувача"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Файл налагоджувача \"%s\" не є виконуваним."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Теки проб \"%s\" не знайдено."

#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Направильна опція в позиції  %d: \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Опція в позиції %d на дозволяє використовувати аргумент %s"

#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Опція в позиції %d потребує аргумент %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Помилка: "

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Помилка створення файлу"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Помилка видалення файлу"

#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Помилка в %s"

#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Помилка в назві файлу компілятора:"

#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Помилка в власних параметрах компілятора (Інше):"

#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Linking / Pass options to linker):"
msgstr "Помилка в власних параметрах компонувальника (Компонування / Передати опції до компонувальника):"

#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Помилка в \"Доповненні шляху Налагоджувача\":"

#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Помилка в шляху пошуку для \"Включені файли\":"

#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Помилка в шляху пошуку для \"Бібліотеки\":"

#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Помилка в шляху пошуку для \"Об'єктні файли\":"

#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Помилка в шляху пошуку для \"Інші початкові коди\":"

#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Помилка в шляху пошуку для \"Інші файли модулів\":"

#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Помилка в \"вихідній теці модуля\":"

#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "ERROR: invalid build mode \"%s\""
msgstr "ПОМИЛКА: Невірний режим побудови \"%s\""

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Помилка завантаження файлу"

#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr "Помилка завантаження файлу \"%s\":%s%s"

#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Помилка завантаження %s з%s%s%s%s"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Помилка переміщення компонента"

#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Помилка переміщення компонента %s:%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Помилка при названні компоненту"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Помилка відкриття компоненту"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Помилка аналізу потоку lfm компонента"

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Помилка читання списку пакунків з файлу%s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Помилка читання XML"

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Помилка читання xml-файлу %s%s%s%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Помилка перейменування файлу"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Помилки"

#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Помилка збереження %s до%s%s%s%s"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Помилка задання назви компоненту %s на %s"

#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr "Помилка запису файлу \"%s\""

#: lazarusidestrconsts.liserrorwritingfile2
msgid "Error writing file %s"
msgstr ""

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Помилка запису списку пакунків в файл%s%s%s%s"

#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Змінити власні сканери (%s)"

#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "Оцінити вираз"

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "О&цінити"

#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr "&Оцінити/Змінити"

#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr "Очистити Події"

#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr "Параметри журналу подій ..."

#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr "Зберегти Події в Файл"

#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr "Додати Коментар ..."

#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr "Додати Коментар"

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number"
msgstr "Кожен n-ний номер рядка"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Файл прикладу:"

#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr "Зібрати всі вибрані"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Приклади:%sІдентифікатор%sTMyEnum.Enum%sНазвамодуля.Ідентифікатор%s#Назвапакунку.Назвамодуля.Ідентифікатор"

#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr "Відкрити перший вибраний"

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Повідомлення про виняток налагоджувача"

#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr "%s виключений під час виконання"

#: lazarusidestrconsts.lisexcludefilter
#| msgid "Exclude Filter"
msgid "Exclude filter"
msgstr "Фільтр для виключення"

#: lazarusidestrconsts.lisexecutable
msgid "Executable"
msgstr "Виконуваний"

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Виконати команду після"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Виконати команду до"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Виконання завершене"

#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Програми"

#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Вихід"

#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr "Розгорнути все (*)"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Розширити всі класи"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Розширити всі пакети"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Розширити всі модулі"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Повна назва файлу в поточному редакторі"

#: lazarusidestrconsts.lisexport
#, fuzzy
#| msgid "Export ..."
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Експорт ..."

#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Експортувати як HTML"

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Список експорту"

#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr "Експортувати список пакунків (*.xml)"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Вираз:"

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Розширити шлях до модулів?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Здобути"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Видобути Процедуру"

#: lazarusidestrconsts.lisexttoolexternaltools
#| msgid "External tools"
msgid "External Tools"
msgstr "Зовнішні Інстументи"

#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Не вдалося запустити інструмент"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Досягнуто максимуму інструментів"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Припускається максимум %s інструментів."

#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" завершено"

#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Не можу запустити інструмент %s%s%s:%s%s"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Не вдалось створити Пакет Програм для \"%s\""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Не вдалось завантажити стан згортки"

#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr ""

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Обмежити мал. дизайнера"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Малювати елементи дизайну тільки в паузах (зменшує навантаження на повільних машинах)"

#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Файл"

#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr ""

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Файл %s%s%s%sне схожий на текстовий.%sВсе одно відкрити?"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Файл %s%s%s%sне схожий на текстовий.%sВсе одно відкрити?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Розширення файлів програм"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Фільтр файлів"

#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Файлові фільтри"

#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Додати графу"

#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Видалити графу"

#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Вставити графу"

#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Файлова маска"

#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Задати типові"

#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Це фільтри файлів, які з'являться в усіх діалогах відкриття файлів"

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Файл %s%s%s змінено. Зберегти?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Файл не має проекту"

#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Файл є текою"

#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Файл не є виконуваним"

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "У файл не можна писати"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Файл є символьним посиланням"

#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Файл %s%s%s є віртуальним."

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Помилкове посилання на файл"

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Ім'я Файлу/Адреса"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Файл не знайдений"

#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Не знайдений файл %s%s%s."

#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr "файл %s не знайдено"

#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "файл не знайдено"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Не знайдений файл %s%s%s.%sСтворити його?%s"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Файл не в нижньому регістрі"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Не текстовий файл"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Параметри Файлу"

#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr ""

#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Всі знайдені файли вже мають вірне кодування ***"

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Файли в кодуванні ASCII або UTF-8"

#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr ""

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Файли не в кодуванні ASCII і не в UTF-8"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "файл, куди буде записуватись налагоджувальна інформація. Якщо не вказан., налагоджувальна інформація виводиться в консоль."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Фільтр"

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Фільтр: %s"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Набори Фільтрів"

#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr ""

#: lazarusidestrconsts.lisfindfiledirectory
msgid "D&irectory"
msgstr "Д&иректорія"

#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Параметри тек"

#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "&Маска файлів"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
#| msgid "Include sub directories"
msgid "Include &sub directories"
msgstr "Включити &підтеки"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Багаторядковий шаблон"

#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Тільки текстові файли"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "шукати в усіх файлах &проекту"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "шукати в усіх від&критих файлах"

#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr ""

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "шукати в &директоріях"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Де"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Знайти комбінацію клавіш"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Знайти втрачений модуль"

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Перший"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Виправити файл LFM"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Плаваюча Точка"

#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Фокусна підказка"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Розпочати зміну назв"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Форма"

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Помилка формату"

#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr "Знайдена версія %s, але очікувалась %s"

#: lazarusidestrconsts.lisfpccfgismissing
msgid "fpc.cfg is missing."
msgstr "fpc.cfg загубився."

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake провалився"

#: lazarusidestrconsts.lisfpcmessagefile
msgid "FPC message file"
msgstr "Файл повідомлень FPC"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr "Ресурси FPC"

#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Початкові коди FPC"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC надто старий"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Версія FPC: "

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Версія FPC (напр. 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"

#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "Помилка запису \"%s\"%s%s"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Синтаксична помилка FPDoc"

#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "Назва пакунку FPDoc:"

#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "Назва пакунку FPDoc. Типовим є назва файлу проекту."

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Є синтаксична помилка  в елементі fpdoc \"%s\":%s%s"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Фрейм"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "Пошук на&зад"

#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"

#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr ""

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Тека кодів Free Pascal"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Пошук в&перед"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Додаткові файли для пошуку (напр. /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Знайти або змінити назву ID"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Знайти посилання"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Ідентифікатор: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "у всіх відкритих пакунках і проектах"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "в поточному модулі"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "в головному проекті"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "в проекті/пакунку, що вміщує цей модуль"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Некоректний ідентифікатор"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Перейменувати всі посилання"

#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Перейменувати в"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Шукати також і в коментарях"

#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Шукати де"

#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Функція"

#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Загальне"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "взяти слово в поточній позиції"

#: lazarusidestrconsts.lisgotoline
#| msgid "Goto line"
msgid "Goto Line"
msgstr "ЙтиДо Рядка"

#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Перейти до виділеного рядка коду"

#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sЦей код є відкритим програмним забезпеченням; ви можете поширювати її та змінювати на умовах ліцензії GNU GPL v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation. %sЦей код поширюється поширюється з надією бути корисним БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, у тому числі не гарантується його придатність до певної мети. Докладнішу інформацію дивіться у ліцензії GNU GPL. %sКопія ліцензії може бути знайдена в Всесвітній Мережі за адресою <http://www.gnu.org/copyleft/gpl.html>. Ви також можете отримати її написавши листа до Free Software Foundation, Inc. за адресою 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA."

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Група"

#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr "Присвоїти до існуючої \"%s\" групи?"

#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr "До групи \"%s\" більше непризначено точок зупинки, видалити її?"

#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr "%sЄ ще %d порожніх груп, видалити всі?"

#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr "Назва групи не може бути порожня. Очистити груп(и) точок зупинки?"

#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr "Назва групи:"

#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr "Назва ГрупиТочокЗупинки має бути дійсним ім'ям ідентифікатора."

#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr "Задати нову групу ..."

#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr "Очистити груп(и)"

#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr "Ввімкнення або Вимкнення груп налагоджувального виводу. Варіанти:"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Зростання до Найбільшого"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Має Довідку"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Коментар заголовка для класу"

#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Довідка"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Розділи Довідки"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Селектор довідки"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Шістнадцяткове"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Довідка до повідомлень Компілятора Free Pascal"

#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr "Сховати повідомлення через директиву"

#: lazarusidestrconsts.lishint
msgid "Hint"
msgstr "Підказка"

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Порада: Типове значення може бути задане в умовних."

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Порада: Перевірте чи два пакунки містять модуль з одним іменем."

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Зберегти всі"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "На крок із входом"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Виконати до повернення результату функції"

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "На крок в обхід"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Довідка: функція Створити Рядок Ресурсів вимагає рядкової константи.%sВиберіть вираз і спробуйте спочатку."

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Довідка: функція Створити Рядок Ресурсів вимагає рядкової константи.%sВиберіть тільки рядковий вираз і спробуйте спочатку."

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Перемкнути форму/модуль"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Показувати форми"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Показувати модулі"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "К-сть влучень"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Бази даних"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Параметри довідки"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Властивості:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Переглядачі"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "HTML шлях до FPC документації"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Горизонтальний"

#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Параметри побудови IDE"

#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr ""

#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr ""

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Створюю Makefile для пакунку %s"

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Помилка: виконання утиліти 'компіл. після' не вдалось для пакету %s"

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Інформація про IDE"

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "УВАГА: невірна назва модуля %s, пакунок=%s"

#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "Макрос IDE"

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "Ідентифікатор"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Ідентифікатор починається з ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Ідентифікатор вміщує ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Параметри IDE:"

#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr ""

#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr ""

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Заголовок IDE починається з назви проекту"

#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Помилка доступу до xml"

#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Помилка доступу до xml-файлу %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Помилка завантаження xml"

#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Помилка завантаження xlm-файлу %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Експортований файл існує"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Експортований файл %s%s%s існує.%sВідкрити файл і замінити тільки налаштування компілятора?%s(Решта налаштувань буде збережена.)"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Завантажити з файла"

#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Відкрити або Завантажити Опції Компілятора"

#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Відкрити нещодавні"

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Недавні файли"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Зберегти в файл"

#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Зберегти в нещодавні"

#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%s%sFor example:%s"
msgstr "Якщо ви хочете використовувати дві різні версії Lazarus ви повинні запустити інший Lazarus з ком. параметром primary-config-path чи pcp.%s%sНаприклад:%s"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ігнорувати все"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ігнорувати і продовжити"

#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Ігнорувати двійкові"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ігнорувати цей тип винятків"

#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Ігнорувати, використовувати TForm як предка"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Наслідувати відступ поточного модуля, проекту або пакету"

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Коментар перед реалізацією класу"

#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr ""

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Список імпорту"

#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr "Імпортувати список пакунків (*.xml)"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Неможливо"

#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr "В джерельній теці пакунку \"%s\"."

#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "В теці початкових кодів проекту. Перевірте на дублікати."

#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr ""

#: lazarusidestrconsts.lisincludefilter
#| msgid "Include Filter"
msgid "Include filter"
msgstr "Фільтр для вибору"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "шлях доданих файлів"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Шляхи до під'єднуваних файлів"

#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr ""

#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr ""

#: lazarusidestrconsts.lisindentationforpascalsources
#, fuzzy
#| msgid "Indentation for pascal sources"
msgid "Indentation for Pascal sources"
msgstr "Відступи для поч. коду Паскаля"

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Індекс"

#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted ..."
msgstr "Перервано ..."

#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Компілювати Проект"

#: lazarusidestrconsts.lisinfobuildcompile
msgctxt "lazarusidestrconsts.lisinfobuildcompile"
msgid "Compiling ..."
msgstr "Компілюю ..."

#: lazarusidestrconsts.lisinfobuilderror
msgid "Error ..."
msgstr "Помилка ..."

#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Помилки:"

#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Підказки:"

#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Рядків"

#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Перервати"

#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Примітки:"

#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr "Проект:"

#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success ..."
msgstr "Успіх ..."

#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Попередження:"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Інформація"

#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Інформація про %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Інфо про виористаний FPC"

#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "В шляху пошуку модулів FPC. Ймовірно, встановлений пакет FPC. Переконайтеся в тому, компілятор і ppu файл з одного встановлення."

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Перед пов'язаними"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Успадкований Елемент"

#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr ""

#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Успадкований компонент проекту"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Для того, щоб створити чисту копію проекту/пакету, всі файли в даній теці будуть видалені і весь її вміст буде втрачено.%s%sВидалити всі файли в %s%s%s?"

#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Вставити"

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Вставити дату"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Вставити дату і час"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "Вставити дату і час. Можливо: форматування рядка"

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "Вставити дату. Можливо: форматування рядка"

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "вставити кінець якщо потрібно"

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Вставити макрос"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "Вставити ім'я поточної процедури"

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Вставити тег PrintShort"

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Вставити тег printshort"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "вставити заголовок процедури"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "вставити ім'я процедури"

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "вставити час"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr "Вставити час. Можливо: форматування рядка"

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Вставити тег url"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "В сесії"

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Перевірити"

#: lazarusidestrconsts.lisinspectclassinherit
msgid "%s : Class %s inherits from %s"
msgstr ""

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Дані"

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Інспектор Налагодження"

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Методи"

#: lazarusidestrconsts.lisinspectpointerto
msgid "Pointer to %s"
msgstr ""

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Властивості"

#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr ""

#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr ""

#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr ""

#: lazarusidestrconsts.lisinspectunavailable
msgid "%s : unavailable"
msgstr ""

#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr ""

#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr ""

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Встановлення не вдалося"

#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "Встановлено"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Встанови його, мені подобається жир"

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Встановити вибране"

#: lazarusidestrconsts.lisinstalluninstallpackages
#| msgid "Install/Uninstall packages"
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Встановлення/Видалення Пакунків"

#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr "Замість компілювання пакунку створити простий Makefile."

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Інтерактивний"

#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Неправильна команда"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Неприпустиме видалення"

#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Неприпустимий вираз:%s%s%s%s"

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Неправильний вираз.%sДовідка: функція \"Створити Рядок Ресурсів\" вимагає рядкової константи в одному файлі. Виділіть вираз і спробуйте ще."

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Невірний фільтр"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Неприпустимий рядок, стовпець в повідомленні%s%s"

#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
#, fuzzy
#| msgid "Invalid macro %s%s%s. The macro name must be a pascal identifier."
msgid "Invalid macro %s%s%s. The macro name must be a Pascal identifier."
msgstr "Недійсний макрос %s%s%s. Ім'я макроса має бути ідентифікатором."

#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Недійсна назва макроса \"%s\". Назва є ключевим словом."

#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Невірна маска"

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Невірний режим %s"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Неправильний множинний вибір"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Невірний (Викл)"

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Невірний (Вкл)"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Некоректний ідентифікатор паскаля"

#: lazarusidestrconsts.lisinvalidpascalidentifiertext
#, fuzzy
#| msgid "The name \"%s\" is not a valid pascal identifier."
msgid "The name \"%s\" is not a valid Pascal identifier."
msgstr "Слово \"%s\" є неправильним ідентифікатором мови паскаль."

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Неправильна назва проц."

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Неправильна назва файлу проекту"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Невірна Тека публікації"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Неправильне виділення"

#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr "невірна версія в %s"

#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s вже є частиною проекту."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s є некоректною назвою проекту.%s Виберіть іншу (напр., project1.lpi)"

#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s це %s.%sЦя кругова залежність не допускається."

#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "директорія не знайдена"

#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Питання"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr "Цікаво, як ви це зробили. Помилка в %s:"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Цікаво, як ви це зробили. Помилка в базовй теці:"

#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Історія Переходів"

#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Залишити"

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Залишити конвертовані файли відкритими в редакторі"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Всі файли проекту буде відкрито в редакторі після перетворення"

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Залишити в списку встановлення"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Залишати назву"

#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "Зберігати відносний відступ багаторядкового шаблону"

#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "Залишити відступи"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Залишити їх і продовжити"

#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Ключ"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Спеціальні команди"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Команди дизайнера"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Команди Інспектора об'єктів"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Клавіша (або двоклавішна комбінація)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Перервати побудову"

#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Додати Адресну Точку зупинки"

#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Додати Точку зупинки Коду"

#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Додати Дані/ТочкуОгляду"

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Додати спостереження"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Побудувати проект/програму"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Вибір схеми розкладки клавіатури"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Класичний"

#: lazarusidestrconsts.liskmcleanupcompiled
msgid "Clean up build files"
msgstr "Очистити файли побудови"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Закрити проект"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "CodeTools визначає редактор"

#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Компілювати проект/програму"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Налаштувати %sBuild File%s"

#: lazarusidestrconsts.liskmconfigurecustomcomponents
#| msgid "Configure custom components"
msgid "Configure Custom Components"
msgstr "Налаштувати нетипові компонети"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Чутліва до тексту допомога"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Перетворення пакунку Delphi в пакунок Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
#| msgid "Convert Delphi project to Lazarus project"
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Перетворення проекту Delphi в проект Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
#| msgid "Convert Delphi unit to Lazarus unit"
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Перетворення модуля Delphi в модуль Lazarus"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
#| msgid "Convert DFM file to LFM"
msgid "Convert DFM File to LFM"
msgstr "Перетворення файлу DFM в LFM"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Копіювати обрані Компоненти в буфер обміну"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Вирізати обрані Компоненти в буфер обміну"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Видалення останнього символу"

#: lazarusidestrconsts.liskmdiffeditorfiles
#| msgid "Diff editor files"
msgid "Diff Editor Files"
msgstr "Порівняти файли кодів"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Редагувати Коди Шаблонів"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Редагувати контекстно-чутливої Допомоги"

#: lazarusidestrconsts.liskmencloseselection
#| msgid "Enclose selection"
msgid "Enclose Selection"
msgstr "Задужкувати віділене"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Обчислити/Змінити"

#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr "Приклади Проектів"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Налаштування Зовнішніх інструментів"

#: lazarusidestrconsts.liskmfindincremental
#| msgid "Find incremental"
msgid "Find Incremental"
msgstr "Знайти за зростанням"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Перейти до маркера 0"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Перейти до маркера 1"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Перейти до маркера 2"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Перейти до маркера 3"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Перейти до маркера 4"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Перейти до маркера 5"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Перейти до маркера 6"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Перейти до маркера 7"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Перейти до маркера 8"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Перейти до маркера 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Перейти до редактора коду 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Перейти до редактора коду 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Перейти до редактора коду 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Перейти до редактора коду 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Перейти до редактора коду 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Перейти до редактора коду 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Перейти до редактора коду 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Перейти до редактора коду 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Перейти до редактора коду 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Перейти до редактора коду 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Вставити дату і час"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Вставити назву користувача"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Перевірити"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Схема розкладки клавіатури"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (типовий)"

#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Mac OS X (стиль Apple)"

#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Mac OS X (стиль Lazarus)"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Новий пакунок"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Новий проект"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Новий проект з файлу"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Новий Модуль"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Примітка: Всі ключі будуть встановлені підповідно до обраної схеми."

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Відкриття файлу пакунку"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Вставити Компоненти з буферу обміну"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Зупинити програму"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Опублікувати проект"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Швидке компілювання, без компонування"

#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Видалити Активний Файл з Проекту"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Виконати програму"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "ЗберегтиВсе"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "ЗберегтиЯк"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Зберегти проект"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Зберегти проект як"

#: lazarusidestrconsts.liskmselectlineend
#| msgid "Select line end"
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Виділити кінець рядка"

#: lazarusidestrconsts.liskmselectlinestart
#| msgid "Select line start"
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Виділити початок рядка"

#: lazarusidestrconsts.liskmselectpagebottom
#| msgid "Select page bottom"
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Виділити низ сторінки"

#: lazarusidestrconsts.liskmselectpagetop
#| msgid "Select page top"
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Виділити верх сторінки"

#: lazarusidestrconsts.liskmselectwordleft
#| msgid "Select word left"
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Виділити слово зліва"

#: lazarusidestrconsts.liskmselectwordright
#| msgid "Select word right"
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Виділити слово справа"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Встановити Закладку на дереві"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Встановити маркер 0"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Встановити маркер 1"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Встановити маркер 2"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Встановити маркер 3"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Встановити маркер 4"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Встановити маркер 5"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Встановити маркер 6"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Встановити маркер 7"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Встановити маркер 8"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Встановити маркер 9"

#: lazarusidestrconsts.liskmstopprogram
#| msgid "Stop program"
msgid "Stop Program"
msgstr "Завершити програму"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Перемкнути між модулем і формою"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "Перемкнути маркер 0"

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "Перемкнути маркер 1"

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "Перемкнути маркер 2"

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "Перемкнути маркер 3"

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "Перемкнути маркер 4"

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "Перемкнути маркер 5"

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "Перемкнути маркер 6"

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "Перемкнути маркер 7"

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "Перемкнути маркер 8"

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "Перемкнути маркер 9"

#: lazarusidestrconsts.liskmtoggleviewassembler
#| msgid "Toggle view Assembler"
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Переглянути Асемблер"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
#| msgid "Toggle view Breakpoints"
msgid "View Breakpoints"
msgstr "Переглянути Точки Зупинки"

#: lazarusidestrconsts.liskmtoggleviewcallstack
#| msgid "Toggle view Call Stack"
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Показати стек викликів"

#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Перемкнути до перегляду Коду Explorer"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
#| msgid "Toggle view component palette"
msgid "Toggle View Component Palette"
msgstr "Перемкнути до перегляду палітри компонетів"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
#| msgid "Toggle view Debuger Event Log"
msgid "View Debuger Event Log"
msgstr "Переглянути Журнал подій налагоджувача"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
#| msgid "Toggle view Debugger Output"
msgid "View Debugger Output"
msgstr "Переглянути Повідомлення Налагоджувача"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Перемкнути до перегляду Документації Редактора"

#: lazarusidestrconsts.liskmtoggleviewhistory
#| msgid "Toggle view History"
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Переглянути Історію"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Перемкнути до перегляду гарячих клавіш графічної оболонки"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
#| msgid "Toggle view Local Variables"
msgid "View Local Variables"
msgstr "Перегляд локальних змінних"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Перемкнути до перегляду Повідомлень"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Перемкнути до перегляду Інспектора Об'єктів"

#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
#| msgid "Toggle view Terminal Output"
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Terminal Output"
msgstr "Дивитись Вивід Терміалу"

#: lazarusidestrconsts.liskmtoggleviewregisters
#| msgid "Toggle view Registers"
msgid "View Registers"
msgstr "Переглянути Регістри"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Перемкнути до перегляду Результатів Пошуку"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Перемкнути до перегляду Редактора програмного Коду"

#: lazarusidestrconsts.liskmtoggleviewthreads
#| msgid "Toggle view Threads"
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Переглянути Потоки"

#: lazarusidestrconsts.liskmtoggleviewwatches
#| msgid "Toggle view Watches"
msgid "View Watches"
msgstr "Показувати спостереження"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Переглянути історію переходів"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Переглядання опцій проекту"

#: lazarusidestrconsts.liskmviewprojectsource
#| msgid "View project source"
msgid "View Project Source"
msgstr "Переглядання тексту проекту"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Переглянути Інформацію про Модулі"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Виконувана програма є неправильною"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Командний рядок виконуваної програми"

#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Налаштування стільниці Lazarus"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Тека Lazarus"

#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "тека, буде використана як базова"

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"

#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus file"
msgstr "Файл Lazarus"

#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Форма Lazarus"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Графічна оболонка Lazarus"

#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Lazarus-файли, що включаються"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Мова графічної оболонки Lazarus (напр. en, uk, de, br, fi)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Назва мови для Lazarus (напр. english, deutsch, ukrainain)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [параметри] <назва файлу проекту>"

#: lazarusidestrconsts.lislazarusotherfile
msgid "Lazarus other file"
msgstr "Інші файли Lazarus"

#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Пакунок Lazarus"

#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Проект Lazarus"

#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Файл Info проекту Lazarus"

#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Текст проекту Lazarus"

#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Модуль Lazarus"

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Дія"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Виберіть вихідний каталог виконуваного файлу IDE"

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Ви точно хочете видалити цей профіль побудови?"

#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Зібрати Багато"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Загальні Налаштування"

#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Підтвердити перед побудовою"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Підтвердіть видалення"

#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "Налагодження IDE"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Визначення"

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Визначення без -d"

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Редагувати Визначення"

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Редагувати список визначень, які можуть бути використані будь-яким профілем"

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Помилка запису файлу"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild не інтерактивний, зупиняю зараз."

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Керування профілями збирання"

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Керування профілями"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Назва активного профілю"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Додати Новий Профіль"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Поточні параметри збирання будуть пов'язані з:"

#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "Звичайний IDE"

#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "Оптимізований IDE"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Параметри:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Опції, передані компілятору"

#: lazarusidestrconsts.lislazbuildprofile
#| msgid "Profile to Build"
msgid "Profile to build"
msgstr "Профіль для побудови"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Перейменувати Профіль"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Нове ім'я для профілю:"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Перезапустити після побудови IDE"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Перезапустити Lazarus автоматично після побудови IDE (не впливає на побудову інших частин)"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Виберіть профілі для побудови"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Показати діалог підтвердження при збиранні безпосередньо з меню Інструментів"

#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr ""

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Для ЦП"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Цільова тека:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Для ОС:"

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Неможливо записати файл \"%s\":%s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Оновити revision.inc"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Оновити дані про ревізію в діалозі \"Про Lazarus\""

#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Очистити + Побудувати все"

#: lazarusidestrconsts.lislclwidgettype
#| msgid "LCL Widget Type"
msgid "LCL widget type"
msgstr "Тип LCL widget"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Додати посилання до нащадка"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Копіювати з усадкованого"

#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s не має діючого шляху FPDoc.%sНе можу створити fpdoc файл для %s"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Пересунути включення до успадкованого"

#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Немає дійсного шляху FPDoc"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Модуль %s не належить жодному пакунку чи проекту.%sДодайте модуль до пакету або проекту.%sНеможливо створити fpdoc файл."

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Ліворуч"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Лівий бордюр. Це значення додається до базового бордюру і використовується для відступу зліва від контролю."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ліве якорювання"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Це список контролів одного рівня для якого ліва сторона зафіксована. Залишити порожнім для батьківського."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Ліві сторони"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Лівий простір еквівалентно"

#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Менше"

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Рівні"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM файл"

#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr ""

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Зламався файл LFM"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM справний"

#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sЦя бібліотека є відкритим програмним забезпеченням; ви можете поширювати її та змінювати на умовах ліцензії GNU Library General Public License v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation. %sЦя програма поширюється поширюється з надією бути корисною БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, у тому числі не гарантується його придатність до певної мети. Докладнішу інформацію дивіться у ліцензії GNU LGPL. %sВи повинні були отримати копію ліцензії GNU LGPL разом з бібліотекою; якщо ви її не отримали, напишіть листа до Free Software Foundation, Inc. за адресою 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "шлях до бібліотек"

#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr ""

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Рядок:"

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Рядок/Довжина"

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Посилання:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "параметри компонувальника"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Ціль посилання"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "список всіх значень case"

#: lazarusidestrconsts.lisloadedsuccessfully
msgid "Loaded successfully"
msgstr "Завантажено успішно"

#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Завантаження %s провалилось."

#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr ""

#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "Локальні"

#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr "&Копіювати Ім'я"

#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr "Ко&піювати Значення"

#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr "Локальні не оцінені"

#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr "Стек викликів Логу"

#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr "(межа кадрів. 0 - необмежено)"

#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "Оцінити вираз"

#: lazarusidestrconsts.lislogmessage
msgid "Log Message"
msgstr "Повідомлення журналу"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "рядок в нижньому регістрі"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "МАЛИЙ рядок поданий як параметр"

#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr ""

#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr ""

#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr "Заголовочні файли lrs"

#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "Mac Pascal"

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Макрос %s"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Введіть дані"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Введіть параметри запуску"

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
#| msgid "Main Unit has Application.CreateForm statements"
msgid "Main unit has Application.CreateForm statements"
msgstr "Головний модуль має програму.Оператори CreateForm"

#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
#| msgid "Main Unit has Application.Title statements"
msgid "Main unit has Application.Title statements"
msgstr "Головний модуль має програму.Заголовні оператори"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
#| msgid "Main Unit has Uses Section containing all Units of project"
msgid "Main unit has Uses section containing all units of project"
msgstr "Головний модуль має секцію Uses, що вміщує всі модулі проекту"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "Основний модуль в кодах Паскаля"

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Створити виконуваний"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make не знайдений"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Створити рядок ресурсу"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Додати до розділу"

#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Рядок ресурсів %s%s%s вже існує. %sВиберіть іншу назву. %s Використовуйте Пропуск, щоб додати в будь-якому випадку."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Параметри перетворення"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Спеціальний індентифікатор"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Ідентифікатор"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Довжина ідентифікатора:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Префікс ідентифікатора:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Вставити за алфавітом"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Вставити з врахуванням контексту"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Неправильна секція Resourcestring"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Виберіть секцію рядки ресурсів зі списку."

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Рядок ресурсів вже існує"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Секція Resourcestring:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Переглядання коду"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Рядкова константа в коді"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Рядки з тим же значенням:"

#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr ""

#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Макс %d"

#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr "%s Може вам треба перезібрати пакунок."

#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "Дія"

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Дамп Пам'яті"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Перервати збирання"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Про FPC"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Додати &точку зупинки"

#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Додати Активний Файл до Пакунку ..."

#: lazarusidestrconsts.lismenuaddjumppointtohistory
#| msgid "Add jump point to history"
msgid "Add Jump Point to History"
msgstr "Додати точку переходу до Історії"

#: lazarusidestrconsts.lismenuaddtoproject
#| msgid "Add editor file to Project"
msgid "Add Editor File to Project"
msgstr "Додати файл редактора до Проекту"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Додати &спостереження..."

#: lazarusidestrconsts.lismenubeaklinesinselection
#| msgid "Break Lines in selection"
msgid "Break Lines in Selection"
msgstr "Розбивати Рядки в виділенні"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Побудувати файл"

#: lazarusidestrconsts.lismenubuildlazarus
#| msgid "Build Lazarus with current profile"
msgid "Build Lazarus with Current Profile"
msgstr "Побудувати Lazarus з поточним профілем"

#: lazarusidestrconsts.lismenubuildlazarusprof
#| msgid "Build Lazarus with profile: %s"
msgid "Build Lazarus with Profile: %s"
msgstr "Побудувати Lazarus з профілем: %s"

#: lazarusidestrconsts.lismenuchecklfm
#| msgid "Check LFM file in editor"
msgid "Check LFM File in Editor"
msgstr "Перевірити файл LFM в Редакторі"

#: lazarusidestrconsts.lismenucleandirectory
#| msgid "Clean directory ..."
msgid "Clean Directory ..."
msgstr "Очистити теку ..."

#: lazarusidestrconsts.lismenucleanupcompiled
#| msgid "Clean up build files ..."
msgid "Clean up Build Files ..."
msgstr "Очистити файли побудови ..."

#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close A&ll Editor Files"
msgid "Close A&ll"
msgstr "Закрити В&сі файли Редактора"

#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr ""

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Закрити Проект"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
#| msgid "CodeTools defines editor ..."
msgid "CodeTools Defines Editor ..."
msgstr "Редактор визначень CodeTools ..."

#: lazarusidestrconsts.lismenucommentselection
#| msgid "Comment selection"
msgid "Comment Selection"
msgstr "Вибір Коментаря"

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Завершити код"

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Налаштувати Побудову+Виконання Файлу ..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
#| msgid "Configure custom components ..."
msgid "Configure Custom Components ..."
msgstr "Налаштувати користувацькі компоненти ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
#| msgid "Configure external tools ..."
msgid "Configure External Tools ..."
msgstr "Налаштувати зовнішні інструменти ..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Налаштувати \"Побудову Lazarus\" ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Довідка, що залежить від контексту"

#: lazarusidestrconsts.lismenuconvertdelphipackage
#| msgid "Convert Delphi package to Lazarus package ..."
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Перетворення пакунку Delphi в пакунок Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
#| msgid "Convert Delphi project to Lazarus project ..."
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Перетворення проекту Delphi в проект Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
#| msgid "Convert Delphi unit to Lazarus unit ..."
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Перетворення модуля Delphi в модуль Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
#| msgid "Convert binary DFM to text LFM + check syntax ..."
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "Перетворити двійковий DFM в текстовий LFM + перевірка синтаксису ..."

#: lazarusidestrconsts.lismenuconvertencoding
#| msgid "Convert encoding of projects/packages ..."
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Конвертувати кодування проектів/пакунків ..."

#: lazarusidestrconsts.lismenudebugwindows
#| msgid "Debug windows"
msgid "Debug Windows"
msgstr "Вікна налагодження"

#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff ..."
msgstr "Порівняти ..."

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Правка"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Кодові шаблони ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Редагувати контекстно-чутливої Допомоги"

#: lazarusidestrconsts.lismenueditinstallpkgs
#| msgid "Install/Uninstall packages ..."
msgid "Install/Uninstall Packages ..."
msgstr "Встановити/Видалити пакунки ..."

#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor ..."
msgstr "Редактор Меню ..."

#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Створити підменю"

#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template ..."
msgstr "Видалити з шаблону ..."

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Вилучити елемент"

#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Обробляти подію OnClick "

#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template ..."
msgstr "Вставити з шаблону ..."

#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Вставити новий пункт (після)"

#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Вставити новий пункт (перед)"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Редактор меню"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Пересунути вниз (або вправо)"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Пересунути вгору (або вліво)"

#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description ..."
msgstr "Новий опис шаблону ..."

#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template ..."
msgstr "Зберегти як шаблон ..."

#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Вибрати меню:"

#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Вибрати шаблон:"

#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Переглядання шаблону"

#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Вкласти в $IFDEF ..."

#: lazarusidestrconsts.lismenuencloseselection
#| msgid "Enclose selection ..."
msgid "Enclose Selection ..."
msgstr "Задужкувати виділення ..."

#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "Об&числити/Змінити..."

#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr "Приклади Проектів ..."

#: lazarusidestrconsts.lismenuextractproc
#| msgid "Extract procedure ..."
msgid "Extract Procedure ..."
msgstr "Витягнути Процедуру ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Файл"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Знайти"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Знайти ..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
#| msgid "Find other end of code block"
msgid "Find Other End of Code Block"
msgstr "Знайти інший кінець блоку коду"

#: lazarusidestrconsts.lismenufindcodeblockstart
#| msgid "Find code block start"
msgid "Find Start of Code Block"
msgstr "Знайти початок блоку коду"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
#| msgid "Find Declaration at cursor"
msgid "Find Declaration at Cursor"
msgstr "Знайти опис під курсором"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Знайти посилання на ідентифікатор ..."

#: lazarusidestrconsts.lismenufindinfiles
#| msgid "Find &in files ..."
msgid "Find &in Files ..."
msgstr "&Пошук у файлах ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Шукати &далі"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Знайти &попередній"

#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr ""

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Параметри ..."

#: lazarusidestrconsts.lismenugotoincludedirective
#| msgid "Goto include directive"
msgid "Goto Include Directive"
msgstr "Перейти за директивою Include"

#: lazarusidestrconsts.lismenugotoline
#| msgid "Goto line ..."
msgid "Goto Line ..."
msgstr "Перейти до рядка ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
#| msgid "Guess misplaced IFDEF/ENDIF"
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Вгадати невідповідність IFDEF/ENDIF"

#: lazarusidestrconsts.lismenuguessunclosedblock
#| msgid "Guess unclosed block"
msgid "Guess Unclosed Block"
msgstr "Вгадати незакінчений блок"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Довідка"

#: lazarusidestrconsts.lismenuideinternals
#| msgid "IDE internals"
msgid "IDE Internals"
msgstr "Нутрощі IDE"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Пошук за зростанням"

#: lazarusidestrconsts.lismenuindentselection
#| msgid "Indent selection"
msgid "Indent Selection"
msgstr "Зсунути виділене"

#: lazarusidestrconsts.lismenuinsertchangelogentry
#| msgid "ChangeLog entry"
msgid "ChangeLog Entry"
msgstr "Елемент ChangeLog"

#: lazarusidestrconsts.lismenuinsertcharacter
#| msgid "Insert from Character Map"
msgid "Insert from Character Map ..."
msgstr "Вставити з Таблиці Символів ..."

#: lazarusidestrconsts.lismenuinsertcvskeyword
#| msgid "Insert CVS keyword"
msgid "Insert CVS Keyword"
msgstr "Вставити Ключ CVS"

#: lazarusidestrconsts.lismenuinsertdatetime
#| msgid "Current date and time"
msgid "Current Date and Time"
msgstr "Поточні дата і час"

#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Вставити Повне Ім'я Файлу ..."

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Вставити Загальні"

#: lazarusidestrconsts.lismenuinsertgplnotice
#| msgid "GPL notice"
msgid "GPL Notice"
msgstr "Примітки GPL"

#: lazarusidestrconsts.lismenuinsertlgplnotice
#| msgid "LGPL notice"
msgid "LGPL Notice"
msgstr "Примітки LGPL"

#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr ""

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Нотатки Зміненої LGPL "

#: lazarusidestrconsts.lismenuinsertusername
#| msgid "Current username"
msgid "Current Username"
msgstr "Поточне ім'я користувача"

#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "&Слідкувати за ..."

#: lazarusidestrconsts.lismenujumpback
#| msgid "Jump back"
msgid "Jump Back"
msgstr "Перейти назад"

#: lazarusidestrconsts.lismenujumpforward
#| msgid "Jump forward"
msgid "Jump Forward"
msgstr "Перейти вперед"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Перейти до"

#: lazarusidestrconsts.lismenujumptoimplementation
#| msgid "Jump to implementation"
msgid "Jump to Implementation"
msgstr "Перейти до реалізації"

#: lazarusidestrconsts.lismenujumptonextbookmark
#| msgid "Jump to next bookmark"
msgid "Jump to Next Bookmark"
msgstr "Перейти до наст. Закладки"

#: lazarusidestrconsts.lismenujumptonexterror
#| msgid "Jump to next error"
msgid "Jump to Next Error"
msgstr "Перехід до наст. помилки"

#: lazarusidestrconsts.lismenujumptoprevbookmark
#| msgid "Jump to previous bookmark"
msgid "Jump to Previous Bookmark"
msgstr "Перейти до попер. Закладки"

#: lazarusidestrconsts.lismenujumptopreverror
#| msgid "Jump to previous error"
msgid "Jump to Previous Error"
msgstr "Перейти до попер. помилки"

#: lazarusidestrconsts.lismenulowercaseselection
#| msgid "Lowercase selection"
msgid "Lowercase Selection"
msgstr "Вибір в нижньому регістрі"

#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr ""

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Створити рядок ресурсу ..."

#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Новий компонент"

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Нова форма"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Новий..."

#: lazarusidestrconsts.lismenunewpackage
#| msgid "New package ..."
msgid "New Package ..."
msgstr "Новий Пакунок ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Новий проект ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
#| msgid "New Project from file ..."
msgid "New Project from File ..."
msgstr "Новий Проект з файлу ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Новий модуль"

#: lazarusidestrconsts.lismenuok
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&Гаразд"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Мережева довідка"

#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Відкрити ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
#| msgid "Open filename at cursor"
msgid "Open Filename at Cursor"
msgstr "Відкрити назву файлу над курсором"

#: lazarusidestrconsts.lismenuopenpackage
#| msgid "Open loaded package ..."
msgid "Open Loaded Package ..."
msgstr "Відкрити завантажений пакунок ..."

#: lazarusidestrconsts.lismenuopenpackagefile
#| msgid "Open package file (.lpk) ..."
msgid "Open Package File (.lpk) ..."
msgstr "Відкрити файл пакунку (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
#| msgid "Open package of current unit"
msgid "Open Package of Current Unit"
msgstr "Відкрити пакунок поточного модуля"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Відкрити проект ..."

#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Відкрити Не&щодавні"

#: lazarusidestrconsts.lismenuopenrecentpkg
#| msgid "Open recent package"
msgid "Open Recent Package"
msgstr "Відкрити Недавній Пакунок"

#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Відкрити Останній Проект"

#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "Па&кунок"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Графік Пакунків"

#: lazarusidestrconsts.lismenupackagelinks
#| msgid "Package links ..."
msgid "Package Links ..."
msgstr "Зв'язки пакунку ..."

#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Новий компонент пакунку"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Процедура List ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Проект"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Інспектор проекту"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Параметри проекту ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Вико&нати"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Опублікувати проект ..."

#: lazarusidestrconsts.lismenuquickcompile
#| msgid "Quick compile"
msgid "Quick Compile"
msgstr "Швидка компіляція"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
#| msgid "Quick syntax check"
msgid "Quick Syntax Check"
msgstr "Швидка перевірка синтаксису"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Швидка перевірка синтаксису OK"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Прибрати з проекту ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Перейменувати ID ..."

#: lazarusidestrconsts.lismenureportingbug
#| msgid "Reporting a bug"
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Повідомити про баг"

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
#| msgid "Rescan FPC source directory"
msgid "Rescan FPC Source Directory"
msgstr "Переглянути теку кодів FPC"

#: lazarusidestrconsts.lismenuresetdebugger
#| msgid "Reset debugger"
msgid "Reset Debugger"
msgstr "Скидання налагоджувача"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Зворотній експорт"

#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Виконати"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Виконати файл"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "Пара&метри виконання ..."

#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Run to &Cursor"
msgid "Step over to &Cursor"
msgstr "Виконати до &курсора"

#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Зберегти"

#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Зберегти &Як ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Зберегти проект"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Зберегти проект як ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "П&ошук"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Виділити"

#: lazarusidestrconsts.lismenuselectall
#| msgid "Select all"
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Виділити все"

#: lazarusidestrconsts.lismenuselectcodeblock
#| msgid "Select code block"
msgid "Select Code Block"
msgstr "Виділити блок коду"

#: lazarusidestrconsts.lismenuselectline
#| msgid "Select line"
msgid "Select Line"
msgstr "Виділити рядок"

#: lazarusidestrconsts.lismenuselectparagraph
#| msgid "Select paragraph"
msgid "Select Paragraph"
msgstr "Виділити абзац"

#: lazarusidestrconsts.lismenuselecttobrace
#| msgid "Select to brace"
msgid "Select to Brace"
msgstr "Виділити до дужки"

#: lazarusidestrconsts.lismenuselectword
#| msgid "Select word"
msgid "Select Word"
msgstr "Виділити слово"

#: lazarusidestrconsts.lismenusetfreebookmark
#| msgid "Set a free bookmark"
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Встановити вільну закладку"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "По&казати Точку Виконання"

#: lazarusidestrconsts.lismenusortselection
#| msgid "Sort selection ..."
msgid "Sort Selection ..."
msgstr "Сортування вибраного ..."

#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "По&чатковий Код"

#: lazarusidestrconsts.lismenustepinto
#| msgid "Step in&to"
msgid "Step In&to"
msgstr "Вс&тупити"

#: lazarusidestrconsts.lismenustepintocontext
#| msgid "Step into (Context)"
msgid "Step Into (Context)"
msgstr "Вступити (Контекст)"

#: lazarusidestrconsts.lismenustepintoinstr
#| msgid "Step into instruction"
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "Вступити в Інструкцію"

#: lazarusidestrconsts.lismenustepintoinstrhint
#| msgid "Step into instruction"
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "Вступити в Інструкцію"

#: lazarusidestrconsts.lismenustepout
#| msgid "Step o&ut"
msgid "Step O&ut"
msgstr "Пове&рнутись"

#: lazarusidestrconsts.lismenustepover
#| msgid "&Step over"
msgid "&Step Over"
msgstr "&Переступити"

#: lazarusidestrconsts.lismenustepovercontext
#| msgid "Step over (Context)"
msgid "Step Over (Context)"
msgstr "Переступити (Контекст)"

#: lazarusidestrconsts.lismenustepoverinstr
#| msgid "Step over instruction"
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "Переступити Інструкцію"

#: lazarusidestrconsts.lismenustepoverinstrhint
#| msgid "Step over instruction"
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "Переступити Інструкцію"

#: lazarusidestrconsts.lismenuswapcaseselection
#| msgid "Swap case in selection"
msgid "Swap Case in Selection"
msgstr "Перемкнути регістр в виділенні"

#: lazarusidestrconsts.lismenutabstospacesselection
#| msgid "Tabs to spaces in selection"
msgid "Tabs to Spaces in Selection"
msgstr "Табуляція в пробіли в виділенні"

#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Про"

#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Зміст"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Стандартне меню Правка"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Стандартне меню Файл"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Стандартне меню Довідка"

#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Знайти"

#: lazarusidestrconsts.lismenutemplatefindnext
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
msgid "Find Next"
msgstr "Шукати далі"

#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Відкрити нещодавні"

#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Посібник"

#: lazarusidestrconsts.lismenutogglecomment
#| msgid "Toggle comment"
msgid "Toggle Comment in Selection"
msgstr "Перемкнути коментар в виборі"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Інструменти"

#: lazarusidestrconsts.lismenuuncommentselection
#| msgid "Uncomment selection"
msgid "Uncomment Selection"
msgstr "Розкоментувати виділення"

#: lazarusidestrconsts.lismenuunindentselection
#| msgid "Unindent selection"
msgid "Unindent Selection"
msgstr "Скасувати зсув виділення"

#: lazarusidestrconsts.lismenuuppercaseselection
#| msgid "Uppercase selection"
msgid "Uppercase Selection"
msgstr "Верхний регістр виділення"

#: lazarusidestrconsts.lismenuuseunit
#| msgid "Add unit to uses section ..."
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Додати модуль в секцію Uses ..."

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Вигляд"

#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Редактор прив'язок"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Асемблер"

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Точки зупину"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Стек викликів"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Браузер Коду"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Оглядач коду"

#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Палітра Компонентів"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Компоненти"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Лог-файл подій"

#: lazarusidestrconsts.lismenuviewdebugoutput
#| msgid "Debug output"
msgid "Debug Output"
msgstr "Повідомлення налагоджувача"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Форми ..."

#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Історія"

#: lazarusidestrconsts.lismenuviewidespeedbuttons
#| msgid "IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE Speed Buttons"
msgstr "Швидкі клавіші IDE"

#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Історії переходів"

#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Місцеві змінні"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Повідомлення"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Інспектор Об'єктів"

#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "&Дивитись Код Проекту"

#: lazarusidestrconsts.lismenuviewpseudoterminal
msgid "Terminal Output"
msgstr "Вивід Терміналу"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Регістри"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Оглядач Обмежень"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Результати пошуку"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Редактор тексту"

#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Порядок Вкладок"

#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Потоки"

#: lazarusidestrconsts.lismenuviewtoggleformunit
#| msgid "Toggle form/unit view"
msgid "Toggle Form/Unit View"
msgstr "Перемкнути форму/модуль"

#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "Unit Dependencies ..."
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Залежності модулів ..."

#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Інформація про модуль..."

#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Модулі..."

#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Вікно спостережень"

#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Що потребує збирання"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Вікно"

#: lazarusidestrconsts.lismeother
#| msgid "Other"
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Інші таби"

#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr "Проекти"

#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr "Повідомлення не містить даних про позицію файлу:%s%s"

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Редактор Повідомлень"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Клас методу не знайдено"

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Пропущені Події"

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Відсутні ідентифікатори"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Пропущені пакунки"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Ваш вибір:"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Закоментувати"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Лише для Delphi"

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Закоментувати вибрані модулі."

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Використовувати модулі лише для Delphi."

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Шукати модулі. Знайдені шляхи додати до параметрів проекту."

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Перервати зараз, встановити пакунки або виправити шляхи і спробувати знов."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Шлях Пошуку Модуля"

#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr "Пропустити цей Модуль"

#: lazarusidestrconsts.lismitnotice
msgid "<description>%sCopyright (c) <year> <copyright holders>%sPermission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:%sThe above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.%sTHE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""

#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr ""

#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr ""

#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr ""

#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr ""

#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr ""

#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr ""

#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr ""

#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr ""

#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr ""

#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr ""

#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr ""

#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr ""

#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr ""

#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr ""

#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
msgid "expected \":=\" after macro name, but found \"%s\""
msgstr ""

#: lazarusidestrconsts.lismmexpectedmacronamebutfound
msgid "expected macro name, but found \"%s\""
msgstr ""

#: lazarusidestrconsts.lismmfromto
msgid "From %s to %s"
msgstr ""

#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr ""

#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr ""

#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr ""

#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr ""

#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr ""

#: lazarusidestrconsts.lismmmoveselecteditemdown
msgid "Move selected item down"
msgstr ""

#: lazarusidestrconsts.lismmmoveselecteditemup
msgid "Move selected item up"
msgstr ""

#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr ""

#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr ""

#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr ""

#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr ""

#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr ""

#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr ""

#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr ""

#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr ""

#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr ""

#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr ""

#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr ""

#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr ""

#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr ""

#: lazarusidestrconsts.lismmwas
msgid "(was \"%s\")"
msgstr ""

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sЦя бібліотека є відкритим програмним забезпеченням; ви можете поширювати її та змінювати на умовах ліцензії GNU Library General Public License v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation з наступними змінами: %sЯк спеціальне виключення, власники авторських прав на цю бібліотеку дають вам дозвіл компонувати цю бібліотеку з незалежними модулями для створення виконуваних файлів, незалежно від умов ліцензії цих незалежних модулів, а також копіювати і поширювати отриманий виконуваний файл відповідно до умов на ваш вибір, за умови, що ви виконаєте для кожного пов'язаного незалежного модуля умови ліцензії цього модуля. Незалежний модуль це модуль, який не отриманий з або на основі цієї бібліотеки. Якщо ви зміните цю бібліотеку, ви можете розширити цей виняток для вашої версії бібліотеки, але ви не зобов'язані це робити. Якщо ви не хочете це робити, видаліть цей виняток з вашої версії.%sЦей код поширюється поширюється з надією бути корисним БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, у тому числі не гарантується його придатність до певної мети. Докладнішу інформацію дивіться у ліцензії GNU LGPL. %sВи повинні були отримати копію ліцензії GNU LGPL з цією бібліотекою; якщо ви її не отримали, напишіть листа до Free Software Foundation, Inc. за адресою 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA."

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Змінити"

#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Більше"

#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More >>"
msgstr "Більше >>"

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Перемістити \"%s\" на позицію вниз"

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Перемістити \"%s\" на позицію вверх"

#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Перемістити Сторінку"

#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Змістити вибраний ел-т вниз (Ctrl+Down)"

#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Змістити вибраний ел-т вверх (Ctrl+Up)"

#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr ""

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(мс)"

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Зберегти повідомлення в файл (*.txt)"

#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Назва"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Конфлікт імені"

#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr ""

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Назва нової процедури"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Ніколи"

#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Новий"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Новий клас"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Нова консольна програма"

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Створити новий файл редактора.%s Виберіть тип."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Створити новий порожній текстовий файл."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Створити новий проект.%sВиберіть тип."

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Створити новий стандартний пакунок%sПакунок - це набір модулів і компонентів."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Створити новий модуль з модулем даних."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Створити новий модуль з фреймом."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Створити новий модуль з формою LCL."

#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Успадкувати з форми або компоненту проекту"

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Не вибрано пункту"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Виберіть спочатку елемент"

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Нове кодування:"

#: lazarusidestrconsts.lisnewmacroname
msgid "Macro %d"
msgstr ""

#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr ""

#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(новий проект)"

#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr ""

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
#| msgid "New units are added to uses sections:"
msgid "New units are added to uses sections"
msgstr "Нові модулі додаються в секцію uses"

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Ні"

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Немає резервних файлів"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Профілів збирання не вибрано."

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Без змін"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Не вибрано коду"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Не успадковані параметри компілятора"

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "підказок немає"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Вікно IDE не вибране"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Файл LFM відсутній"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Макрос не вибраний"

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "без назви"

#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%sжоден"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "жоден, клацніть щоб вибрати"

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "не вибрано вузлів"

#: lazarusidestrconsts.lisnopascalfile
#, fuzzy
#| msgid "No pascal file"
msgid "No Pascal file"
msgstr "Файл Паскаля відсутній"

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Файл програми %s%s%s не знайдено."

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Не знайдено розділу в ResourceString"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Як правило фільтр є регулярним виразом. В простому синтаксисі a . є нормальним символом, a *  відповідає за все, a ?  відповідає за будь-який символ, а кома і крапка з комою відділяють альтернативи. Наприклад, простий синтаксис *.pas;*.pp переписується на ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Не знайдено рядка з константами"

#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "Не пакунок расу розробки"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Не встановлювальний пакунок"

#: lazarusidestrconsts.lisnotavalidpascalidentifier
#, fuzzy
#| msgid "Not a valid pascal identifier"
msgid "Not a valid Pascal identifier"
msgstr "Не є допустимим ідентифікатором Паскаля"

#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Нижній"

#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Ліворуч"

#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Справа"

#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Верхній"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "ЗАУВАЖЕННЯ:Не можу створити означений шаблон для текстів Free Pascal"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "ЗАУВАЖЕННЯ:Не можу створити означений шаблон для текстів Lazarus"

#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "шаблон не вибрано"

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Не реалізовано"

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Ще не реалізовано:%s%s"

#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "не встановлено"

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Не зараз"

#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Завантажено: "

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Створити"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Створити новий проект"

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "К-сть файлів для конвертування: %s"

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - типово"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "шлях до об'єкта"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Перейти на вкладку Обране Інсп. Об'єктів"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr "Перейти на вкладку Обране Інспектора Об'єктів після запиту імені компонента"

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Викл)"

#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr ""

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Клас %s%s%s не знайдений"

#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr ""

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "авто-встановити динамічно"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "авто-встановити статично"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Опис: "

#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sОпис: %s"

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "Назва файлу: %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "встановлено динамічно"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "встановлено статично"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "відсутній"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "змінено"

#: lazarusidestrconsts.lisoipopenloadedpackage
#| msgid "Open loaded package"
msgid "Open Loaded Package"
msgstr "Відкрити Завантажений Пакунок"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Назва Пакунку"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Виберіть пакунок"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "тільки для читання"

#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Стан"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sЦей пакунок вже встановлений, але файлу lpk не знайдено"

#: lazarusidestrconsts.lisok
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "Гаразд"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Старий клас"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (Вкл)"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "При розриві рядка (тобто при настисканні клавіші Enter)"

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Шукати лише для повних слів"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "При вставці з буферу обміну"

#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Відкрити"

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Відкрити як XML-файл"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Відкривати дизайнер при відкритті модуля"

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Відкрити існуючий файл"

#: lazarusidestrconsts.lisopenfile
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Відкрити Файл"

#: lazarusidestrconsts.lisopenfile2
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Відкрити файл"

#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Відкрити %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Відкрити пакунок?"

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Відкрити пакунок %s"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Відкрити файл пакунку"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Відкрити проект?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Відкрити проект"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Відкрити проект знову"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Відкрити файл проекту"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Відкрити символьне посилання"

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Відкрити ціль"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Відкрити файл як текст програми"

#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Відкрити пакунок %s"

#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Відкрити проект %s"

#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Відкритий XML"

#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr "Опції змінені, перезбираю начисто з -B"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "або"

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Підмінити мову. Наприклад --language=de.  Для можливих величин див. теку languages"

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%sперевизначити типовий компілятор. напр. ppc386 ppcx64 ppcppc і т.д. типовий міститься в environmentoptions.xml"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project or IDE build mode."
msgstr "%sігнорувати режим збирання проекту чи IDE."

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%sперевизначити цп проекту. напр. i386 x86_64 powerpc powerpc_64 etc. типовий: %s"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%sперевизначити операційну систему проекту. напр. win32 linux. типова: %s"

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%sперевизначити набір віджетів преокту. напр. gtk gtk2 qt win32 carbon. типовий: %s"

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Переписати файл?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Переписати файл на диску"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Власник' вже використовується в TReader/TWriter. Виберіть інше ім'я."

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Пакунок"

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "пакунок %s"

#: lazarusidestrconsts.lispackageinfo
#| msgid "Package Info"
msgid "Package info"
msgstr "Інфо про Пакунок"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Назва пакунку починається з ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Назва пакунку вміщує ..."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Потрібне встановлення пакунку"

#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Вихідні теки пакунку"

#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Теки з джерелом пакунку"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "модуль пакунку"

#: lazarusidestrconsts.lispage
msgid "Page"
msgstr ""

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", проаналізовано "

#: lazarusidestrconsts.lispascalfile
msgid "Pascal file"
msgstr "Файл Паскаля"

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Кількість Проходів"

#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Вставити"

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "вставити буфер обміну"

#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr "Вставити текст з буферу"

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Шлях"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Переглянути"

#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Видалити недійсні Шляхи"

#: lazarusidestrconsts.lispatheditmovepathdown
#| msgid "Move path down"
msgid "Move path down (Ctrl+Down)"
msgstr "Зсунути шлях вниз (Ctrl+Down)"

#: lazarusidestrconsts.lispatheditmovepathup
#| msgid "Move path up"
msgid "Move path up (Ctrl+Up)"
msgstr "Зсунути шлях вверх (Ctrl+Up)"

#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Додати новий шлях до списку"

#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Видалити вибраний шлях"

#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Видалити неіснуючі (сірі) шляхи зі списку"

#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Замінити вибраний шлях новим шляхом"

#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Додати шаблон в список"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Шляхи шаблонів"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Шляхи пошуку:"

#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "шлях кешу instantfpc"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Шлях утиліти make"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Шлях до невдалого примірника:"

#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Пауза"

#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Очистити для викор назви пакету"

#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Вимкнути I18N в lfm"

#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Додати пункт"

#: lazarusidestrconsts.lispckeditaddtoproject
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Додати до Проекту"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Застосувати зміни"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Викликати процедуру %sRegister%s вибраного модуля"

#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr ""

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Очистити типову/бажану назву файлу залежності"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Побудувати всі?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Побудувати пакунок"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Параметри компілятора для пакунку %s"

#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr ""

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Створити Makefile"

#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, стандартний: %s"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Властивості Залежності"

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Редагувати Загальні Параметри"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Властивості файлу"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Встановити"

#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Встановити пакунки IDE"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Неправильна максимальна версія"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Неправильна мінімальна версія"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Максимальна версія"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Мінімальна версія"

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Змінено: %s"

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Пересунути залежність вниз"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Пересунути залежність вверх"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Пакунок %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Пакунок %s%s%s змінено.%s Зберегти пакунок?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "пакунок%s не збережений"

#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Сторінка: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Оновити залежність"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Оновити файл"

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Тільки для читання:%s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
#| msgid "Recompile all required"
msgid "Recompile All Required"
msgstr "Необхідно перекомпілювати все"

#: lazarusidestrconsts.lispckeditrecompileclean
#| msgid "Recompile clean"
msgid "Recompile Clean"
msgstr "Перебудувати начисто"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Перекомпілювати це, а також  і всі потрібні пакунки?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Зареєстровані доповнення"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Зареєструвати модуль"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Видалити залежність"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Видалити залежність?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Видалити залежність %s%s%s%sз пакунку %s%s%s?"

#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Видалені Файли"

#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Видалені необхідні пакунки"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Видалити файл"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Видалити файл?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Видалити файл %s%s%s%s з пакунку %s%s%s?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Видалити вибраний елемент"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Необхідні пакунки"

#: lazarusidestrconsts.lispckeditsavepackage
#| msgid "Save package"
msgid "Save Package"
msgstr "Зберегти Пакунок"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Зберегти ім'я файлу як типове для цієї залежності"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Зберегти ім'я файлу як бажане для цієї залежності"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Максимальна версія %s%s%s є неправильною версією пакунку.%s(гарний приклад 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Мінімальна версія %s%s%s є неправильною версією пакунку.%s(гарний приклад 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Видалити"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Продивитись код пакунку"

#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr ""

#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Встановлено"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Встановити при наст. запуску"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sСтан: "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
#, fuzzy
#| msgid "Uninstall on next start"
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Видалити при наст. пуску"

#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Деінсталювати пакунок %s"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Додати параметри до підпорядкованих пакунків і проектів"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Додати шляхи до залежних пакунків/проектів"

#: lazarusidestrconsts.lispckoptsauthor
#| msgid "Author:"
msgid "Author"
msgstr "Автор"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Перебудувати за необхідністю автоматично"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "перебудувати при перезбиранні всіх"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Спеціальний"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
#| msgid "Description/Abstract"
msgid "Description / Abstract"
msgstr "Опис / Абстрактно"

#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Час розробки"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
#| msgid "Designtime and Runtime"
msgid "Designtime and runtime"
msgstr "При розробці і запуску"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Інтегрування в IDE"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Вставити"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Неправильний тип пакунку"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Бібліотека"

#: lazarusidestrconsts.lispckoptslicense
#| msgid "License:"
msgid "License"
msgstr "Ліцензія"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Компонувальник"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Важливий"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Компіляція вручну (ніякої автоматизації)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Другорядний"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Об'єкт"

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Параметри пакунку"

#: lazarusidestrconsts.lispckoptspackagetype
#| msgid "PackageType"
msgid "Package type"
msgstr "Тип пакунку"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Забезпечує"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Версія"

#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Час виконання"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Пакунок %s%s%s має мітку Автовстановлення.%sЦе означає, що він автоматично вмонтується в IDE. Встановлювані пакунки%sмають бути для розробки."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Цей пакунок пропонує те саме що і наступні пакунки:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
#| msgid "Update/Rebuild"
msgid "Update / Rebuild"
msgstr "Оновити/Перебудувати"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Використання"

#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Пакунок:"

#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Пошукові шляхи для fpdoc xml-файлів. Кілька шляхів повинні бути розділені комою."

#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr ""

#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Коли форма буде збережена, IDE може зберігати всі властивості TTranslateString до файлу  po. Для цього необхідно включити I18N для цього пакету, забезпечити вихідну теку po і зняти цей прапорець."

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Перервати"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Перебіг"

#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Згорнути директорію"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Знайдений конфлікт"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Змінити Віртуальний Модуль"

#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Розгорнути каталог"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Назва файлу"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Виправити регістр файлів"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Неправильна назва файла модуля"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Неправильна назва модуля"

#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr "Загублені файли пакунку %s"

#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Новий файл не в шляху включення"

#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Немає втрачених файлів. Всі на місці."

#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Видалити файли"

#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Повернути Пакунок"

#: lazarusidestrconsts.lispesavepackageas
#| msgid "Save package as"
msgid "Save Package As ..."
msgstr "Зберегти Пакунок Як ..."

#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Показати структуру тек"

#: lazarusidestrconsts.lispeshowmissingfiles
#| msgid "Show missing files"
msgid "Show Missing Files"
msgstr "Показати Загублені Файли"

#: lazarusidestrconsts.lispesortfiles
#| msgid "Sort Files"
msgid "Sort Files Permanently"
msgstr "Сортувати файли остаточно"

#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Сортувати файли за алфавітом"

#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "Файл \"%s\" зараз не є в шляху включення пакунку.%sДодати \"%s\" в шлях включення?"

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Назва Модуля"

#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Викор. всі модулі в теці"

#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Не викор. модулі в теці"

#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr ""

#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr ""

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Додавання CompiledSrcPath"

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Вихідна тека"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Відмітити теку кодів пакунку"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Шлях до модулів"

#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr ""

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Ви дійсно бажаєте забути всі зміни до пакунку %s і завантажити його з файлу?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Новий модуль не знаходиться в шляху до модулів"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Опублікувати пакунок"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Повернути пакунок?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
msgstr "Файл %s%s%s%sзараз не знаходиться в списку шляхів модулів пакунку.%s%sДодати %s%s%s в шлях?"

#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "У спливаючому меню більше функцій"

#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Бінарне"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Включити файл"

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "xml файл питань"

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "Текст форми LFM - Lazarus"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "Ресурс LRS - Lazarus"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Основний Модуль"

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Модуль"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Віртуальний модуль"

#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID"
msgstr "Тека пакунку. Параметром є ID пакунку"

#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID"
msgstr "Шлях пошуку заголовних файлів пакунку. Параметром є ID пакунку"

#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID"
msgstr "Шлях пошуку джерел пакунку. Параметром є ID пакунку"

#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID"
msgstr "Шлях пошуку модуля пакунку. Параметром є ID пакунку"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sДодавання нової залежності до пакунку %s: пакунку %s%s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sДодавання нової залежності до проекту %s: пакунок %s%s"

#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Додати модуль до операторної частини uses пакунку. Унеможливити це тільки для модулів, які в жодному випадку не треба компілювати"

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Знайдено модулі з однаково розпізнаними назвами"

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Автом. встановлені пакунки"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sОбидва пакунки є пов'язаними. Це означає, що або один із них використовує інший, або обидва вони використовуються третім пакунком."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Залежність порушена"

#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Знайдені кругові залежності"

#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr "Компілювання пакунку %s"

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Видалення не вдалося"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Видалити старий файл пакунку?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Видалити старий файл пакунку %s%s%s?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Залежність без власника:%s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Помилка читання файлу"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Помилка читання пакунку"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Помилка: оновлення po файлу не вдалось для пакету %s"

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Помилка запису файлу"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Помилка запису пакунку"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Файл вже є в пакунку"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Файл в проекті"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Назва файлу відрізняється від назви пакунку"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Назву файлу використано іншим пакунком"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Назву файлу використано проектом"

#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Не знайдений файл %s%s%s."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Файл не збережений"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "При встановленні пакунку %s буде автоматично встановлено пакунок:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "При встановленні пакунку %s будуть автоматично встановлені пакунки:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "неправильна назва файлу компілятора"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Неправильне розширення файлу"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Неправильне розширення файлу пакунку"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Неправильна назва файлу пакунку"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Неправильна назва пакунку"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Неправильна назва пакунку"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Завантаження пакунку %s замінить пакунок%s%s з файлу %s.%sСтарий пакунок змінено.%s%sЗберегти старий пакунок%s?"

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "Новий пакунок"

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Пакунок: %s"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Конфлікти в пакунку"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
#, fuzzy
#| msgid "Package is no designtime package"
msgid "Package is not a designtime package"
msgstr "Пакунок не є designtime пакунком"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Потрібен пакунок"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "головний файл є кодом пакунку"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Така назва пакунку вже існує"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Пакунки повинні мати розширення файлів .lpk"

#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Спочатку скомпілюйте пакунок."

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Збережіть файл перед додаванням в пакунок."

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Проект: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Перебудувати Lazarus?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Перейменувати файл в нижній регістр?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Замінити існуючий файл %s%s%s?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Замінити файл"

#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Один або кілька необхідних пакетів не були знайдені. Дивіться графік пакетів."

#: lazarusidestrconsts.lispkgmangsavepackage
#| msgid "Save Package?"
msgid "Save package?"
msgstr "Зберегти пакунок?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Зберегти пакунок%s (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Чи треба змінити назву файла на нижн. рег. в %s%s%s%s?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Пропустити цей пакунок"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "статичний файл налаштувань пакунку"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Файл компілятора для пакунку %s не є виконуваним:%s%s"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Файл %s%s%s%sвже в пакунку %s."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, fuzzy
#| msgid "The file %s%s%s is not a lazarus package."
msgid "The file %s%s%s is not a Lazarus package."
msgstr "Файл %s%s%s не є пакунком Lazarus."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Назва файлу %s%s%s не відповідає назві пакунку %s%s%s в файлі.%sЗамінити назву пакунку на %s%s%s?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Назва файлу %s%s%s є частиною поточного проекту.%sПроекти і пакунки не мають ділити файли."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Назва файлу %s%s%sвикористовується%sпакунком %s%s%s%sв файлі %s%s%s."

#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr "Файл \"%s\" пакунку %s не знайдений."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Наступний пакунок не вдалось завантажити"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Наступні пакунки не вдалось завантажити:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sНаступні модулі будуть додані до розділу uses %s%s:%s%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Пакунок %s%s%s компілюється з помилками.%sВидалити його із встановочного списку?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, fuzzy
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
msgstr "Назва пакунку %s%s%s в%s%s%s%s є неправильною назвою пакунку lazarus."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, fuzzy
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Пакунок %s є пакунком тільки часу виконання.%sТакі пакунки не можуть бути встановлені в IDE."

#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, fuzzy
#| msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also uses the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
msgstr "Пакунок %s компілюється автоматично, а цого вихідна тека -  \"%s\", яка знаходиться в типовому шляху пошуку модулів компілятора. Пакет використовує інші пакети, які також використовують типовий шлях пошуку модулів компілятора. Це створює нескінченний цикл.%sВи можете вирішити цю проблему%sвидаленням шляху з конфігурації компілятора (напр. fpc.cfg)%sабо вимкненням автооновлення цього пакунку%sабо видаленням залежностей."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, fuzzy
#| msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Пакунок %s%s%s відмічено для встановлення, але його не було знайдено.%sВидалити залежність із списку установки пакунків?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Пакунок %s потребується для %s, який був позначеним для установки.%sДивись діаграму пакунків."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть інший пакунок(напр., package1.lpk)."

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Назва пакунку %s%s%s %sфайлу %s%s%s є некоректною."

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, fuzzy
#| msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Пакунок %s%s%s відмічено.%sЗараз lazarus підтримує тільки статично пов'язані пакунки. Поточне видалення потребує перепобудови і перезапуску lazarus.%s%sВи бажаєте перебудувати Lazarus зараз?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, fuzzy
#| msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Пакунок %s%s%s помічено для встановлення.%sЗараз lazarus підтримує тільки статично пов'язані пакунки. Поточна установка потребує перепобудови і перезапуску lazarus.%s%sВи бажаєте перебудувати Lazarus зараз?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Проект вимагає пакунку %s%s%s.%sАле його не знайдено. Див. Проект -> Інспектор проекту."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Існує два модуля з однаковими назвами:%s%s1. %s%s%s з %s%s2. %s%s%s з %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "В пакунках є кругова залежність. Дивіться графік пакетів."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Існує модуль FPC з такою самою назвою, як і пакунок:%s%s%s%s%s%s"

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Існує модуль FPC з такою самою назвою, як:%s%s%s%s%s з %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Вже існує іншій пакунок з назвою %s%s%s.%sКонфліктуючий пакунок:%s%s%s%sФайл: %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Вже завантажено пакунок%s%s%s %sз файлу %s%s%s.%sДив. Пакунок -> Діаграма пакунків.%sЗаміна неможлива."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Посеред необхідних пакунків є не збережений. Див. діаграму пакунків."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Існує модуль з такою самою назвою, як і пакунок: %s%s1. %s%s%s з %s%s2. %s%s%s%s"

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Це віртуальний пакунок. В нього немає коду. Збережіть спочатку пакунок."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Не можу створити теку"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Не можу створити теку виведення %s%s%s%sз пакунку %s."

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Не можу створити теку кодів пакунку %s%s%s%sдля пакунку %s."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, fuzzy
#| msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Не можу створити теку цілі для lazarus:%s%s%s%s.%sЦя тека потрібна для оновленого IDE lazarus з вашими пакунками."

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Не можу видалити файл %s%s%s."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Не можу видалити файл"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Не можу видалити старий файл %s%s%s%s з пакунку %s."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Неможливо завантажити пакунок"

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Не можу відкрити пакунок%s%s%s.%sЦей пакунок було позначено для встановлення."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Не можу прочитати файл стану %s%s%s%sпакунку %s.%sПомилка: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Не можу записати пакунок%s%s%s%sу файл %s%s%s.%sПомилка: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Не можу записати файл стану %s%s%s%sпакунку %s.%sПомилка: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Видалити пакунок?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Видалити пакунок%s?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Не збережений пакунок"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Викор. модуль"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Увага: Файл %s%s%s%sналежить поточному проекту."

#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "залишити"

#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "новий"

#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "видалити"

#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Виберіть пакунок"

#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "Встановлено"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
#, fuzzy
#| msgid "Can not register components without unit"
msgid "Cannot register components without unit"
msgstr "Не можу зареєструвати компоненти без модуля"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Клас компонента %s%s%s вже визначений"

#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sНазва файлу: %s%s%s"

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Неправильний клас компонента"

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Неправильна назва модуля: %s"

#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: %s%s%s"
msgstr "%s%slpk файл: %s%s%s"

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Файл пакунку не знайдений"

#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "Помилка реєстрації пакунку"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Порожня процедура реєстрації"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Було викликано RegisterUnit, але пакунків не зареєстровано."

#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr "%s%sФайл lpk не знайдено."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Пакунок %s%s%s встановлено, але не знайдений правильний файл з пакунком (.lpk).%sБув створений зламаний холостий пакунок."

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Це пакунок за замовчуванням. Використовується тільки для компонентів без пакунку. Такі компоненти є застарілими."

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Цей пакунок встановлений але lpk-файл не був знайдений. Всі компоненти дезактивовані. Будь-ласка, виправте проблему."

#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sНазва модуля: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr "Модуль \"%s\" не знайдений у lpk файлі.%sНапевне цей lpk файл не був використаний для збирання цієї IDE. Або пакет зловживає процедурою RegisterUnit."

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr "Модуль \"%s\" був видалений з пакунку (lpk)"

#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgstr ""

#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options / Additions and Overrides%s%s%s"
msgstr ""

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Цього файлу немає у всіх завантажених пакунках."

#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr ""

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Неможливо прочитати файл пакунку %s%s%s.%sПомилка: %s"

#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr ""

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Глобальна"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Зв'язки Пакунку"

#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Показувати глобальні зв'язки"

#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Показувати користувацькі зв'язки"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Користувацька"

#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgstr "Виправте помилку, показану у вікні повідомленя, яке зазвичай є нижче редактора вихідного коду."

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Відкрийте модуль перед запуском."

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Виділіть трохи коду, щоб витягти нову процедуру/метод."

#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Всі>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Змінити Шрифт"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Копіювати назву методу з буферу обміну"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Фільтр за збіжністю будь-якої частини метода"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Фільтр за збіжністю початку метода"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Перейти до Обраного"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<нічого>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Об'єкти"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Список Процедур"

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Тип"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Виберіть теку з файлом .po"

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Не зберігати ніякої сесії"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Вказівник"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Зберегти в теці графічної оболонки"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Зберегти в файлі .lpi"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Зберегти в файлі .lpi в теці проекту"

#: lazarusidestrconsts.lisposavesessionfoldstate
msgid "Save fold info"
msgstr "Зберегти згорток до"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Зберегти інформацію про сесію в"

#: lazarusidestrconsts.lisposavesessionjumphistory
msgid "Save jump history"
msgstr "Зберегти історію переходів"

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Попереднє слово"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "тека головних налаштувань, де Lazarus зберігає свої файли налаштувань. За замовчуванням"

#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Основний шлях конфігурації"

#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr "перед %s"

#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Пріоритет"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Приватний"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Приватний метод"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Можливо, потрібно встановити деякі пакунки перед тим, як продовжувати.%s%sПопередження:%sПроект використовує наступні пакунки, які можуть знадобитись для відкриття форми в дизайнері. Якщо Ви продовжите, ви можете отримати помилки про відсутність компонентів і завантаження форми швидше за все призведе до неприємних результатів.%s%sРекомендується скасувати та спочатку встановити ці пакунки.%s%s"

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Процедура"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Процедура з інтерфейсом"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Програма"

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Виявлена програма"

#: lazarusidestrconsts.lisprogramnotfound
msgid "Program %s not found"
msgstr "Програма %s не знайдена"

#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr ""

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
#, fuzzy
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Текст програми повинен мати розширення паскаля, напр. .pas, .pp або .lpr"

#: lazarusidestrconsts.lisprojaddaddfilestoproject
#| msgid "Add files to project"
msgid "Add Files to Project"
msgstr "Додати Файли до Проекту"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Залежність вже існує"

#: lazarusidestrconsts.lisprojaddeditorfile
#| msgid "Add editor files"
msgid "Add Editor Files"
msgstr "Додати Файли Редактора"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Неправильна версія (Min-Max)"

#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Неправильна назва пакунку"

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
#, fuzzy
#| msgid "Invalid pascal unit name"
msgid "Invalid Pascal unit name"
msgstr "Неправильна назва модуля паскаля"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Неправильна версія"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Максимальна версія (необов'язково)"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Мінімальна версія (необов'язково)"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Нова вимога"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Назва Пакунку:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Пакунок не знайдений"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Залежності %s%s%s не знайдено.%sВиберіть існуючий пакунок."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Максимальна версія %s%s%s некоректна.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Максимальна версія менше за мінімальну."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Мінімальна версія %s%s%s є некоректною.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть існуючий пакунок."

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Проект вже залежить от пакунку %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Назва модуля %s%s%s вже існує в проекті%sв файлі: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Назва модуля %s%s%s вже існує в виділенні%sв файлі: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The unit name %s%s%s is not a valid pascal identifier."
msgid "The unit name %s%s%s is not a valid Pascal identifier."
msgstr "Назва модуля %s%s%s є неприпустимим ідентифікатором паскаля."

#: lazarusidestrconsts.lisprojaddtoproject
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to Project"
msgstr "Додати до Проекту"

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Назва модуля вже існує"

#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr "Проект %s"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Проект змінено"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Проект змінився на диску"

#: lazarusidestrconsts.lisprojectcount
msgid "%d projects"
msgstr ""

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Тека проекту"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Назва на панелі завдань показує також шлях до теки проекту"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Назва файлу проекту"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Шляхи, що включені до проекту"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Виявлено info-файл проекту"

#: lazarusidestrconsts.lisprojectinformation
#| msgid "Project Information"
msgid "Project information"
msgstr "Інформація про проект"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Проект є виконуваним"

#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Проект"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Властивості макросів проекту"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Вихідна Тека проекту (напр. тека ppu)"

#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Вихідна тека проекту"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Тека з основним файлом проекту повинна бути"

#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr ""

#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "Сеанс проекту змінився"

#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Теки кодів проекту"

#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s За адресою %1:x"

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Проект %s зазнав винятку класу '%s'."

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Проект %s зазнав винятку класу '%s' з повідомленням:%s%s"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s В файлі '%1:s' за адресою %2:x"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s В файлі '%1:s' рядок %2:d"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:s В файлі '%1:s' рядок %2:d:%0:s%3:s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Шлях до кодів проекту"

#: lazarusidestrconsts.lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built"
msgstr "Проект %s%s%s успішно зібрано"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "модуль проекту"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Шлях до модулів проекту"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Майстер Проектів"

#: lazarusidestrconsts.lisprojfiles
msgid "Files:"
msgstr "Файли:"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Підтвердити видалення залежності"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Підтвердіть видалення файлу"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Видалити залежність для %s?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Інспектор проекту - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Видалені необхідні пакунки"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Видалити файл %s з проекту?"

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Неможливо прочитати файл стану %s проекту %s%sПомилка: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Неможливо записати файл стану в проект %s%sПомилка: %s"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Завжди будувати (навіть якщо нічого не мінялось)"

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Помилка"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Не можу змінити список автостворюваних форм в коді програми.%sВиправте спочатку помилки."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Мітка теки програмних файлів проекту"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Довідка за значенням"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Властивості (замінити чи видалити)"

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Захищений"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Захищений метод"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Спільний метод"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Опублікований метод"

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Тека публікації проекту"

#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Опублікувати Проект"

#: lazarusidestrconsts.lispublprojinvalidexcludefilter
#| msgid "Invalid Exclude filter"
msgid "Invalid exclude filter"
msgstr "Неправильний фільтр виключень"

#: lazarusidestrconsts.lispublprojinvalidincludefilter
#| msgid "Invalid Include filter"
msgid "Invalid include filter"
msgstr "Неправильний фільтр включень"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Зберігати .lrs файли в кінцеву теку"

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
#, fuzzy
#| msgid "A pascal unit must have the extension .pp or .pas"
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Модуль паскаля має мати розширення .pp або .pas"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Редагувати віртуальний модуль"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Вже є модуль з такою назвою. %sФайл: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The unitname is not a valid pascal identifier."
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Назва модуля не є правильним ідентифікатором pascal. "

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
#| msgid "The unitname is used when the IDE extends uses clauses."
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "Назва модуля використана графічною оболонкою при розширенні користувацьких виразів"

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Назва модуля і Назва файлу не збігаються.%sНаприклад: unit1.pas і Unit1"

#: lazarusidestrconsts.lispwconvertproject
#| msgid "Convert Delphi Project"
msgid "Convert &Delphi Project"
msgstr "Конвертувати Проект &Delphi"

#: lazarusidestrconsts.lispwnewproject
#| msgid "New Project"
msgid "&New Project"
msgstr "&Новий Проект"

#: lazarusidestrconsts.lispwopenproject
#| msgid "Open Project"
msgid "&Open Project"
msgstr "Від&крити Проект"

#: lazarusidestrconsts.lispwopenrecentproject
#| msgid "Open Recent Project"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Відкрити Не&давній Проект"

#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Переглянути &Приклади Проектів"

#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr "Створити локальну змінну"

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Швидкі виправлення"

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Шв. випр: Видалити модуль"

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Шукати ідентифікатор"

#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Вийти"

#: lazarusidestrconsts.lisquitlazarus
#| msgid "Quit Lazarus"
msgid "&Quit Lazarus"
msgstr "&Вийти з Lazarus"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Помилка читання"

#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr ""

#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Недавні вкладки"

#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Record"

#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr ""

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Запис/Структура"

#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Повернути"

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Регістри"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Регулярний вираз"

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Відносні шляхи"

#: lazarusidestrconsts.lisremove
#| msgid "remove"
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Видалити"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Видалити всі некоректні властивості"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Видалити всі модулі"

#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Видалити з списку встановлення"

#: lazarusidestrconsts.lisremovefromproject
#| msgid "Remove from project"
msgid "Remove from Project"
msgstr "Видалити з Проекту"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Видалити з пошукового шляху"

#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Видалити включений шлях?"

#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Видалити локальну змінну %s"

#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr "Видалити локальну змінну"

#: lazarusidestrconsts.lisremovenonexistingfiles
#, fuzzy
#| msgid "Remove non existing files"
msgid "Remove nonexistent files"
msgstr "Видалити неіснуючі файли"

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Видалити вибрані модулі"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Видалити їх"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Видалити шляхи з \"Інші джерела\""

#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr "Видалити модуль з секції uses"

#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Видалити шлях до модуля?"

#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Перейменувати"

#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr ""

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Перейменувати файл?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Не вдалося змінити назву файла"

#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr ""

#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Перейменувати на %s"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Превести в нижній регістр"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Перевідкрити проект"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Перевідкрити з іншим кодуванням"

#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Повторень:"

#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Заміна"

#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisreplacedtypeswiths
msgid "Replaced type \"%s\" with \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Заміна"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Функції заміни"

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Заміни"

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Виправити невідомі властивості і типи"

#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Замінити весь ідентифікатор"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Помилка заміни"

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr "Вимагає FPC 2.4 чи новіше. Як ресурси Delphi"

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Пересканувати"

#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr ""

#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Скинути всі фільтри до типових?"

#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr ""

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Помилка збереження ресурсу"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Тип ресурсів проекту"

#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Перезапуск"

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Результат:"

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "повертає список значень змінних case перед змінною"

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Обертання не вдалося"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Справа"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Праве якорювання"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Правий бордюр. Значення додається до базового бордюру і використовується для відступу справа від контролю."

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Це список контролів одного рівня для якого права сторона зафіксована. Залишити порожнім для батьківського."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Праві краї"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "По правому краю"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Корінь"

#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr ""

#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Виконати"

#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr ""

#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Виконати"

#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "%s (виконується ...)"

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Файл не є виконуваним"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Головна програма %s%s%s не є виконуваним файлом."

#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Виконати"

#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
#, fuzzy
#| msgid "Runtime only, can not be installed in IDE"
msgid "Runtime only, cannot be installed in IDE"
msgstr "Часу виконання, не можна встановити в IDE"

#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr ""

#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgstr ""

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Виконати-до не вдався"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
#| msgid "Abstract methods - not yet overridden"
msgid "Abstract Methods - not yet overridden"
msgstr "Абстрактні Методи - ще не перекриті"

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Абстрактні методи %s"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Курсор не в оголошенні класу"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE зайнятий"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s є абстрактним класом, він має %s абстрактних методів."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Не знайдено абстрактних методів"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Перевизначити всі вибрані"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Перевизначити перший вибраний"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Не вибирати нічого"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Можна перевизначити %s абстактних методів.%sВиберіть методи для яких треба створити пробки:"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Не лишилось абстрактних методів для перевизначення."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Цей метод не можна перевизначити бо він визначений в поточному класі"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Не можу показати абстрактні методи поточногокласу, бо"

#: lazarusidestrconsts.lissave
#| msgid "Save ..."
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Зберегти"

#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Зберегти всі"

#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Зберегти всі відзначені"

#: lazarusidestrconsts.lissaveallmessagestofile
#| msgid "Save all messages to file"
msgid "Save All Messages to File"
msgstr "Зберегти Всі Повідомлення в Файл"

#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Зберегти всі змінені файли"

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Зберегти і вийти з діалогу"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Зберегти і перебудувати IDE"

#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Зберегти як"

#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Зберегти змінені файли?"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Зберегти зміни?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Зберегти зміни в проект %s?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Зберегти поточний файл редактора"

#: lazarusidestrconsts.lissavedsuccessfully
msgid "Saved successfully"
msgstr "Збережено успішно"

#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr ""

#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr ""

#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Зберегти інформацію редактора про файли, що не відносяться до проекту"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Зберегти файл як"

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Зберегти файл %s%s%sперед закриттям форми %s%s%s?"

#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Зберегти інформацію про закриті редактором файли"

#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr ""

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Зберегти проект %s (*%s)"

#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr "Зберегти зміни сеансу до проекту %s?"

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Зберегти налаштування"

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Зберегти "

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Масштабний фактор:"

#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr ""

#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr ""

#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Шляхи пошуку"

#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr "Шукати модуль"

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "вторинна тека налаштувань, де Lazarus шукає свої шаблони налаштувань. За замовчуванням "

#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Вторинний шлях конфігурації"

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Дивись повідомлення."

#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sДив.. Проект -> Інспектор проекту"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Шукати елемент довідки:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Виберіть елемент"

#: lazarusidestrconsts.lisselectanotherlclwidgetsetmacrolclwidgettype
msgid "Select another LCL widget set (macro LCLWidgetType)"
msgstr "Вибрати інший набір віджетів LCL (макрос LCLWidgetType)"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Виберіть файли форм Delphi (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Вибраний"

#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr ""

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(вибраний нижній сусід)"

#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Картографія вибраної команди"

#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr ""

#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr ""

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(вибраний лівий сусід)"

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(вибраний правий сусід)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(вибраний верхній сусід)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Вибрати файл"

#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Вибрати теку початкових кодів FPC"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Вибір перевищує рядкову константу"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Інструмент вибору"

#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Вибрати теку початкових кодів Lazarus"

#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr "Виберіть шлях до %s"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Встановити за замовчуванням"

#: lazarusidestrconsts.lissetupdefaultindentation
#, fuzzy
#| msgid "(Setup default indentation)"
msgid "(Set up default indentation)"
msgstr "(Налаштувати відступи за замовчуванням)"

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Коротко:"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Показати"

#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr ""

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Виводити підказки оголошень"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Показати відмінності між режимами ..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Показати порожні модулі/пакунки"

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr "Показувати Знаки для:"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Показувати канавку"

#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Показати довідку"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Показувати довідки в Інспекторі об'єкту"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Показувати змінні"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Показувати панель інформації"

#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr ""

#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview Gutter"
msgstr "Показати Канавку огляду"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Показувати пакунки"

#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Показати позицію редактора коду"

#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr ""

#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr "Показати діалог налаштування найбільш важливих параметрів"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Показувати спеціальні символи"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr "Показувати рядок стану"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Показувати модулі"

#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr ""

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Виводити підказки зі значеннями під час налагодження"

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "показати версію і вийти"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Зменшити до найменшого"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Рівень"

#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr ""

#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr ""

#: lazarusidestrconsts.lissimplesyntax
#| msgid "Simple Syntax"
msgid "Simple syntax"
msgstr "Простий синтаксис"

#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Пропустити помилки"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Пропустити файл"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Пропустити файл і продовжити завантаження"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Пропустити завантаження останнього проекту"

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr ""

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Збіги"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Вибачте, цей тип ще не реалізовано"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "За зростанням"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Чутливий до Регістру"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Спадаюче"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Домен"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ігнорувати пробіли"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Рядки"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Параметри"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Абзаци"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Попередній перегляд"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Прийняти"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Сортування вибраного"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Слова"

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Код і призначення однакові:%s%s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source Breakpoint ..."
msgstr "Точка Зупинки &Джерела ..."

#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Початкова тека %s%s%s%s і тека призачення %s%s%s%s є тою самою.%s%sМоже ви не зрозуміли осболивості.%sЦе очистить/перестворить цільової каталог%sі скопіює в нього пакунок/проект."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Теки кодів %s%s%s не існує."

#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr ""

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Код змінено"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Код сторінки %s%s%s змінено. Зберегти?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr "Поч.коди більше ніж однієї сторінки змінились. Зберегти сторінку %s%s%s? (ще %d)"

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Шляхи до програмних файлів"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Вирівняти по ширині"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Джр ОС"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Пошук"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Шукати текст"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Почати перетворення"

#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Запустити IDE"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Розпочати з нового проекту"

#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Завершити"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Завершити налагоджування і перебудувати прект?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Завершити налагодження?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Завершити налагоджування?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Зупинитись на винятку"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Завершити налагоджування?"

#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Зберігати роздільники шляху \\ та / як"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Дивний lpi файл"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Помилка потоків"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Рядок"

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Стиль"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Підпроцедура"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Підпроцедура того ж рівня"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Успішно"

#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Запропонувати типове ім'я нового файлу в нижньому регістрі"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Підозрілий шлях включення"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Підозрілий шлях модуля"

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Версія SVN"

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Неправильна назва змінної"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s є некоректним ідентифікатором."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Змінювання системної змінної"

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Синтаксичний режим"

#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "system.ppu не знайдено. Перевірте ваш fpc.cfg."

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "ТАБ"

#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Сортувати вкладки всіх контролів-нащадків \"%s\" за позиціями?"

#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Змістити вибраний ел-т вниз в порядку вкладок"

#: lazarusidestrconsts.listaborderof
msgid "Tab Order of %s"
msgstr "Порядок Вкладок %s"

#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Обчислити порядок вкладок контролів за їх X- та Y- позиціями"

#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Змістити вибраний ел-т вверх  в порядку вкладок"

#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr "Вкладки для %s"

#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr "Зробити Знімок"

#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Ціль:"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Для ЦП:"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Ім'я цільового файлу: (-o, порожньо = викор. вихідну теку модуля)"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Ім'я цільового файлу (-o):"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Назва цільового файлу проекту"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Ім'я цільового файлу + параметри"

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Для якої ОС"

#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Внутрішня помилка компілятора! (%d)"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Редагована Клітинка"

#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid "Inserts an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s  while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgstr "Вставляє редаговану Клітку. По Клітинках можна переміщатися за допомогою клавіші tab.%0:sМакрос \"param\" приймає список розділених комами аргументів.%0:sПерший аргумент є типовим значенням.%0:sДругий аргумент (необов'язковий) може бути використаний щоб пов'язати клітку з іншою (синхронна правка)%0:s%0:s а param(\"foo\") do param(foo);%0:sВставляє 2 незалежних клітинки, з типовим текстом \"foo\"%0:sЛапки необов'язковіl%0:s%0:s  Якщо param(\"foo\") > 0 та param(\"foo\",sync=1) < 99 тоді%0:sВставляє 2 пов'язані клітинки, редагування однієї змінить іншу також%0:sЗначення \"1\" вказує позицію іншого \"param()\", так що якщо є ще параметри:%0:s  якщо param(\"bar\") та param(foo) > 0 і param(foo,sync=2) < 99 тоді%0:s2-га і третя пов'язуються. (3-тя вказує на \"2\") %0:s%0:s\"синх може бути скорочений до \"s\":%0:s  якщо param(\"foo\") > 0 та param(\"foo\",s=1) < 99 тоді%0:s%0:s  якщо param(\"bar\") та param(\"foo\") > 0 і param(\"foo\",sync) < 99 тоді%0:sДругий і третій пов'язуються.%0:sЗауважте: \"Синх не має позиції і не має \"=\", тому він синхронізує з попередньою кілтинкою з тим же типовим текстом (тут це \"foo\")"

#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr ""

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Тека проб"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "Пакет Програм був створений для \"%s\""

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, fuzzy
#| msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "Клас %s%s%s не є елементом управління (TControl) і його не можна вставити на що-небудь інше.%sНе можу вставити."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "Codetools знайшов помилку:%s%s%s"

#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Команда після %s%s%s не є виконуваною."

#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Команда після опублікування є некоректною:%s%s%s%s"

#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "Файл компілятора \"%s\" виглядає невірним:%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Компонент %s не може бути видалений, бо %s ним не володіє."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "Редактор компоненту для класу %s%s%s викликав помилку:%s%s%s%s"

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Редактор компонента для класу %s%s%sщо пов'язаний зі словом #%s %s%s%sвикликав помилку:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Компонент %s успадкований від %s.%sДля видалення успадкованого компоненту слід відкрити об'єкт-предок і видалити його там."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Компонент %s успадкований від %s.%sДля перейменування успадкованого компоненту слід відкрити об'єкт-предок і перейменувати його там."

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
#, fuzzy
#| msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "Імена компонентів повинні бути унікальними в межах форми/модуля даних. Порівняння імен, як і для звичайних ідентифікаторів Паскаля, відбувається без урахування регістру."

#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "Конфігурація буде понижена/перетворена."

#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, fuzzy
#| msgid "The %s contains a not existing directory:%s%s"
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "%s містить неіснуючу директорію:%s%s"

#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "%s містить символ зірочки *.%sLazarus інтерпретує його як звичайний символ, не розкриваючи в якості маски файлу."

#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "Поточний FPC не має файлу налаштувань. Ймовірно, компілятор не зможе знайти ряд модулів. Перевірте, що fpc правильно встановлено."

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "Поточна тека початкових кодів Free Pascal %s%s%s%sвиглядає неправильною.%sВиберіть Гаразд щоб вибрати типову %s%s%s.%sІнакше перевірте Інструменти -> Параметри -> Файли"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез неї Ви не зможете створювати додатки LCL.%sВиберіть ОК для використання теки за замовчуванням %s%s%s.%sІнакше перевірте Інструменти -> Параметри -> Файли"

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
msgstr "Налагоджувач %s%s%s%sне існує або не є виконуваним.%s%sДив. Інструменти -> Параметри -> Параметри Налагоджувача"

#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr ""

#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr ""

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Теки призначення%s%s%s%s не існує."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Каталог призначення %s%s%s не існує.%sПеревірте ім'я виконуваного файлу в Меню > Проект > Параметри Проекту."

#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "Каталог \"%s\" більше не містить файлів включення проекту. Видалити його зі списку шляхів пошуку файлів включення проекту?"

#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "Каталог \"%s\" більше не містить модулі проекту. Видалити його зі списку шляхів пошуку модулів проекту?"

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Тека %s%s%s більше не потрібна в шляху до модулів.%sПрибрати її?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr "Каталог %s%s%s не доступний для запису."

#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Теки %s%s%s немає в шляху до модулів.%sДодати її?"

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Директорія %s не знайдена."

#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Файл %s%s%s"

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Файл %s не схожий на lpi файл."

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "Індекс файлів потрібен для забезпечення роботи функції пошуку і їй подібних. Під час сканування можна редагувати початковий код і компілювати, але функція пошуку і їй подібні будуть повідомляти, що необхідні модулі не знайдені. Це може зайняти кілька хвилин."

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Файл %s%s%s є символьним посиланням.%s%sВідкрити %s%s%s замість нього?"

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, fuzzy
#| msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgid "The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?"
msgstr "Файл %s%s%s не є проектом Lazarus.%sСтворити новий прокт для цього %s?"

#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr "Файлова маска \"%s\" недійсна."

#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "Файлова маска \"%s\" не є вірним регулярним виразом."

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, fuzzy
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Файл %s%s%s%sсхожий на програму. Закрити поточний проект і створити новий проект lazarus для цієї програми?%s\"Ні\" відкриє файл як звичайний код."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, fuzzy
#| msgid "The file %s seems to be the program file of an existing lazarus Project."
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Схоже, що файл %s є програмним в існуючому Проекті"

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Файл %s%s%s%знайдений в одному з каталогів початкового коду пакету %s, і він виглядає як відкомпільований модуль. Такі модулі повинні бути в результуючому каталозі пакунку, інакше інші пакунки можуть мати проблеми з використанням цього пакунку.%s%sВидалити невизначені файли?"

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Файлу %s%s%s%sне знайдено.%sВи бажаєте пошукати його самостійно?%s"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Файл %s%s%s%sне знайдено.%sПропуск продовжить завантаження проекту,%sПереривання зупинить завантаження."

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Наступні методи, що використовуються %s відсутні в програмному файлі%s%s%s%s%s%sПрибрати завислі посилання?"

#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "Джерельна тека FPC \"%s\" виглядає невірною:%s%s"

#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "Виконуваний файл компілятора Free Pascal зазвичай має ім'я \"%s\". Ви також можете використовувати компілятор для певної платформи, наприклад, \"%s\". Задайте повний шлях до файлу."

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Ідентифікатор є модулем. Для його перейменування використайте функцію Файл - Зберегти як."

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "Клавіша %s%sвже призначена для %s.%s%sВидалити стару асоціацію і призначити клавішу для нової функції%s%s?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "Необхідний для виконання Пакет Програм %s%sне існує або не є виконуваним файлом.%sВи хочете створити такий?%s%Для налаштування дивіться Проект -> Параметри Проекту -> Додаток."

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Виконувана програма %s%s%s%sне існує або не є виконуваною.%s%sДивіться -> Запуск -> Параметри запуску -> Локальні"

#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "Тека Lazarus містить початкові коди IDE і файли пакетів LCL і багато стандартних пакетів. Наприклад, вона містить файл \"ide%slazarus.lpi\". Файли перекладу також знаходяться там."

#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "Тека Lazarus \"%s\" виглядає невірною:%s%s"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "LFM-файл (файл форми Lazarus) вміщує некоректні властивості. Це означає, наприклад, що він вміщує деякі властивості/класи, яких немає в поточній версії LCL. Як правило треба прибрати ці властивості з lfm і (якщо треба) виправити код паскаля вручну."

#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "Макрос \"%s\" не починається з \"%s\"."

#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr ""

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, fuzzy
#| msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgid "The new include file is not yet in the include search path.%sAdd directory %s to build modes?"
msgstr "Новий заголовочний файл ще не є в шляху пошуку включень.%sДодати теку %s?"

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, fuzzy
#| msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgid "The new unit is not yet in the unit search path.%sAdd directory %s to build modes?"
msgstr "Новий модуль ще не в шляху пошуку миодулів.%sДодати теку %s?"

#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "Стара конфігурація буде оновлена."

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\"Інші джерела\" містить каталог, який вже знаходиться в \"Інші файли модулів\".%s%s"

#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "Кінцева директорія %s%s%s відсутня."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Вихідна тека %s є в списку пошуку включених шляхів %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Вихідна тека %s є в списку пошуку шляху успадкованого включення %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Вихідна тека %s є в списку пошуку шляху успадкованого модуля %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Вихідна тека %s є в списку пошуку шляху модуля %s."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr " Вихідна тека повинна бути окремою текою і не містити файлів початкових кодів."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "Клас власника має це ім'я"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Власник має це ім'я"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Пакунок %s додає шлях \"%s\" до шляху включення IDE.%sНапевне пакунок погано сконфігурований."

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Пакунок %s додає шлях \"%s\" до шляху модулів IDE.%sНапевне пакунок погано сконфігурований."

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Пакунок вже містить модуль з таким іменем."

#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, fuzzy
#| msgid "The package %s can not be installed, because it requires the package \"%s\", which is a runtime only package."
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgstr "Пакет %s не можна встановити, бо він вимагає пакунок \"%s\", який є пакунком лише часу виконання."

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "Пакет %s не можна деінсталювати, бо він потрібен для самого IDE."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Пакунок %s не має жодних процедур \"Реєстрації\", яка зазвичай означає, що він не надає аддон IDE. Його встановлення швидше всього лише збільшить розмір IDE і може навіть зробити його нестійким..%s%sПідказка: Якщо ви хочете використати пакет у проекті, використайте пункт меню \"Додати в проект\"."

#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr "Пакунок %s вже в списку"

#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
#, fuzzy
#| msgid "The package %s is not a design time package. It cannot be installed in the IDE"
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "Пакунок %s не є пакунком часу розробки. Він не може бути встановлений в IDE"

#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "Шлях \"make\" є невірним: \"%s\""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, fuzzy
#| msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
msgstr "Програму %smake%s не знайдено.%sЦей інструмент потрібен, щоб Побудувати lazarus.%s"

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Опції компілятора проекту і директиви в основному коді відрізняються. Для нового модуля будуть використані наступні режим і тип рядка проекту:"

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "Проект не використовує інтерфейси модулів LCL, які вимагає LCLBase.%sВи отримаєте дивні помилки компонувальника, якщо ви використаєте LCL без інтерфейсів."

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Проект не має основного файлу з початковим кодом."

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Файл відомостей проекту %s%s%s%sзбігається з головним кодом!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "Інформаційний файл проекту %s%s%s%sзмінився на диску."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Проект треба зберегти перед компіляцією%sЯкщо Ви встановите Тестову Теку в параметрах IDE,%sВи можете створювати проекти і будувати їх одразу.%sЗберегти проект?"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Проект використовує цільову ОС=%s та ЦП=%s.%ssystem.ppu для цієї цілі не був знайдений в теках бінарників. %sПереконайтесь, що fpc для цієї цілі встановлений вірно і fpc.cfg містить вірні директорії."

#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "Проект використовує нові ресурси FPC, які вимагають принаймні FPC 2.4"

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "В теці є і інші файли з такою самою назвою,%s, що відрізняється тільки регістром:%s%s%sВидалити їх?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "На диску є файл з такою самою назвою і схожим розширенням%sФайл: %s%sСхожий файл: %s%s%sВидалити інший файл?"

#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr ""

#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr ""

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Вже існує компонент з таким іменем"

#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Вже існує форма з назвою %s%s%s"

#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name %s%s%s."
msgstr "Вже є макрос з іменем %s%s%s."

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Вже існує макрос IDE з іменем \"%s\""

#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr "В списку вже є пакунок %s"

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Вже існує модуль, що називається %s%s%s. Ідентифікатори паскаля мають бути унікальними."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "В проекті є модуль з назвою %s%s%s.%sВиберіть іншу назву"

#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr ""

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Має бути хоча б один режим побудови."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "Ресурс класу %s%s%s походить від %s%s%s. Можливо, що це відноситься ло TForm."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Сталася помилка при запису вибраних компонентів %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Сталася помилка при перетворенні бінарного потоку вибраного компонента %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Сталася помилка при копіюванні потоку компонента в буфер:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
#, fuzzy
#| msgid "The root component can not be deleted."
msgid "The root component cannot be deleted."
msgstr "Компоненту верхнього рівня не може бути видалено."

#: lazarusidestrconsts.listhesefileswillbedeleted
#| msgid "These files will be deleted:"
msgid "These files will be deleted"
msgstr "Ці файли будуть видалені"

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Ці налаштування зберігаються з проектом."

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Ці модулі не були знайдені:"

#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Початковий код пакунків Free Pascal необхідні для перегляду і завершення коду. Наприклад, вони мають файл \"%s\"."

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)"
msgstr "Неможливо знайти Тестову Теку:%s%s%s%s%s(див. параметри IDE)"

#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit %s%s%s already exists."
msgstr ""

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "Модуль належить пакету %s."

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Модуль %s існує двічі в шляху модулів %s:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "Модуль має це ім'я"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "Ім'я файлу модуля %s%s%s - не в нижньому регістрі.%sКомпілятор Free Pascal не шукає всі регістри. Рекомендовано користуватися нижнім регістром для імені.%s%sПерейменувати файл?"

#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "Модуль %s є частиною джерел FPC, але відповідний fpdoc xml файл не був знайдений.%sАбо ви ще не додали теку fpcdocs до пошукового шляху або модуль ще не документований.%sФайли fpdoc файли для джерел FPC можуть бути завантажені з: %s%sДодайте теку в опціях редактора fpdoc.%sЩоб створити новий файл, каталог має бути перезаписуваним."

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "Модуль %s використовується іншими файлами.%sОновити залежності автоматично?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Модуль вже називається %s%s%s. Ідентифікатори паскаля мають бути унікальними."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "Шлях пошуку модулів %s%s%s містить теку початкових кодів %s%s%s пакунку %s"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Робоча тека %s%s% не існує.s%Перевірте робочу теку в Меню > Запуск > Параметри запуску."

#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr ""

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Ця функція потребує відкритий .lfm файл в редакторі коду."

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "це довідкове повідомлення"

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, fuzzy
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Це виглядає як pascal файл.%sРекомендується використовувати назви файлів в нижньому регістрі для запобігання різних проблем на деякиих операційних системах і різних компіляторах.%sЗмінити на нижній регістр?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Проект не має основного файлу з поч. кодом"

#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Цей проект має лише типовий режим побудови."

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Цей набір параметрів для збирання Lazarus не підтримується встановленням.%sТека %s%s%s недоступна для запису.%sДивіться сайт Lazarus для інших способів встановлення."

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Цей вираз не може бути витягнутий.%sВиберіть будь-який код, щоб витягти нову процедуру/метод."

#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Це створить кругову залежність."

#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr "Потоки"

#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Поточний"

#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "Функція"

#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr "ЙтиДо"

#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Рядок"

#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr "Потоки не визначені"

#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Джерело"

#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Стан"

#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr "&Автоматично закрити в випадку успіху"

#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr "Компілювання:"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Заголовок"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Назва на панелі завдань показує наприклад: project1.lpi - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Назва (залишити порожнім для типової)"

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Функція: додати розподілювач шляхів"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
#, fuzzy
#| msgid "Function: chomp path delimiter"
msgid "Function: remove trailing path delimiter"
msgstr "Функція: прибрати розподілювач шляхів"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Функція: витягнути розширення файлу"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Функція: витягнути назву файлу з розширенням"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Функція: витягнути тільки назву файлу"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Функція: витягнути шлях до файлу"

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(невідомий макрос: %s)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Шлях:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Перемкнути показ імен файлів з повним або відносним шляхом"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Фіксація по верху"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Верхній бордюр. Ця величина додається до базового бордюру і використовується для відступу над контролем."

#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Proc Hint"
msgstr "Показувати Підказку Клас/Проц"

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Вершини"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Це список контролів одного рівня для якого верхня сторона зафіксована. Залишити порожнім для батьківського."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Вирівняти по висоті"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Дерево потребує оновлення"

#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Типи (не видалені якщо немає заміни)"

#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr ""

#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr ""

#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr ""

#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr ""

#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr ""

#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr ""

#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr ""

#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr ""

#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr ""

#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr ""

#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr ""

#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr ""

#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr ""

#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr ""

#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr ""

#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr ""

#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr ""

#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr ""

#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr ""

#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr ""

#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr ""

#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr ""

#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr ""

#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr ""

#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr ""

#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr ""

#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr ""

#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr ""

#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr ""

#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr ""

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Не показувати це повідомлення знову."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Помилка в регулярному виразі"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Шрифт без UTF-8"

#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Перейти до рядка:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Не знайдено"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Замінити %s%s%s%s на %s%s%s в цьому місті?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Шукаю: %s"

#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr ""

#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr ""

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Рядок пошуку '%s' не знайдено!"

#: lazarusidestrconsts.lisuethecurre
#, fuzzy
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Поточний шрифт редактора не підтримує UTF-8, але ваша система здається ним користується.%sЦе означає не-ASCII символи, ймовірно, будуть показані невірно.%sВи можете вибрати інший шрифт в параметрах редактора."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Очистити кеш включень (includes)"

#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s байтів"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Доданий:"

#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "в проекті:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Рядків"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Назва:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "ні"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Розмір"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Тип:"

#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Модуль"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "так"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Значення CodeTools"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Не можу перетворити бінарний потік на текст"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Не можу скопіювати компоненти в буфер"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Не можу додати коментар заголовка ресурсу до файлу ресурсу %s%s%s%s.%sМожливо, помилка синтаксису."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Не можу додати ресурс T%s:FORMDATA до файлу ресурсів %s%s%s%s.%sМожливо, помилка синтаксису."

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgstr "Не вдається додати залежність %s, бо пакет %s уже має залежність %s"

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread2
msgid "Unable to add the dependency %s, because the package %s has already a dependency to %s"
msgstr "Не вдається додати залежність %s, бо пакет %s уже має залежність з %s"

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgstr "Не вдається додати залежність %s, бо це створить кругову звлежність. Залежність %s"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Не можу додати %s до проекту, тому що в проекті вже є модуль з такою самою назвою."

#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Не можу зберегти резервний файл %s%s%s як %s%s%s!"

#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sНеможливо змінити клас %s на  %s"

#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr "Не можу змінити заголовок проекту в джерелі.%s%s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Не можу очистити теку призначення"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Не можу очистити %s%s%s.%sПеревірте доступ."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Не можу перетворити компонент з текстового на бінарний формат:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Не можу перевести файл %s%s%s%sПомилка: %s"

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Не можу перетворити текстові дані форми файлу %s%s%s%s%sна двійковий потік. (%s)"

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Не можу скопіювати файл"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Не можу скопіювати файл %s%s%s%sв %s%s%s"

#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Не можу скопіювати файл %s%s%s%sв %s%s%s."

#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Не можу створити резервну теку %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Не можу створити теку %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Не можу створити теку %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Не можу створити файл"

#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Не можу створити файл %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Не можу створити файл%s%s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile4
msgid "Unable to create file %s"
msgstr ""

#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Не можу створити файл %s%s%s."

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Не можу створити посилання %s%s%s з ціллю %s%s%s"

#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file, because there is already a directory with this name."
msgstr "Не можу створити новий файл, бо тека з таким іменем вже існує."

#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr "Не можу створити новий метод."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Не можу створити тимчасовий lfm буфер"

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Не можу видалити"

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Не можу видалити двозначний файл %s%s%s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Не можу знайти секцію ResourceString в цьому чи будь-якому з використовуваних модулів."

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Не можу знайти правильну назву класу в %s%s%s"

#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Не можу знайти файл %s%s%s."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, fuzzy
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Не можу знайти файл %s%s%s.%sЯкщо він належить до вашого проекту, перевірте шлях пошуку в%sПроект -> Параметри Компілятора -> Шляхи Пошуку -> Інші Файли Модулів. Якщо файл належить пакунку, перевірте відповідні опції компілятора пакету. Якщо цей файл відноситься до lazarus, переконайтесь що компілюєте начисто. Якщо файл належить FPC тоді перевірте fpc.cfg. Якщо не впевнені, перевірте Проект -> Параметри Компілятора -> Текст"

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Не можу знайти %s в LFM Потоці"

#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Не можу знайти метод."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, fuzzy
#| msgid "Unable to find Pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s%s%s%s"
msgstr "Не можу знайти модуль Паскаля (.pas,.pp) для .lfm файл%s%s%s%s"

#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Не можу побудувати зміни редактора"

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Не можу знайти код для дизайнера"

#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr "Не можу завантажити файл:%s%s"

#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr "не можу завантажити файл %s: %s"

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Не можу завантажити пакунок %s%s%s"

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Неможливо завантажити клас компоненту  %s%s%s через те, що він залежить сам від себе. "

#: lazarusidestrconsts.lisunabletoopen
msgid "Unable to open \"%s\""
msgstr ""

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Не вдалося відкрити компонент предок"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Не можу відкрити дизайнер.%sКлас %s не походить від розробляємого класу типу TForm або TDataModule."

#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Не можу прочитати %s"

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Не можу прочитати файл"

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Не можу прочитати файл %s%s%s!"

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Не можу прочитати файл %s%s%s%sПомилка: %s"

#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Не можу прочитати файл %s%s%s."

#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr "Не можу прочитати lpi"

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Не можу прочитати файл інформації проекту%s%s%s%s."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Не можу прочитати файл інформації проекту%s%s%s%s."

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Не можу стерти старий резервний файл %s%s%s!"

#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr "Не можу видалити заголовок проекту з джерела.%s%s"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Не можу змінити назву двозначного файла %s%s%s%sв %s%s%s"

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Не можу змінити назву файла"

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Не можу змінити назву файла %s%s%s в %s%s%s!"

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Не можу змінити назву файла %s%s%s%sв %s%s%s."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Неможливо змінити назву форми в коді"

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Не можу змінити назву метода. Виправте помилку. Див. вікно повідомлень."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Неможливо змінити назву змінної в коді."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Не можу запустити"

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Неможливо встановити AnchorSide Control"

#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Не можу відобразити метод."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Не можу скопіювати вибрані компоненти в потік"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Не можу скопіювати вибрані компоненти в потік"

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Не можу створити потік %s:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Не можу перевести двійковий компонент потоку %s:T%s на текст."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Неможливо оновити вираз CreateForm в коді проекту"

#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Не можу записати %s%s%s%s%s."

#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Не можу записати %s%s%s"

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Не можу записати файл"

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Не можу записати файл %s%s%s%sError: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr "Не можу записати файл інформації проекту%s%s%s%s.%sПомилка: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Не можу записати файл сесій проекту%s\"%s\".%sПомилка: %s"

#: lazarusidestrconsts.lisunabletowritetofile
msgid "Unable to write to file %s%s%s."
msgstr "Не можу записати в файл %s%s%s."

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "Не можу записати в файл \"%s\"."

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Не можу записати xml-потік до %s%sПомилка: %s"

#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Зняти мітки з усіх"

#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Повернути"

#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr "Деінсталювати %s"

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Деінсталювання неможливе"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Видалити виділення"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Модуль %s%s%s змінено. Зберегти?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Ідентифікатор модуля існує"

#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s модуль %s в пакунку %s%s"

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Модуль з такою назвою вже є в проекті"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Назва модуля починається з ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Назва модуля включає ..."

#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr "Модуль не знайдено в проекті %s"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Тека для генерації модулів"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "шлях до модуля"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Шляхи до модулів"

#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr "Модулі не знайдено в проекті %s"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "Непідписаний"

#: lazarusidestrconsts.lisunusedunitsof
msgid "Unused units of %s"
msgstr ""

#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Незвичайне ім'я компілятора. Зазвичай воно починається на fpc, ppc чи ppcross."

#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Вверх"

#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr ""

#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr ""

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Оновити залежності?"

#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Модернізація"

#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Параметри модернізації"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "рядок в верхньому регістрі"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "ВЕЛИКИЙ рядок поданий як параметр"

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Повідомлення використання (опція -h)"

#: lazarusidestrconsts.lisuseandclose
msgid "Use and close"
msgstr ""

#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Викор рядки Ansi"

#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr ""

#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Викор. пакунки часу розробки"

#: lazarusidestrconsts.lisuseexcludefilter
#| msgid "Use Exclude Filter"
msgid "Use exclude filter"
msgstr "Використовувати фільтр виключень"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Використати ідентифікатор"

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Використати ідентифікатор %s в %s на %s"

#: lazarusidestrconsts.lisuseincludefilter
#| msgid "Use Include Filter"
msgid "Use include filter"
msgstr "Використовувати фільтр включень"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Запуск програми"

#: lazarusidestrconsts.lisusemessagefile
msgid "Use message file:"
msgstr "Викор файл повідомлень:"

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Використати пакунок %s в пакунку %s"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Використати пакунок в пакунку"

#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Використати пакунок %s в проекті"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Використати пакунок в проекті"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr ""

#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr ""

#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr ""

#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr ""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Домашня тека користувача"

#: lazarusidestrconsts.lisusesub
msgctxt "lazarusidestrconsts.lisusesub"
msgid "Use >>"
msgstr "Використати >>"

#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Додати Unit до секції Uses"

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Викор. модуль %s в модулі %s"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 з BOM"

#: lazarusidestrconsts.lisvalue
#| msgid "Value:"
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Змінна"

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Змінна%s"

#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Змінна: "

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Змінні"

#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Змінна"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Виклики перевірки методу"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Версія"

#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Помилкова версія"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Вертикально"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Копіювати дані про версію в буфер"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Властивості Точки Зупинки ..."

#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr "Дивитись джерело"

#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "Перемкнути вигляд Асемблер"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Переглянути код (.lfm)"

#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Попередження: "

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Попередження: знайдений двозначний файл %s%s%s. Код: %s%s%s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sУвага: Це основний модуль. Новий основний модуль буде %s.pas."

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Спостерігати"

#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr "Огляд:"

#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr "Дія огляду"

#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr "Читання"

#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr "Читання/Запис"

#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr "Запис"

#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr "Точка зупинки &Даних/Огляду ..."

#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr "Точка зупинки &Даних/огляду ..."

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Властивості Спостерігання"

#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr "Межі огляду"

#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "Глобально"

#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr "Оголошення"

#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr "Створити точку зупинки &Даних/Огляду ..."

#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr "Вітаємо в Lazarus IDE %s"

#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%s%sThere is already a configuration from version %s in%s%s%s"
msgstr "Вітаємо в Lazarus %s%s%sВже існує конфігурація з версії %s в%s%s%s"

#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Що потребує побудови"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
#| msgid "When a unit is renamed, update references ..."
msgid "When a unit is renamed, update references"
msgstr "Коли модуль перейменований оновити залежності"

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "Якщо ввімкнено поточні налаштування зберігаються в шаблон, який використовується при створенні нових проектів"

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Коли рухається курсор редактора коду, показати поточний вузол в провіднику коду"

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", з включеннями "

#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Без належного компілятора перегляд і компілювання коду буде невтішним."

#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr ""

#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Без правильної теки Lazarus ви отримаєте багато попереджень."

#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr ""

#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Без належного початковогокоду FPC перегляд і завершення буде дуже обмеженим."

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "З необхідними пакунками"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "Ви&далити Всі"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "Н&едоступні Всі"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "В&вімкнути Все"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Вираз"

#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr ""

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Властивості"

#: lazarusidestrconsts.liswlwatchlist
#| msgid "Watch list"
msgid "Watch List"
msgstr "Список Спостережень"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Слово під курсором в цьому редакторі"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Робоча тека для побудови"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Робоча тека для виконання"

#: lazarusidestrconsts.lisworkingdirectorynotfound
msgid "Working directory %s not found"
msgstr "Робоча тека %s не знайдена"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Помилка запису"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Помилка запису: %s%sФайл: %s%s%s"

#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr "невірна версія в %s: %s"

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Помилка XML"

#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "Файли XML"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Помилка розбору XML в файлі %s%sПомилка: %s"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Ви можете вимкнути  це для окремих форм в редакторі пакетів"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Ви можете вимкнути  це для окремих форм в спливаючому меню в інспекторі проектів"

#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr ""

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
#, fuzzy
#| msgid "You can not build lazarus while debugging or compiling."
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Ви не можете перебудувати lazarus при налагоджуванні або компіляції."

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Редактор тексту"

#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr ""

#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr ""

#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr ""

#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr ""

#: lazarusidestrconsts.lrspldunabletodeletefile
msgid "Unable to delete file \"%s\""
msgstr ""

#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr ""

#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr ""

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Додати модуль пакунку в секцію uses"

#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Бінарне"

#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Десятковий"

#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr "Показувати тип вибраних Регістрів"

#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr ""

#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr "Шістнадцятковий"

#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr "Вісімковий"

#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr "Сирі дані"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Додати Зворотнє"

#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr ""

#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr ""

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Автоматично збільшувати номер білду"

#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "Доступні сканери"

#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "По&будувати:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Набір символів:"

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Закрити поточну сторінку"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Умовні визначення"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Створити нове визначення"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Ввімкнути i18n"

#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr ""

#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr "Фільрувати рядки в списку з текстом"

#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Файл форми (*.dfm)|*.dfm"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "Знайдено, але тут не вказано: "

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Параметри i18n"

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Включити версію в виконуваний файл"

#: lazarusidestrconsts.rsiwpcolumnnameshint
msgid "Column Names"
msgstr ""

#: lazarusidestrconsts.rsiwpcolumnstrategyhint
msgid "Strategy for saving Columns"
msgstr ""

#: lazarusidestrconsts.rsiwpcolumnwidthhint
msgid "Column Width"
msgstr ""

#: lazarusidestrconsts.rsiwpcustomgeometry
msgid "Custom geometry"
msgstr ""

#: lazarusidestrconsts.rsiwpcustomgeometryhint
msgid "User can define window's position and size"
msgstr ""

#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
msgid "Fixed default geometry"
msgstr ""

#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
msgid "Always the same fixed position and size"
msgstr ""

#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
msgid "Let windowmanager decide"
msgstr ""

#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
msgid "System windowmanagers have different strategies for positioning windows"
msgstr ""

#: lazarusidestrconsts.rsiwppositionwindowlisthint
msgid "Windows that have been open. They may be closed now."
msgstr ""

#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Відновити геометрію вікна"

#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
msgid "Use previous position and size"
msgstr ""

#: lazarusidestrconsts.rsiwpsplittercustomposition
msgid "Custom Size"
msgstr "Власний Розмір"

#: lazarusidestrconsts.rsiwpsplitterdefault
msgid "Default Size"
msgstr "Типовий Розмір"

#: lazarusidestrconsts.rsiwpsplitterfollowwindow
msgid "Restore with window"
msgstr "Відновити з вікном"

#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
msgid "Restore Size"
msgstr "Відновити Розмір"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Африкаанс"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Арабська"

#: lazarusidestrconsts.rslanguageautomatic
#, fuzzy
#| msgid "Automatic (or english)"
msgid "Automatic (or English)"
msgstr "Автоматично (або англійською)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Каталонська"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Китайська"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Чеська"

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Голландська"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Англійська"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Фінська"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Французька"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Німецька"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Іврит"

#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr ""

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Індонезійська"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Італійська"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Японська"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Литовська"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Параметри Мови"

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Польська"

#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr "Португальська"

#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "Бразильська португальська"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Російська"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Вибір мови:"

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Словацька"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Іспанська"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Турецька"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Українська"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "&Основна версія:"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "&Другорядна версія:"

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Інша Інформація"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Результуюча Тека PO:"

#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr ""

#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr ""

#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr ""

#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Тип"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Ревізія:"

#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "Сканери"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Виберіть успадкований елемент"

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Почати новий пошук"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Нумерація версій"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Команди меню Довідка"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Команда команди"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Команди Інструментів Коду"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Команди виділення стовпців тексту"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Команди переміщення курсора"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Команди редагування тексту"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Команди файлового меню"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Команди згортання тексту"

#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Макроси"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Команди маркера тексту"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Команди Меню Пакунок"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Команди меню Проект"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Команди меню Виконати"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Команди пошуку і заміни тексту"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Команди виділення тексту"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Команди блокноту зауважень до тексту програми"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Синхронне Редагування"

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Синхронне Редагування (не в Клітинці)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Синхронне редагування (при виділенні)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Редагування Шаблонів"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Редагування Шаблонів (не в Клітинці)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Команди меню Інструменти"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Команди меню Переглядання"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Команда:"

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Конфлікт "

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "перервати побудову"

#: lazarusidestrconsts.srkmecabstractmethods
#| msgid "Abstract methods ..."
msgid "Abstract Methods ..."
msgstr "Абстрактні Методи ..."

#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "додати точку зупинки за адресою"

#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "додати точку зупинки в початковому коді"

#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "додати дані/точку огляду"

#: lazarusidestrconsts.srkmecaddjumppoint
#| msgid "Add jump point"
msgid "Add Jump Point"
msgstr "Додати Точку Переходу"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "додати спостереження"

#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr ""

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Завершення шаблонів коду"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Копіювати Блок"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Видалити Блок"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Перейти до початку Блоку"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Перейти до кінця Блоку"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Сховати Блок"

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Зсунути блок вправо"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Перемістити Блок"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Вказати початок блоку"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Вказати кінець блоку"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Показати Блок"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Перемкнути блок"

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Відмінити зсув блоку вправо"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "побудувати програму/проект"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "побудувати файл"

#: lazarusidestrconsts.srkmecbuildlazarus
#, fuzzy
#| msgid "Build lazarus"
msgid "Build Lazarus"
msgstr "Побудувати lazarus"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Символ"

#: lazarusidestrconsts.srkmeccleanupcompiled
msgid "clean up build files"
msgstr "очистити файли побудови"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Видалити весь текст"

#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr ""

#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr ""

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Вибір Стовпців Знизу"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Вибір Стовпців до абсолютного кінця"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Вибір Стовпців до абсолютного початку"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Вибір Стовпців Зліва"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Вибір Стовпців до кінця рядка"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Вибір Стовпців до початку рядка"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Вибір Стовпців до початку тексту в рядку"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Вибрати Сторінку Донизу"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Вибрати Сторінку Знизу"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Вибрати Сторінку Доверху"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Вибрати Сторінку Зверху"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Вибір Стовпців Справа"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Вибір Стовпців Зверху"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Додати до вибору Слово Зліва"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Додати до вибору Слово Справа"

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Режим вибирання колонки"

#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "компілювати програму/проект"

#: lazarusidestrconsts.srkmeccompletecode
#| msgid "Complete code"
msgctxt "lazarusidestrconsts.srkmeccompletecode"
msgid "Complete Code"
msgstr "Завершити Код"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "файл налаштувань побудови"

#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Копіювати вибране у буфер обміну"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Копіювати редактор в нове вікно"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Копіювати редактор в наступне вільне вікно"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Копіювати редактор в попереднє вільне вікно"

#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Вирізати вибране в буфер обміну"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Видалити до початку рядка"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Видалити символ біля курсора"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Видалити до кінця рядка"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Видалити останній символ"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Видалити до початку слова"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Видалити поточний рядок"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Видалити до кінця слова"

#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr ""

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Порівнянти"

#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "Змістити курсор вниз"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Пересунути курсор на абсолютний кінець"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Пересунути курсор на абсолютний початок"

#: lazarusidestrconsts.srkmecemptymethods
#| msgid "Empty methods ..."
msgid "Empty Methods ..."
msgstr "Порожні Методи ..."

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Параметри IDE"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "розрахувати/змінити"

#: lazarusidestrconsts.srkmecextractproc
#| msgid "Extract procedure"
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Видобути Процедуру"

#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Зовнішній інструмент %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Налаштування зовнішнього інструменту"

#: lazarusidestrconsts.srkmecfind
#| msgid "Find text"
msgid "Find Text"
msgstr "Пошук Тексту"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Знайти інший кінець блоку"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Знайти початок блоку"

#: lazarusidestrconsts.srkmecfinddeclaration
#| msgid "Find declaration"
msgid "Find Declaration"
msgstr "Знайти Опис"

#: lazarusidestrconsts.srkmecfindidentifierrefs
#| msgid "Find identifier references"
msgid "Find Identifier References"
msgstr "Знайти Посилання на Ідентифікатор"

#: lazarusidestrconsts.srkmecfindinfiles
#| msgid "Find in files"
msgid "Find in Files"
msgstr "Знайти в Файлах"

#: lazarusidestrconsts.srkmecfindnext
#| msgid "Find next"
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Знайти Далі"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
#| msgid "Find next word occurrence"
msgid "Find Next Word Occurrence"
msgstr "Знайти наступне входження слова"

#: lazarusidestrconsts.srkmecfindoverloads
#| msgid "Find overloads"
msgid "Find Overloads"
msgstr "Знайти Перевантаження"

#: lazarusidestrconsts.srkmecfindoverloadscapt
#| msgid "Find overloads ..."
msgid "Find Overloads ..."
msgstr "Знайти Перевантаження ..."

#: lazarusidestrconsts.srkmecfindprevious
#| msgid "Find previous"
msgid "Find Previous"
msgstr "Знайти Попередній"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
#| msgid "Find previous word occurrence"
msgid "Find Previous Word Occurrence"
msgstr "Знайти попереднє входження слова"

#: lazarusidestrconsts.srkmecfindproceduredefinition
#| msgid "Find procedure definiton"
msgid "Find Procedure Definiton"
msgstr "Знайти Опис Процедури"

#: lazarusidestrconsts.srkmecfindproceduremethod
#| msgid "Find procedure method"
msgid "Find Procedure Method"
msgstr "Знайти Метод Процедури"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Згорнути під Курсором"

#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Згорнути до Рівня %d"

#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Перейти до редактора %d"

#: lazarusidestrconsts.srkmecgotoincludedirective
#| msgid "Go to to include directive of current include file"
msgid "Go to include directive of current include file"
msgstr "Перейти до директиви include поточного включеного файлу"

#: lazarusidestrconsts.srkmecgotolinenumber
#| msgid "Go to line number"
msgid "Go to Line Number"
msgstr "Перейти до номеру рядка"

#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Перейти до маркера %d"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Перейти за координатою XY"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
#| msgid "Guess misplaced $IFDEF"
msgid "Guess Misplaced $IFDEF"
msgstr "Передбачити зміщене $IFDEF"

#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor half-word left"
msgstr "Пересунути курсор на півслова вліво"

#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor half-word right"
msgstr "Пересунути курсор на півслова вправо"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Вставити елемент ChangeLog"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Вставити з таблиці символів"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Вставити ключове слово CVS Author"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Вставити ключове слово CVS Date"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Вставити ключове слово CVS Header"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Вставити ключове слово CVS ID"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Вставити ключове слово CVS Log"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Вставити ключове слово CVS Name"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Вставити ключове слово CVS Revision"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Вставити ключове слово CVS Source"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Вставити поточні дату і час"

#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Вставити повний Шлях до Файлу"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Вставити примітку про GPL"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Вставити GUID"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Вставити примітку про LGPL"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Розірвати рядок, залишити курсор"

#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr ""

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Режим вставки"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Вставити змінений LGPL допис"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Вставити поточне ім'я користувача"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "перевірити"

#: lazarusidestrconsts.srkmecinvertassignment
#| msgid "Invert assignment"
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Інвертувати Присвоєння"

#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "Змістити курсор вліво"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Розірвати рядок і зсунути курсор"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Пересунути курсор в кінець рядка"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Метод вибору рядка"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Пересунути курсор на початок рядка"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Змістити курсор до початку тексту в рядку"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Заблокувати Редактор"

#: lazarusidestrconsts.srkmecmakeresourcestring
#| msgid "Make resource string"
msgid "Make Resource String"
msgstr "Створити Рядок Ресурсу"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Перейти до відпов. дужки"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Пересунути редактор вліво"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Перемістити редактор вліво в кінець"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Перемістити редактор в нове вікно"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Перемістити редактор в наступне вільне вікно"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Перемістити редактор в попереднє вільне вікно"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Пересунути редактор вправо"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Перемістити редактор вправо в кінець"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Наступна закладка"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Перейти до наступного редактора"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Йти до наступного редактора з тим же Джерелом"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Йти до наступного вікна"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Нормальний режим вибрання"

#: lazarusidestrconsts.srkmecopenfileatcursor
#| msgid "Open file at cursor"
msgid "Open File at Cursor"
msgstr "Відкрити файл під Курсором"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Режим перезапису"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Пересунути курсор до низу сторінки"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Пересунути курсор вниз на одну сторінку"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Пересунути курсор вліво на одну сторінку"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Пересунути курсор вправо на одну сторінку"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Пересунути курсор на початок сторінки"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Пересунути курсор на попередню сторінку"

#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Вставити з буфера в поточну позицію"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "призупинити програму"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Попередня закладка"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Перейти до попереднього редактора"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Йти до попереднього редактора з тим же Джерелом"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Йти до попереднього вікна"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "швидке компілювання, без компонування"

#: lazarusidestrconsts.srkmecremovebreakpoint
#| msgid "remove break point"
msgid "remove breakpoint"
msgstr "видалити точку зупинки"

#: lazarusidestrconsts.srkmecremoveemptymethods
#| msgid "Remove empty methods"
msgid "Remove Empty Methods"
msgstr "Видалити Порожні Методи"

#: lazarusidestrconsts.srkmecremoveunusedunits
#| msgid "Remove unused units"
msgid "Remove Unused Units"
msgstr "Видалити Невикористовувані Модулі"

#: lazarusidestrconsts.srkmecrenameidentifier
#| msgid "Rename identifier"
msgid "Rename Identifier"
msgstr "Перейменувати ID"

#: lazarusidestrconsts.srkmecreplace
#| msgid "Replace text"
msgid "Replace Text"
msgstr "Замінити Текст"

#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Повідомити про баг"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "скидання налагоджувача"

#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "Змістити курсор вправо"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "запустити програму"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "запуск файлу"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "параметри запуску"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Прокрутити вниз один рядок"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Прокрутити вліво один символ"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Прокрутити вправо на один символ"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Прокрутити вверх на один рядок"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Виділити вниз"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Виділити всі"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Перетворити табуляцію в пробіли в виділеному"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Виділити до самого кінця"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Виділити до самого початку"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Виділити перехід за коорд."

#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select half-word left"
msgstr "Вибрати півслова вліво"

#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select half-word right"
msgstr "Вибрати півслова вправо"

#: lazarusidestrconsts.srkmecselleft
#, fuzzy
#| msgid "SelLeft"
msgid "Select Left"
msgstr "Виділити зліва"

#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Виділити кінць рядка"

#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Виділити початок рядка"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Виділити до початку тексту в рядку"

#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Виділити низ сторінки"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Виділити сторінку знизу"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Виділити сторінку зліва"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Виділити сторінку справа"

#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Виділити верх сторінки"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Виділити сторінку зверху"

#: lazarusidestrconsts.srkmecselright
#, fuzzy
#| msgid "SelRight"
msgid "Select Right"
msgstr "Виділити справа"

#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr ""

#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr ""

#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr ""

#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr ""

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Виділити вверх"

#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Вибрати кінець слова зліва"

#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Вибрати кінець слова справа"

#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Виділити слово зліва"

#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Виділити слово справа"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Задати вільну Закладку"

#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Встановити позначку %d"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"

#: lazarusidestrconsts.srkmecshowabstractmethods
#| msgid "Show abstract methods"
msgid "Show Abstract Methods"
msgstr "Показати Абстрактні Методи"

#: lazarusidestrconsts.srkmecshowcodecontext
#| msgid "Show code context"
msgid "Show Code Context"
msgstr "Контекст Коду"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "показати точку виконання"

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "зупинити програму"

#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Програти Макрос"

#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Записати Макрос"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Йти до ост. позиції в клітинці"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Йти до пер. позиції в клітинці"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Вибрати клітинку"

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Втеча"

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Наступна Клітинка"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Наступна Клітинка (всі вибрані)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Попередня Клітинка"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Попередня Клітинка (всі вибрані)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Почати Синхронне редагування"

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Йти до ост. позиції в клітинці"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Йти до пер. позиції в клітинці"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Вибрати клітинку"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Втеча"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Фініш"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Наступна Клітинка"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Наступна Клітинка (обертати)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Наступна Клітинка (всі вибрані)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Наступна Клітинка (обертати / всі вибрані)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Попередня Клітинка"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Попередня Клітинка (всі вибрані)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""

#: lazarusidestrconsts.srkmecsyntaxcheck
#| msgid "Syntax check"
msgid "Syntax Check"
msgstr "Перевірка Синтаксису"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Переглянути асемблер"

#: lazarusidestrconsts.srkmectogglebreakpoint
#| msgid "toggle break point"
msgid "toggle breakpoint"
msgstr "перемкнути точку зупинки"

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Переглядання точок зупинки"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Переглядання стеку викликів"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Браузер коду програми"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Показувати оглядач коду"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Переглянути палітру компонетів"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Переглядання виводу налагоджувача"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Перемкнути модуль/форму"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Переглянути Редактор Документації"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Переглянути швидкі клавіші графічної оболонки"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Переглядання локальних змінних"

#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "Перемкнути Маркер %d"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Перемкнути підсвіч Поточного Слова "

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Переглядання повідомлень"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Перемкнути режим"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Показувати Інспектор Об'єктів"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Переглянути регістри"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Дивитись браузер обмежень"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Показувати результати пошуку"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Показувати редактор тексту"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Показувати спостереження"

#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Розгорунти все"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Розгортати під Курсором"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "невідома команда редактора"

#: lazarusidestrconsts.srkmecunusedunits
#| msgid "Unused units ..."
msgid "Unused Units ..."
msgstr "Невикористовувані Модулі ..."

#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "Змістити курсор вгору"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Показувати редактор прив'язок"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Переглянути компоненти"

#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr ""

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Показувати форми"

#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Переглянути Історію"

#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View Terminal Output"
msgstr "Дивитись Вивід Терміалу"

#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Переглянути Порядок Вкладок"

#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Переглянути Потоки"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Показувати залежності модулів"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Показувати відомості про модулі"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Показувати модулі"

#: lazarusidestrconsts.srkmecwordcompletion
#| msgid "Word completion"
msgid "Word Completion"
msgstr "Завершення Слів"

#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "Змістити крусор на кінець слова зліва"

#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "Змістити крусор на кінець слова справа"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Пересунути курсор на слово вліво"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Пересунути курсор на слово вправо"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Змінити кнопки команди"

#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr ""

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Згорнути коментарі в виділенні"

#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr ""

#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr ""

#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr ""

#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr ""

#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr ""

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Сховати коментарі в виділенні"

#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr ""

#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr ""

#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Розгорунти все"

#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr ""

#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr ""

#: lazarusidestrconsts.synfunfoldallinselection
#| msgid "Unfold all in Selection"
msgid "Unfold all in selection"
msgstr "Розгорнути все в виділенні"

#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr ""

#: lazarusidestrconsts.synfunfoldcommentsinselection
#| msgid "Unfold comments in Selection"
msgid "Unfold comments in selection"
msgstr "Розгорнути коментарі в виділенні"

#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr ""

#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr ""

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Файл тільки для читання"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Файл \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" не для запису."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Заблоковано"

#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Запис"

#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Зап-пауза"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Додати спостереження біля курсора"

#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "Додати Точку&Огляду під Курсором"

#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Закладка"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Закрити Всі &Інші Сторінки"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Закрити сторінку"

#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Копіювати назву файлу"

#: lazarusidestrconsts.uemcopytonewwindow
#| msgid "Clone to new Window"
msgid "Clone to New Window"
msgstr "Клонувати в Нове Вікно"

#: lazarusidestrconsts.uemcopytootherwindow
#| msgid "Clone to other Window"
msgid "Clone to Other Window"
msgstr "Клонувати в Інше Вікно"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Нове Вікно"

#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Налагодження"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Кодування"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "&Оцінити/Змінити ..."

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Знайти опис"

#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Знайти в іншому вікні"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Перехід на закладку"

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Маркер"

#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "Слідкувати за ..."

#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Інвертувати присвоєння"

#: lazarusidestrconsts.uemlineending
#| msgid "Line ending"
msgid "Line Ending"
msgstr "Кінець рядка"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Закріпити Сторінку"

#: lazarusidestrconsts.uemmovepageleft
#| msgid "Move page left"
msgid "Move Page Left"
msgstr "Перемістити сторінку вліво"

#: lazarusidestrconsts.uemmovepageleftmost
#| msgid "Move page leftmost"
msgid "Move Page Leftmost"
msgstr "Помістити сторінку в кінці зліва"

#: lazarusidestrconsts.uemmovepageright
#| msgid "Move page right"
msgid "Move Page Right"
msgstr "Перемістити сторінку вправо"

#: lazarusidestrconsts.uemmovepagerightmost
#| msgid "Move page rightmost"
msgid "Move Page Rightmost"
msgstr "Помістити сторінку в кінці справа"

#: lazarusidestrconsts.uemmovetonewwindow
#| msgid "Move to new Window"
msgid "Move to New Window"
msgstr "Перемістити в Нове Вікно"

#: lazarusidestrconsts.uemmovetootherwindow
#| msgid "Move to other Window"
msgid "Move to Other Window"
msgstr "Перемістити в Інше Вікно"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Нове Вікно"

#: lazarusidestrconsts.uemnextbookmark
#| msgid "Goto next Bookmark"
msgid "Goto Next Bookmark"
msgstr "Перейти до наступної закладки"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Змінено"

#: lazarusidestrconsts.uemopenfileatcursor
#| msgid "&Open file at cursor"
msgid "&Open File at Cursor"
msgstr "&Відкрити файл біля курсора"

#: lazarusidestrconsts.uemprevbookmark
#| msgid "Goto previous Bookmark"
msgid "Goto Previous Bookmark"
msgstr "Перейти до попер. закладки"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Процедурний перехід"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Тільки для читання"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Переробка коду"

#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Виконувати до курсора"

#: lazarusidestrconsts.uemsetfreebookmark
#| msgid "Set a free Bookmark"
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Встановити вільну Закладку"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Показувати нумерацію рядків"

#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Джерело"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Перемкнути Закладку"

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "Перемкнути &Точку зупинки"

#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Показувати стек викликів"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Ще не реалізовано"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "ВСТ"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "ЗАМ"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Тільки для читання"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Інформація про Версію"