lazarus/languages/lazaruside.pt.po
2012-04-05 21:07:08 +00:00

18823 lines
573 KiB
Plaintext
Raw Blame History

This file contains invisible Unicode characters

This file contains invisible Unicode characters that are indistinguishable to humans but may be processed differently by a computer. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.

msgid ""
msgstr ""
"Content-Type: text/plain; charset=UTF-8\n"
"Project-Id-Version: Lazarus\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: \n"
"Last-Translator: Marcelo Borges de Paula\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Poedit-Language: Portuguese\n"
"X-Poedit-Country: BRAZIL\n"
#: lazarusidestrconsts.dbgbreakgroupdlgcaptiondisable
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaptiondisable"
msgid "Select Groups"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgcaptionenable
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaptionenable"
msgid "Select Groups"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr ""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Usar esquema predefinido"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Redefinir todas configurações"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Redefinir todas configurações medianiz"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Redefinir todas configurações texto"
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Colar"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Columns)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Lines)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplediff
#| msgid "This page does not represent your current settings. See advandced page. Use this page to reset any advanced changes"
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Esta página não representa suas configurações atuais. Veja página avançada. Use esta página para redefinir quaisquer alterações avançadas."
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Geral"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
#, fuzzy
#| msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Padrão, Todas ações (ponto parada, retração) no Mouse abaixo"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
#, fuzzy
#| msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Extendido, Ações (ponto parada, retração) no Mouse acima. Seleção no Mouse abaixo e movimento"
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Medianiz"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "Mouse direita inclui movimento marca"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Texto"
#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr "Tecla Alt define modo coluna"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
#, fuzzy
#| msgid "Drag Selection (copy/paste)"
msgid "Drag selection (copy/paste)"
msgstr "Arrastar Seleção (copiar/colar)"
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Duplo"
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Quádruplo"
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Triplo"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Botão Central"
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Extra 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Extra 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Direita"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Você tem alterações não salvas. Ao usar esta página, todas alterações feitas na página avançado serão desfeitas"
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr ""
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "<Nenhum>"
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Somente Leitura"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Minúscula, primeira letra maiúscula"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Adicionar operador de atribuição :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Realçar parênteses"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Árvore código retrátil"
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Texto Padrão"
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Ponto de parada desativado"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Ponto de parada ativo"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Linha erro"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Ponto execução"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
#| msgid "Folded code"
msgid "Folded code marker"
msgstr "Marcador código retraído"
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Global"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Medianiz"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Linha"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Edição Síncrona"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Edição Modelo"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Texto"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Separador Medianiz"
#: lazarusidestrconsts.dlgaddhiattrhighlightall
#| msgid "Highlight all"
msgid "Incremental others"
msgstr "Outros Incrementais"
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Realçar palavra atual"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
#| msgid "Incremental search match"
msgid "Incremental search"
msgstr "Busca incremental"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Ponto de parada inválido"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
#| msgid "Line highlight"
msgid "Current line highlight"
msgstr "Realce linha atual"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Número linha"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Linha modificada"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Vínculo \"mouse\""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
#| msgid "SyncronEdit Range"
msgid "Selected Area"
msgstr "Área selecionada"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
#| msgid "SyncronEdit Current Cells"
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Célula Ativa"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
#| msgid "SyncronEdit Other Cells"
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Outras Células"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
#| msgid "SyncronEdit Syncron Cells"
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Células sincronizadas"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
#| msgid "TemplateEdit Current"
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Célula Ativa"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
#| msgid "TemplateEdit Cells"
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Outras Células"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
#| msgid "TemplateEdit Sync"
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Células Sincronizadas"
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Bloco texto"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Ponto de parada desconhecido"
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Palavra entre Parênteses"
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr ""
#: lazarusidestrconsts.dlgadditionalsrcpath
#, fuzzy
#| msgid "Additional Source search path for all projects (.pp;.pas)"
msgid "Additional source search path for all projects (.pp;.pas)"
msgstr "Caminho de busca adicional de fontes para todos os projetos (.pp;.pas)"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Adicionar ponto e vírgula"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Ajustar linha superior devido ao comentário em frente"
#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Todos os arquivos"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabeticamente"
#: lazarusidestrconsts.dlgalreadyusesallotherunits
msgid "\"%s\" already uses all the units in this project"
msgstr ""
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Cursor sempre visível"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Ação ambígua de arquivos:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Aviso ao compilar"
#: lazarusidestrconsts.dlgapplicationsettings
#, fuzzy
#| msgid "Application Settings"
msgid "Application settings"
msgstr "Configurações da Aplicação"
#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "Padrão"
#: lazarusidestrconsts.dlgassertcode
#, fuzzy
#| msgid "Include Assertion Code"
msgid "Include assertion code"
msgstr "Incluir Código de Afirmação"
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Formulários auto. criados"
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Quando criar novos formulários, adicioná-los a formulários auto. criados"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Auto excluir arquivos"
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "Ocultar \"mouse\" ao digitar"
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Auto identar"
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Setup smart indent)"
msgstr "(Configurar identação inteligente)"
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Auto identar"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Auto remover métodos vazios"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Auto renomear arquivo em minúsculas"
#: lazarusidestrconsts.dlgautosave
#, fuzzy
#| msgid "Auto save"
msgid "Auto Save"
msgstr "Auto-Salvar"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Formulários disponíveis:"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Plano de fundo"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(sem subdiretório)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Mesmo nome (no subdiretório)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Antes de métodos"
#: lazarusidestrconsts.dlgblockgroupoptions
#, fuzzy
#| msgid "Selection:"
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Seleção:"
#: lazarusidestrconsts.dlgblockindent
#, fuzzy
#| msgid "Block indent"
msgid "Block indent (spaces)"
msgstr "Identação bloco"
#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr "Identação método"
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Espaço/Tab. como linha anterior"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Posicionar somente"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Espaços"
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr ""
#: lazarusidestrconsts.dlgbp7cptb
#, fuzzy
#| msgid "TP/BP 7.0 Compatible"
msgid "TP/BP 7.0 compatible"
msgstr "Compatibilidade com TP/BP 7.0"
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Realçar parênteses"
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr "Correspondendo pares parênteses"
#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr "Arquivo de mensagens do compilador Free Pascal (*.msg)|*.msg|Todos (*.*)|*.*"
#: lazarusidestrconsts.dlgbuildmodes
msgid "Build Modes"
msgstr ""
#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Aplicar"
#: lazarusidestrconsts.dlgcasesensitive
#, fuzzy
#| msgid "&Case Sensitive"
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Sensível maiúsc./minúsc."
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Verificando opções do compilador"
#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Resultados"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Testar"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Teste: Verificando compilador ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Teste: Verificando configurações compilador ..."
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "Teste: Verificando config. fpc ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Teste: Verificando data compilador ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Teste: Compilando um arquivo vazio ..."
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Teste: Verificando falta fpc ppu ..."
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Teste: Verificando fontes no caminho de busca ppu fpc ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Teste: Compilando um arquivo vazio"
#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Ordem da Classe"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Por último"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "minúsculas"
#: lazarusidestrconsts.dlgcdtpreview
#, fuzzy
#| msgid "Preview (Max line length = 1)"
msgid "Preview (max line length = 1)"
msgstr "Visualizar (Tam. máximo linha=1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Prefixo Ler"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Sufixo Armazenar"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "MAIÚSCULAS"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefixo Variável"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Prefixo Escrever"
#: lazarusidestrconsts.dlgcentercursorline
#, fuzzy
#| msgid "Center Cursor Line"
msgid "Center cursor line"
msgstr "Centralizar linha do cursor"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Salvar Como - Auto renomear arquivos Pascal em minúsculas"
#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Verificar consistência"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Verificar pacotes na criação formulário"
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Escolha o arquivo de modelos de código (*.dci)"
#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Regra inserção partes Classe"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Exibir botões de fechar no \"notebook\""
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Esquema de cores"
#: lazarusidestrconsts.dlgcmacro
#, fuzzy
#| msgid "C Style Macros (global)"
msgid "C style macros (global)"
msgstr "Estilo de Macros C (global)"
#: lazarusidestrconsts.dlgcoansistr
#, fuzzy
#| msgid "Use Ansi Strings"
msgid "Use ansi strings"
msgstr "Usar Sequências de Caracteres Ansi"
#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "Como está"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr "Estilo assembler:"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Mensagens"
#: lazarusidestrconsts.dlgcochecks
#, fuzzy
#| msgid "Checks:"
msgid "Checks"
msgstr "Verificações:"
#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Compilação"
#: lazarusidestrconsts.dlgcoconditionals
msgctxt "lazarusidestrconsts.dlgcoconditionals"
msgid "Conditionals"
msgstr "Condicionais"
#: lazarusidestrconsts.dlgcocops
#, fuzzy
#| msgid "C Style Operators (*=, +=, /= and -=)"
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Estilo de Operadores C (*=, +=, /= and -=)"
#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr "Criar nó filho"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Criar Makefile"
#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr "Criar nó acima"
#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr "Criar nó abaixo"
#: lazarusidestrconsts.dlgcodbx
#, fuzzy
#| msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgid "Generate debugging info for DBX (slows compiling)"
msgstr "Gerar Informações de Depuração para DBX (Retarda a compilação)"
#: lazarusidestrconsts.dlgcodebugging
#, fuzzy
#| msgid "Debugging Info"
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging info"
msgstr "Depuração:"
#: lazarusidestrconsts.dlgcodebugging2
#, fuzzy
#| msgid "Debugging:"
msgctxt "lazarusidestrconsts.dlgcodebugging2"
msgid "Debugging"
msgstr "Depuração:"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Caminho adicional do Depurador (nenhum):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Criação de código"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Ambos"
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Retrair"
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Ocultar"
#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr "Mouse"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Inverter ordem-retração no \"Popup\""
#: lazarusidestrconsts.dlgcodegeneration
#, fuzzy
#| msgid "Code generation"
msgid "Code Generation"
msgstr "Geração código"
#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Opções das Ferramentas de Código"
#: lazarusidestrconsts.dlgcofast
#, fuzzy
#| msgid "Faster Code"
msgid "Faster code"
msgstr "Código mais rápido"
#: lazarusidestrconsts.dlgcogdb
#, fuzzy
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "Gerar Informações de depuração para GDB (Retarda a compilação)"
#: lazarusidestrconsts.dlgcoheaptrc
#, fuzzy
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Usar a unidade Heaptrc"
#: lazarusidestrconsts.dlgcoincfiles
#, fuzzy
#| msgid "Include Files (-Fi):"
msgid "Include files (-Fi):"
msgstr "Arquivos de Inclusão (-Fi)"
#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Herança"
#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Manter certas variáveis nos registradores"
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Bibliotecas (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Vinculando"
#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Carregar/Salvar"
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Cor"
#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr "Exportar"
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Editar Cor)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Não modificado"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Cores"
#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Parâmetros linha de comando"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parâmetros linha de comando (sem nome da aplicação)"
#: lazarusidestrconsts.dlgcompilermessage
#, fuzzy
#| msgid "Compiler Messages"
msgid "Compiler messages"
msgstr "Mensagens do compilador"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr "Arquivo de idioma das mensagens do compilador"
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Opções do Compilador"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Completar Propriedades"
#: lazarusidestrconsts.dlgconfigfiles
#, fuzzy
#| msgid "Config Files:"
msgid "Config files"
msgstr "Arquivos de configuração:"
#: lazarusidestrconsts.dlgconormal
#, fuzzy
#| msgid "Normal Code"
msgid "Normal code"
msgstr "Código Normal"
#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Opções: "
#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Outros"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Transbordamento (Overflow)"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analisando sintaxe"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Copiar/Colar com info. retração"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Selecionar/Copiar palavra se nada selecionado"
#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Faixa"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr ""
#: lazarusidestrconsts.dlgcoshowerr
#, fuzzy
#| msgid "Show Errors"
msgid "Show errors"
msgstr "Exibir Erros"
#: lazarusidestrconsts.dlgcoshowoptions
#| msgid "Show Options"
msgid "&Show Options"
msgstr "E&xibir Opções"
#: lazarusidestrconsts.dlgcosmaller
#, fuzzy
#| msgid "Smaller Code"
msgid "Smaller code"
msgstr "Código menor"
#: lazarusidestrconsts.dlgcosmartlinkable
#, fuzzy
#| msgid "Smart Linkable"
msgid "Smart linkable"
msgstr "Vinculação inteligente"
#: lazarusidestrconsts.dlgcosources
#, fuzzy
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Outros Fontes (arquivos .pp/.pas, usado somente pela IDE não pelo Compilador)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Pilha (Stack)"
#: lazarusidestrconsts.dlgcostrip
#, fuzzy
#| msgid "Strip Symbols From Executable"
msgid "Strip symbols from executable"
msgstr "Remover símbolos do executável (STRIP)"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Choose type of debug info"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automático"
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr ""
#: lazarusidestrconsts.dlgcounitstyle
#, fuzzy
#| msgid "Unit Style"
msgid "Unit style"
msgstr "Estilo de unidade:"
#: lazarusidestrconsts.dlgcouseasdefault
#| msgid "Use these settings as default for new projects"
msgid "Use these compiler options as default for new projects"
msgstr "Usar estas opções como padrão para novos projetos"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Gerar código para valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Detalhes"
#: lazarusidestrconsts.dlgcppinline
#, fuzzy
#| msgid "C++ Styled INLINE"
msgid "C++ styled INLINE"
msgstr "INLINE Estilo C++"
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "Ctrl-clique-central na aba fecha todas as outras"
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Cursor além fim de linha (EOL)"
#: lazarusidestrconsts.dlgcursorgroupoptions
#, fuzzy
#| msgid "Cursor:"
msgid "Cursor"
msgstr "Cursor:"
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Cursor salta seleção"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "Cursor salta tabulações"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Extensão definida pelo usuário (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Editor caminhos"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Caminho e tipo de depurador"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Fonte padrão do Editor"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Valor padrão"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Excluir modelo "
#: lazarusidestrconsts.dlgdeplhicomp
#, fuzzy
#| msgid "Delphi Compatible"
msgid "Delphi compatible"
msgstr "Compatível com o Delphi"
#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Área de Trabalho"
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Botões -"
#: lazarusidestrconsts.dlgdesktopfiles
#, fuzzy
#| msgid "Desktop files"
msgid "Desktop Files"
msgstr "Arquivos da Área de Trabalho"
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Dicas"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menus - "
#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr "Opções diversas"
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Direção"
#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Diretório inexistente"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Desativar \"anti-aliasing\""
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Usar cor margem direita"
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Desenhar nível divisor"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Cor linha aninhada"
#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr "Desenhar divisor"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Cor linha"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedimento/Função"
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Classe/Estrutura"
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Classe/Estrutura (local)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Seções unidade"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Cláusula \"Uses\""
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"
#: lazarusidestrconsts.dlgedadd
#, fuzzy
#| msgid "Add..."
msgid "Add ..."
msgstr "Adicionar..."
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Voltar"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Negrito"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Subdiretório"
#: lazarusidestrconsts.dlgedcodetempl
#, fuzzy
#| msgid "Code templates"
msgid "Code Templates"
msgstr "Modelos de Código"
#: lazarusidestrconsts.dlgedcompleteblocks
#| msgid "Complete blocks"
msgid "Add close statement for pascal blocks"
msgstr "Adicionar instrução para fechar blocos pascal"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Extensão definida pelo usuário"
#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Atraso"
#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(atraso %s seg)"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Exibir"
#: lazarusidestrconsts.dlgededit
#, fuzzy
#| msgid "Edit..."
msgid "Edit ..."
msgstr "Editar..."
#: lazarusidestrconsts.dlgedfiles
#, fuzzy
#| msgid "Editor files"
msgid "Editor Files"
msgstr "Arquivos do editor"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Complemento identificador"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Inverter"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
#| msgid "Ignore Locks, longest unused editor"
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignorar Bloqueios, usar editor em desuso por mais tempo"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignorar Bloqueios, se o editor for o atual"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignorar Bloqueios, se o editor estiver na janela atual"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Bloqueado, se o texto estiver em exibição"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Desbloqueado"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Desbloqueado, se o texto estiver em exibição centralizada"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Nova aba, existente ou nova janela"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Nova aba em nova janela"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Nova aba em janela existente"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
#| msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\"This option will always succeed, further options are never tested."
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Esta opção usará o editor em desuso por mais tempo para o arquivo, mesmo se estiver bloqueado e/ou precise de deslocamento. A determinação do editor em desuso por mais tempo não observa a ordem na qual as janelas foram focadas, mesmo que tenha sido configurada pela opção \"mesmo critério ordem\". Esta opção sempre será bem sucedida, demais opções nunca serão testadas."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Esta opção irá verificar se o atual editor ativo tem o arquivo alvo e em caso positivo, irá usar o editor atual, mesmo se ele estiver bloqueado e/ou precise de deslocamento."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Esta opção irá verificar se existe um editor para o arquivo alvo na janela atual e se existir, irá usar este editor, mesmo se ele estiver bloqueado e/ou precise de deslocamento."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Esta opção ira usar um editor bloqueado (e somente um bloqueado), que não precise se deslocar a fim de mostrar o ponto se salto alvo (ponto de salto alvo já está na área visível da tela)."
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Esta opção irá usar qualquer Editor não bloqueado."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Esta opção irá usar um Editor não bloqueado, que não precise se deslocar a fim de mostrar o ponto de salto alvo (ponto de salto alvo já está na área visível da tela, excluindo 2-5 linhas no topo/base)."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Esta opção irá abrir uma nova Aba em uma Janela existente ou nova, se nenhuma aba bloqueada for encontrada. Esta opção será sempre bem-sucedida, demais opções nunca serão testadas."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
#| msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Se nenhuma aba desbloqueada for encontrada, esta opção irá abrir uma nova Aba em uma nova Janela (mesmo que outra janela existnte possa ser usada para a nova aba). Esta opção será sempre bem-sucedida, demais opções nunca serão testadas."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
#| msgid "This option will open a new Tab in an existing (and only in an existing) Window, if no unlocked tab is found. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "Se nenhuma aba desbloqueada for encontrada, então esta opção irá abrir uma nova Aba em uma Janela existente (e somente em uma existente). Uma aba é aberta somente se a janela existir, e que ainda não tenha um editor para o arquivo alvo."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Itálico"
#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Fonte do Editor"
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr ""
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Opções do editor"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Esquemas globais"
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "Misc."
#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "Não foram encontrados erros nos acessos rápidos."
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Desligado"
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Ligado"
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Sublinhado"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Atributos elemento"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Tecla \"End\" salta para final mais próximo"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Perguntar"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Nota: Arquivos de projetos são todos os arquivos no diretório de projeto"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Cópia de segurança"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Arquivos"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Grade"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Idioma"
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Guias de alinhamento componentes"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Miscelânea"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Nenhum"
#: lazarusidestrconsts.dlgenvotherfiles
#, fuzzy
#| msgid "Other files"
msgid "Other Files"
msgstr "Outros arquivos"
#: lazarusidestrconsts.dlgenvproject
#, fuzzy
#| msgid "Project"
msgid "Tabs for project"
msgstr "Projeto"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Focar mensagens após compilação"
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Espaço extra carac."
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Espaços extra linhas"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Usar arquivo depuração externo gdb"
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Extensões de arquivo"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Localizar texto sob o cursor"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Pedaço"
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Pedaço seção"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Comentário"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Nó"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Item"
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Lista <>"
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Objeto (herdado, em linha)"
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Comentário (* *)"
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (aninhado)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Comentário { }"
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Classe/Objeto"
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "público/privado"
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Comentário aninhado"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procedimento)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedimento"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Programa"
#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr "Record"
#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Comentário //"
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unidade"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Seção unidade"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (global)"
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Comentário"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "TipoDoc"
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Nó"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Processando Instrução"
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Primeiro plano"
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Regra inserção de procedimento"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Manter a ordem dos procedimentos"
#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Caminho do Compilador (ex. %s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Diretório Fonte FPC"
#: lazarusidestrconsts.dlgframecolor
#| msgid "Frame color"
msgid "Text-mark"
msgstr "Marca-Texto"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor de Formulário"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr ""
#: lazarusidestrconsts.dlgfromcursor
#, fuzzy
#| msgid "&From Cursor"
msgid "&From cursor"
msgstr "&Do cursor"
#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Opções"
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Obter Posição"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Global"
#: lazarusidestrconsts.dlggpccomp
#, fuzzy
#| msgid "GPC (GNU Pascal Compiler) Compatible"
msgid "GPC (GNU Pascal Compiler) compatible"
msgstr "Compatível com GPC (Compilador Pascal GNU)"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Gerar código para gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Cor dos esticadores"
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Cor da Grade"
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Tamanho X da Grade"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Tamanho do passo horizontal da grade"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Tamanho Y da Grade"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Tamanho do passo vertical da grade"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Explorador Código"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Ferramentas de código"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Depurador"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Ambiente"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Desfazer Grupo"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Exibir Guias de Alinhamento"
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Medianiz"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Retraido"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Cor da Medianiz"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Cor borda medianiz"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Índice separador medianiz"
#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Largura da Medianiz"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Rolar meia-página"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr ""
#: lazarusidestrconsts.dlgheapsize
#, fuzzy
#| msgid "Heap Size"
msgid "Heap size"
msgstr "Tamanho do Heap"
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Altura:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Ocultar a janela da IDE ao executar"
#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr "Ocultar ícones de mensagens"
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Ocultar aba de janelas em páginas únicas"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Realçar Cor"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Realçar Cor Fonte"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "Esquerda do Cursor"
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "Direita do Cursos"
#: lazarusidestrconsts.dlghintsparametersendernotused
#, fuzzy
#| msgid "Show Hints for parameter \"Sender\" not used"
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Exibir dica parâmetro \"Sender\" não usado"
#: lazarusidestrconsts.dlghintsunused
#, fuzzy
#| msgid "Show Hints for unused units in main source"
msgid "Show hints for unused units in main"
msgstr "Exibir dicas unidades não utilizadas"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Tecla \"Home\" salta para ínicio mais próximo"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Aplicação servidora"
#: lazarusidestrconsts.dlgidentifiercompletion
#, fuzzy
#| msgid "Identifier completion"
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Complemento identificador"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Regra para Identificadores"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Opções IDE"
#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ignorar"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Incluir variáveis de sistema"
#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Identar código para"
#: lazarusidestrconsts.dlgindentstabsgroupoptions
#, fuzzy
#| msgid "Indent and Tabs:"
msgid "Indent and Tabs"
msgstr "Identações e Tabulações:"
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Na frente de métodos"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Nome do construtor precisa ser \"init\" (e o destrutor precisa ser \"done\")"
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr ""
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr ""
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Inserir espaço após"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Inserir espaço na frente de"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Invervalo em segundos"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Saltando (ex. Saltando Métodos)"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Manter posição X cursor"
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Teclas de acesso rápido"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Erros nas teclas de acesso rápido"
#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Esquema de teclas de acesso rápido"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Regra para Palavras-Chaves"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Permitir LABEL e GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Idioma"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Por último (ex. no final do fonte)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Diretório Lazarus (padrão para todos os projetos)"
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Esquerda:"
#: lazarusidestrconsts.dlglefttopclr
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "Linhas guia esquerda, topo"
#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Nível 1 (rápido e amigável ao depurador)"
#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr "Nível 2 (Nível 1 + otimizações rápidas)"
#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Nível 3 (Nível 2 + otimizações lentas)"
#: lazarusidestrconsts.dlglevelnoneopt
#, fuzzy
#| msgid "Level 0 (no extra Optimizations)"
msgid "Level 0 (no extra optimizations)"
msgstr "Nível 0 (nenhuma Otimização extra)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Separação de Linha"
#: lazarusidestrconsts.dlglinklibraries
#, fuzzy
#| msgid "Link Style"
msgid "Link style"
msgstr "Estilo de Vínculo:"
#: lazarusidestrconsts.dlglinksmart
#, fuzzy
#| msgid "Link Smart"
msgid "Link smart"
msgstr "Vínculo inteligente"
#: lazarusidestrconsts.dlglnumsbct
#, fuzzy
#| msgid "Display Line Numbers in Run-time Error Backtraces"
msgid "Display line numbers in run-time error backtraces"
msgstr "Exibir número de linhas nos erros de Tempo de Execução ao rastreá-los"
#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Carregar configurações do arquivo"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Menu Principal"
#: lazarusidestrconsts.dlgmainviewforms
#, fuzzy
#| msgid "View project forms"
msgid "View Project Forms"
msgstr "Exibir formulários do projeto"
#: lazarusidestrconsts.dlgmainviewframes
#, fuzzy
#| msgid "View project frames"
msgid "View Project Frames"
msgstr "Exibir bordas projeto"
#: lazarusidestrconsts.dlgmainviewunits
#, fuzzy
#| msgid "View project units"
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Exibir unidades do projeto"
#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Caminho Make"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margem e medianiz"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Cor dos marcadores"
#: lazarusidestrconsts.dlgmarkupgroup
#, fuzzy
#| msgid "Word under Caret Highlight"
msgid "Highlight of Word under Caret"
msgstr "Realçar Palavra sob Marca"
#: lazarusidestrconsts.dlgmarkupwordfulllen
#| msgid "Ignore bounds for words longer than"
msgid "Match word boundaries for words up to this length:"
msgstr "Comparar limite palavra para palavras até este comprimento:"
#: lazarusidestrconsts.dlgmarkupwordnokeyword
#, fuzzy
#| msgid "Ignore Keywords"
msgid "Ignore keywords"
msgstr "Ignorar Palavras-Chave"
#: lazarusidestrconsts.dlgmarkupwordnotimer
#, fuzzy
#| msgid "Disable Timer for Markup Current Word"
msgid "Disable timer for markup current word"
msgstr "Desativar cronômetro para remarcar palavra atual"
#: lazarusidestrconsts.dlgmarkupwordtrim
#, fuzzy
#| msgid "Trim Spaces (when highlighting current selection)"
msgid "Trim spaces (when highlighting current selection)"
msgstr "Remover espaços (enquanto realçar seleção atual)"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Contador Máximo"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Comprimento máximo da linha:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Máximo de arquivos recentes"
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Máximo de arquivos de projeto recentes"
#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Regra inserção métodos"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mesclar métodos e propriedades"
#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr "Botão"
#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "Esquerda"
#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr "Meio"
#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "Direita"
#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr "Retrair Tudo (Alguns retraídos)"
#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr "Retrair Um (Alguns retraídos)"
#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr "Expandir Todos (Alguns retraídos)"
#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr "Expandir Um (Alguns retraídos)"
#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr "Retrair Todos (Todos expandidos)"
#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr "Retrair Um (Todos expandidos)"
#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr "Configuração 1"
#: lazarusidestrconsts.dlgmousefoldgroup2
msgid "Setting 2"
msgstr "Configuração 2"
#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse:"
msgstr "Mouse:"
#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr "Único"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Duplo"
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Triplo"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Quádruplo"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Qualquer"
#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr "Exportar"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Extra 1"
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Extra 2"
#: lazarusidestrconsts.dlgmouseoptbtnimport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnimport"
msgid "Import"
msgstr "Importar"
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Esquerda"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Meio"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Retroceder"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Direita"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Capturar"
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Mover Marca (extra)"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Atuar no Mouse acima"
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Clique"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Editar Mouse"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Entrada Duplicada"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Esta entrada conflita com uma entrada existente"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Botão"
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "Marca"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Contexto"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Clique"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Acima/Abaixo"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Opção"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Odernação"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Prioridade"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Mouse"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Avançado"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Comando IDE"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Tudo"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Medianiz"
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Árvore retrátil"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Retraído [+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Expandido [-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Números de linha"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Texto"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Seleção"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Outras ações usando o mesmo botão"
#: lazarusidestrconsts.dlgmouseoptotheracthint
#, fuzzy
#| msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Eles podem ser executados dependendo das teclas modificadores, configurações \"Falltrough\", Simples/Duplo, Acima/Abaixo..."
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtro Teclas-Mod."
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Prioridade"
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Mensagens"
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Seleção múltipla"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
#, fuzzy
#| msgid "Find editor for jump targets"
msgid "Find Editor for Jump Targets"
msgstr "Localizar editor para os alvos do salto:"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Ordem à usar para editores correspondentes ao mesmo critério"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Mais recente editor focado para este arquivo"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editor (para arquivo) na mais recente janela focada"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Lista de critérios prioritária para escolher um editor:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Páginas e Janelas"
#: lazarusidestrconsts.dlgmultiwintabgroup
#, fuzzy
#| msgid "Notebook Tabs:"
msgid "Notebook Tabs"
msgstr "Abas \"Notebook\":"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Nomeação"
#: lazarusidestrconsts.dlgnoautomaticrenaming
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Sem renomeação automática"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr ""
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Sem realce"
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Posição abas \"notebook\" fonte"
#: lazarusidestrconsts.dlgnotsplitlineafter
#, fuzzy
#| msgid "Do not split line after:"
msgid "Do not split line after"
msgstr "Não dividir a linha após:"
#: lazarusidestrconsts.dlgnotsplitlinefront
#, fuzzy
#| msgid "Do not split line In front of:"
msgid "Do not split line in front of"
msgstr "Não dividir linha na frente de:"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inspetor de Objetos"
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Altura do Item"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Miscelânea"
#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Opções"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Configurações rápidas"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Usar configurações Delphi padrão"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Usar configurações Lazarus padrão"
#: lazarusidestrconsts.dlgoptimiz
#, fuzzy
#| msgid "Optimizations:"
msgid "Optimizations"
msgstr "Otimizações"
#: lazarusidestrconsts.dlgotherunitfiles
#, fuzzy
#| msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgid "Other unit files (-Fu) (delimiter is semicolon):"
msgstr "Outros arquivos de unidade (-Fu) (ponto e vírgula como delimitador)"
#: lazarusidestrconsts.dlgoverwriteblock
#, fuzzy
#| msgid "Overwrite Block"
msgid "Overwrite block"
msgstr "Sobrescrever Bloco"
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Dicas para a paleta de componentes"
#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Extensão Pascal padrão"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Realçar declarações de controle como palavras-chave"
#: lazarusidestrconsts.dlgpasextkeywordsgroup
#, fuzzy
#| msgid "Extended Pascal keyword options"
msgid "Extended Pascal Keyword Options"
msgstr "Opções palavras-chave Pascal Extendido"
#: lazarusidestrconsts.dlgpassoptslinker
#, fuzzy
#| msgid "Pass Options To The Linker (Delimiter is space)"
msgid "Pass options to linker (delimiter is space)"
msgstr "Enviar opções ao vinculador (espaço como delimitador)"
#: lazarusidestrconsts.dlgpasstringkeywords
#, fuzzy
#| msgid "Highlight String keyword(s)"
msgid "Highlight \"String\" keyword(s)"
msgstr "Realçar palavra(s)-chave \"String\""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Padrão"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Nenhum"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Apenas \"String\""
#: lazarusidestrconsts.dlgpersistentblock
#, fuzzy
#| msgid "Persistent Block"
msgid "Persistent block"
msgstr "Persistir Bloco"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Cursor persistente"
#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr "Grupo pacotes"
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplicação"
#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr "Limpar ícone"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Criar Aplicação Encartada"
#: lazarusidestrconsts.dlgpodpiaware
#, fuzzy
#| msgid "Dpi aware application (for Vista+)"
msgid "Enabled DPI Awareness (for Vista+)"
msgstr "Aplicação \"Dpi Aware\" (para Vista+)"
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formulários"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Ícone:"
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(tamanho: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(nenhum)"
#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr "Carregar ícone"
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Miscelânea"
#: lazarusidestrconsts.dlgpooutputsettings
#, fuzzy
#| msgid "Output Settings"
msgid "Output settings"
msgstr "Configurações de saída"
#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr "Salvar ícone"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sessão"
#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Nome do arquivo alvo:"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Título:"
#: lazarusidestrconsts.dlgpouseappbundle
#, fuzzy
#| msgid "Use Application Bundle for running and debugging (darwin only)"
msgid "Use Application Bundle for running and debugging (Darwin only)"
msgstr "Usar Aplicação encartada para execução e depuração (somente darwin)"
#: lazarusidestrconsts.dlgpousemanifest
#| msgid "Use manifest file to enable themes (windows only)"
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Usar arquivo de manifesto para ativar temas (somente windows)"
#: lazarusidestrconsts.dlgproject
msgid "Project"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Opções de Projeto"
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Opções do Projeto: %s"
#: lazarusidestrconsts.dlgprojfiles
#, fuzzy
#| msgid "Project files"
msgid "Project Files"
msgstr "Arquivos do Projeto"
#: lazarusidestrconsts.dlgpromptonreplace
#, fuzzy
#| msgid "&Prompt On Replace"
msgid "&Prompt on replace"
msgstr "&Perguntar antes de substituir"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Complemento propriedade"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Nome da propriedade"
#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr "Auto fechar o diálogo de compilação"
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Abrir o último projeto ao iniciar"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Exibir espaçamento da borda"
#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Exibir diálogo de compilação"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Exibir grade"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Ajustar à grade"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referência"
#: lazarusidestrconsts.dlgregularexpressions
#, fuzzy
#| msgid "Regular E&xpressions"
msgid "Regular e&xpressions"
msgstr "Expressões &Regulares"
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Substituir &Tudo"
#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace With"
msgid "&Replace with"
msgstr "&Substituir por"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Relatório"
#: lazarusidestrconsts.dlgrightbottomclr
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "Linhas guia direita, base"
#: lazarusidestrconsts.dlgrightclickselects
#, fuzzy
#| msgid "Right Click selects"
msgid "Right click selects"
msgstr "Clique direito seleciona"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Margem Direita"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Diretório de trabalho"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Selecionar netos"
#: lazarusidestrconsts.dlgruberbandcreationcolor
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Criação Banda elástica"
#: lazarusidestrconsts.dlgruberbandselectioncolor
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Seleção Banda elástica"
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Tela (não para win32, ex: 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Ambiente"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Local"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variáveis de sistema"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Usar tela"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Sobreposições de usuário"
#: lazarusidestrconsts.dlgrunparameters
#, fuzzy
#| msgid "Run parameters"
msgid "Run Parameters"
msgstr "Parâmetros de execução"
#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Salvar configurações para arquivo"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Linha salva"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Salvar informações do editor para arquivos fechados"
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Salvar informações do editor somente para arquivos de projeto"
#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Escopo"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Rolar por um à menos"
#: lazarusidestrconsts.dlgscrollgroupoptions
#, fuzzy
#| msgid "Scrolling:"
msgid "Scrolling"
msgstr "Rolagem:"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Exibir dicas de rolagem"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Rolar para o final do arquivo"
#: lazarusidestrconsts.dlgscrollpastendline
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Marca após final da linha"
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Diretório de busca \"%s\" não encontrado."
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Procura terminada pelo usuário."
#: lazarusidestrconsts.dlgsearchcaption
#, fuzzy
#| msgid "Searching..."
msgid "Searching ..."
msgstr "Procurando..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Caminhos"
#: lazarusidestrconsts.dlgselectedtext
#, fuzzy
#| msgid "&Selected Text"
msgid "&Selected text"
msgstr "Texto &Selecionado"
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Redefinir para o padrão"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Definir elemento para padrão"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Variável da propriedade"
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr ""
#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Exibir legendas componentes"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Exibir procedimentos compilados"
#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Exibir opções do compilador"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Exibir números de linha"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Exibir condicionais"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Exibir informações de depuração"
#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Exibir macros definidas"
#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Exibir dicas do editor"
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Exibir tudo"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Exibir info. executável (só Win32)"
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Exibir informações gerais"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Exibir dicas medianiz"
#: lazarusidestrconsts.dlgshowhint
#, fuzzy
#| msgid "Show Hints"
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Exibir Dicas"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Exibir número de linhas"
#: lazarusidestrconsts.dlgshownotes
#, fuzzy
#| msgid "Show Notes"
msgid "Show notes"
msgstr "Exibir Notas"
#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Não exibir nada (somente erros)"
#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Exibir todos \"procs\" no erro"
#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr "Exibir dicas de rolagem"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Exibir sumário"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Exibir arquivos provados"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Exibir arquivos usados"
#: lazarusidestrconsts.dlgshowwarnings
#, fuzzy
#| msgid "Show Warnings"
msgid "Show warnings"
msgstr "Exibir Avisos"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Exibir um único botão na Barra de Tarefas"
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr ""
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Abas inteligentes"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Símbolo no final (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Contador (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Símbolo na frente (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Ajustar às Guias de Alinhamento"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Espaço"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Dicas para botões principais (abrir, salvar, ...)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Editor de Código"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Origem"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr ""
#: lazarusidestrconsts.dlgstatickeyword
#, fuzzy
#| msgid "Static Keyword in Objects"
msgid "Static keyword in objects"
msgstr "Palavra-Chave estática nos objetos"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Parar após números de erros:"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Sub propriedades"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Opções de sintaxe"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tabulações identam blocos"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Exibir números abas no \"notebook\""
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulações para espaços"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Largura tabulações"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Família CPU alvo"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "SO Alvo"
#: lazarusidestrconsts.dlgtargetplatform
#, fuzzy
#| msgid "Target Platform"
msgid "Target platform"
msgstr "Plataforma Alvo:"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Processador Alvo"
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Diretório para criação de projetos de teste"
#: lazarusidestrconsts.dlgtexttofind
#, fuzzy
#| msgid "&Text to Find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "&Texto a Localizar"
#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "O diretório \""
#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "seg"
#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Avaliação da expressão apontada pela ferramenta"
#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Símbolos de ferramentas apontada pela ferramenta"
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Topo:"
#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Nome de arquivo de modelo"
#: lazarusidestrconsts.dlgtrimspacetypecaption
#, fuzzy
#| msgid "Trim Spaces Style"
msgid "Trim spaces style"
msgstr "Estilo remoção espaços"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Marca ou Edita"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Linha editada"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Deixar linha"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Somente posicionar"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Eliminar espaços no final"
#: lazarusidestrconsts.dlguncertopt
#, fuzzy
#| msgid "Uncertain Optimizations"
msgid "Uncertain optimizations"
msgstr "Outras otimizações"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Desfazer após salvar"
#: lazarusidestrconsts.dlgundogroupoptions
#, fuzzy
#| msgid "Undo / Redo:"
msgid "Undo / Redo"
msgstr "Desfazer / Refazer:"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limite Desfazer"
#: lazarusidestrconsts.dlgunitdepcaption
#, fuzzy
#| msgid "Unit dependencies"
msgid "Unit Dependencies"
msgstr "Dependências da unidade"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Atualizar"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Diretório de saída das unidades (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Linha não salva"
#: lazarusidestrconsts.dlgusecodefolding
#, fuzzy
#| msgid "Code folding"
msgid "Code Folding"
msgstr "Retração código"
#: lazarusidestrconsts.dlgusecustomconfig
#, fuzzy
#| msgid "Use additional Compiler Config File"
msgid "Use additional compiler config file"
msgstr "Usar arquivo adicional de configurações do Compilador"
#: lazarusidestrconsts.dlgusedividerdraw
#, fuzzy
#| msgid "Divider drawing"
msgid "Divider Drawing"
msgstr "Desenho do Divisor"
#: lazarusidestrconsts.dlgusefpccfg
#, fuzzy
#| msgid "Use standard Compiler Config File (fpc.cfg)"
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Usar arquivo padrão de configuração do compilador (fpc.cfg)"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Usar inicialização de aplicação"
#: lazarusidestrconsts.dlguseminimumime
msgid "Ime handled by System"
msgstr ""
#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr "Usar arquivo mensagens"
#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Falhou ao carregar esquema do usuário do arquivo %s"
#: lazarusidestrconsts.dlguseschemedefaults
#| msgid "Use global scheme settings"
msgid "Use (and edit) global scheme settings"
msgstr "Usar (e editar) o esquema global de configurações"
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Usar esquema configuração local"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Usar realce de sintaxe"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Usar aba histórico quando fechando abas"
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr ""
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Valor"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Detalhes durante a compilação:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Medianiz visível"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Margem direita visível"
#: lazarusidestrconsts.dlgwholewordsonly
#, fuzzy
#| msgid "&Whole Words Only"
msgid "&Whole words only"
msgstr "&Somente Palavras Completas"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Largura:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Aplicação gráfica Win32"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Janela"
#: lazarusidestrconsts.dlgwinpos
#, fuzzy
#| msgid "Window Positions"
msgid "Window positions"
msgstr "Posições da Janela"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr ""
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Palavras"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Visualizar"
#: lazarusidestrconsts.dlgwritefpclogo
#, fuzzy
#| msgid "Write an FPC logo"
msgid "Write FPC logo"
msgstr "Escrever logotipo FPC"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Componentes multi-selecionados deverm estar num formulário único."
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr ""
#: lazarusidestrconsts.fdmdeleteselection
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Excluir seleção"
#: lazarusidestrconsts.fdmmirrorhorizontal
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Espelho horizontal"
#: lazarusidestrconsts.fdmmirrorvertical
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Espelho vertical"
#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Odernação"
#: lazarusidestrconsts.fdmorderbackone
#| msgid "Back one"
msgid "Back One"
msgstr "Um atrás"
#: lazarusidestrconsts.fdmorderforwardone
#| msgid "Forward one"
msgid "Forward One"
msgstr "Um à frente"
#: lazarusidestrconsts.fdmordermovetoback
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Mover para trás"
#: lazarusidestrconsts.fdmordermovetofront
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Mover para frente"
#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as XML"
msgid "Save Form as XML"
msgstr "Salvar formulário como XML"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr ""
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Escala"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Selecionar Tudo"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr ""
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Tamanho"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opção: Ajustar à grade"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opção: Ajustar para linhas guias"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Ordem-Z"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Em ambos os lados"
#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr ""
#: lazarusidestrconsts.histdlgbtnexport
msgctxt "lazarusidestrconsts.histdlgbtnexport"
msgid "Export"
msgstr "Exportar"
#: lazarusidestrconsts.histdlgbtnimport
msgctxt "lazarusidestrconsts.histdlgbtnimport"
msgid "Import"
msgstr "Importar"
#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr ""
#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgcolumnloc
msgid "Location"
msgstr ""
#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr ""
#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = não, 1 = desenha linhas divisórias apenas para níveis altos, 2 = desenha linhas primeiros dois níveis, ..."
#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Adicionar Arquivo"
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Adicionar Arquivos"
#: lazarusidestrconsts.lisa2paddfilestopackage
#, fuzzy
#| msgid "Add files to package"
msgid "Add Files to Package"
msgstr "Adicionar arquivos ao pacote"
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Adicionar arquivos LFM, LRS, se eles existirem"
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Adicionar ao pacote"
#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Adicionar unidade"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Tipo Ancestral ambíguo"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nome da Classe ambíguo"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nome da Unidade Ambíguo"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Tipo Ancestral"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Uma unidade Pascal deve ter extensão .pp ou .pas"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dependências Quebradas"
#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<escolha um arquivo existente>"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Nome da Classe já existe"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr ""
#: lazarusidestrconsts.lisa2pcreatenewfile
#, fuzzy
#| msgid "Create new file"
msgid "Create New File"
msgstr "Criar novo arquivo"
#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr ""
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dependência"
#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Arquivo já existe"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File %s%s%s already exists in the package."
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Arquivo já existe no pacote"
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Arquivo está em uso"
#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Nome do arquivo:"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Nome do Arquivo"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Arquivo nao é uma unidade"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Tipo Ancestral inválido"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nome da Classe inválido"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Arquivo inválido"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nome de Arquivo Inválido"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nome de unidade inválido"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s não é um nome de unidade válido."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Novo nome de classe:"
#: lazarusidestrconsts.lisa2pnewcomponent
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
msgid "New Component"
msgstr "Novo Componente"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Novo Arquivo"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Pacote não encontrado para a dependência %s%s%s.%sFavor escolher um pacote existente."
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nome da Página muito longo"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Página da Paleta:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Unidades Pascal devem ter extensão .pp ou .pas"
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Diálogo Salvar arquivo"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Encolher ou expandir nome de arquivo"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Exibir tudo"
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Alternar Caminhos"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "O tipo ancestral %s%s%s tem o mesmo nome que%sa unidade%s%s%s."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "O tipo ancestral %s%s%s não é um identificador Pascal válido."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "O nome da classe %s%s%s e tipo ancestral %s%s%s são os mesmos."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "O nome da classe %s%s%s já existe no %sPacote %s%sArquivo: %s%s%s"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "O nome da classe %s%s%s tem o mesmo nome %sa unidade %s%s%s."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "O nome da classe %s%s%s não é um identificador Pascal válido."
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "O arquivo %s%s%s já existe no pacote."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "O arquivo %s%s%s faz parte do projeto atual.%sNão é uma boa ideia compartilhar arquivos entre projetos e pacotes."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "O nome de arquivo %s%s%s é ambíguo, porque o pacote ainda não tem diretório padrão.%sFavor especificar um nome de arquivo com caminho completo."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "A Versão Máxima %s%s%s é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "A Versão Máxima é menor que a Versão Mínima."
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "A Versão Mínima %s%s%s é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "O pacote já tem uma dependência para o pacote %s%s%s."
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "O nome do pacote %s%s%s é inválido.%sFavor escolher um pacote existente."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "O nome da página %s%s%s é muito longo (max 100 caracteres)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "O nome da unidade %s%s%s já existe no pacote:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "O nome da unidade %s%s%s já existe neste pacote."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "O nome da unidade %s%s%s%se nome do arquivo %s%s%s diferem."
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "O nome da unidade %s%s%s não corresponde ao nome do arquivo."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "O nome da unidade %s%s%s é o mesmo de um componente registrado.%sUsá-lo pode causar estranhas mensagens de erro."
#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Nome de arquivo da unidade:"
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Nome de Arquivo da Unidade:"
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Nome da Unidade:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Nome da unidade já existe"
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Nome da Unidade Inválido"
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Examinar unidade em busca do nome de unidade e procedimento de registro"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Abandonar alterações?"
#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "Ocorreu um erro durante a criação do encarte da Aplicação:"
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Abortar tudo"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Abortar todo o carregamento"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Abortar carregamento do projeto"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Abortar carregamento por completo"
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Documentação:"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Sobre IDE"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Sobre o Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Licença: GPL/LGPL. Veja os fontes Lazarus e Free Pascal para detalhes da licença.%sLazarus é uma IDE para criar aplicações gráficas e console com o Free Pascal. Free Pascal é um compilador Pascal e Object Pascal que roda em Windows, Linux, Mac OS X, FreeBSD e mais.%sLazarus é a peça que falta do quebra-cabeças que irá permitir a você desenvolver programas para todas as plataformas citadas em um ambiente semelhante ao Delphi. A IDE é uma ferramenta RAD que inclui um editor de formulários.%sNa medida que o Lazarus evolui nós precisamos de mais desenvolvedores."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Não foi possível encontrar a lista de colaboradores."
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Oficial:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "Um %s não pode conter TControls.%sVocê somente pode colocar componentes não-visuais nele"
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Agradecimentos"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Ação:"
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Ações:"
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Ativar a sintaxe de expressões regulares para texto e substituição (bem parecido com perl)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr ""
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Ativo"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Filtro Ativo"
#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Adicionar"
#: lazarusidestrconsts.lisaddfilesindirectory
msgid "Add Files in Directory"
msgstr ""
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Opções adicionais do compilador herdadas dos pacotes"
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Adiciona novo modo construção, copiando configuração de \"%s\""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Adicionar nova macro"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Adicionar novo conjunto"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Adicionar requisito pacote?"
#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "Adicionar pacote %s ao projeto?"
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Adicionar pacote ao projeto"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Adicionar parênteses parâmetros"
#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr ""
#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Adicionar ao caminho busca arquivos inclusão"
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Adicionar %s ao projeto?"
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Adicionar ao caminho de busca das unidades?"
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Adicionar interfaces unidade"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Adicionar unidade (não recomendado)"
#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr "Adicionar valor:"
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Adicionar valor para macro %s"
#: lazarusidestrconsts.lisaf2paddfiletoapackage
#, fuzzy
#| msgid "Add file to a package"
msgid "Add File to Package"
msgstr "Adicionar arquivo a um pacote"
#: lazarusidestrconsts.lisaf2pdestinationpackage
#, fuzzy
#| msgid "Destination Package"
msgid "Destination package"
msgstr "Pacote de Destino"
#: lazarusidestrconsts.lisaf2pfiletype
#, fuzzy
#| msgid "File Type"
msgid "File type"
msgstr "Tipo de Arquivo"
#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Tem procedimento Registro"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Pacote Inválido"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "ID de Pacote inválida: %s%s%s"
#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Unidade Virtual (fonte não está no pacote)"
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Pacote é somente leitura"
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Pacote %s%s%s não encontrado."
#: lazarusidestrconsts.lisaf2pshowall
#, fuzzy
#| msgid "Show All"
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Exibir tudo"
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "O arquivo %s%s%s%sjá está no pacote %s."
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "O Pacote %s é somente leitura."
#: lazarusidestrconsts.lisaf2punitname
#, fuzzy
#| msgid "Unit Name: "
msgid "Unit name: "
msgstr "Nome da Unidade:"
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Um arquivo %s%s%s já existe.%sSubstituí-lo?"
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr ""
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Alinhamento"
#: lazarusidestrconsts.lisallblockslooksok
#, fuzzy
#| msgid "All blocks looks ok."
msgid "All blocks look ok."
msgstr "Todos os blocos parecem OK."
#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Todos os arquivos"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Todas opções herdadas"
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Permitir Chamadas de Funções"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Permitir busca por múltiplas linhas"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Todas as modificações para %s%s%s%sserão perdidas e o arquivo reaberto."
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Tecla alternativa"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Tecla alternativa (ou sequência de 2 teclas)"
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Sempre"
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr ""
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Sempre ignorar"
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Arquivo ambíguo encontrado"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Arquivo ambíguo encontrado: %s%s%s%sEste arquivo pode ser confundido com %s%s%s%s%sExcluir o arquivo ambíguo?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Arquivos ambíguos encontrados"
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Unidade ambígua encontrada"
#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Unidade ambígua encontrada"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor de Âncora - nenhum controle selecionado"
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Ativo = Incluir %s nas Âncoras"
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Âncora dos controles selecionados"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Ocorreu um erro na última inicialização carregando %s!%s%sCarregar este projeto novamente?"
#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr "Anexar descrição curta à descrição longa"
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Aplicação%sUm programa LCL/Free Pascal gráfico. O fonte do programa é automaticamente mantido pelo Lazarus."
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Nome de classe da &Aplicação"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "Aplicar \"flags\" de contrução (-B) também para as dependências"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Aplicar convenções"
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Uma unidade projeto não pode ser usada por outros pacotes/projetos"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Espaço da borda em torno do controle. Os outros quatro espaços da borda serão adicionados a esse valor."
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Um simples arquivo de programa Pascal.%sEle pode ser usado para um teste rápido e sujo.%sMelhor criar um novo projeto."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Perguntar antes de substituir cada texto encontrado"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr ""
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "Perguntar pelo nome componente após colocá-lo num formulário"
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Perguntar nome de arquivo no comando 'novo arquivo' "
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Perguntar nome ao criar"
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Auto completar: desligado"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Auto completar: ligado"
#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr "Auto Continuar"
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Continuar autom. após:"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Marcações e Correspondências"
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automático"
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr "Auto converter arquivos .lfm para arquivo inclusão .lrs"
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Auto invocar após ponto"
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "quebra de linha"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "espaço"
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "final palavra"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "não adicionar caractere"
#: lazarusidestrconsts.lisautomaticfeatures
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Complementos e Dicas"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Auto exibir"
#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Pacotes disponíveis"
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr ""
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Fazer cópia de segurança dos arquivos modificados"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Arquivo cópia de segurança falhou"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Cria um diretório de cópia de segurança sob o diretório do projeto"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Alterar o nome ou versão do pacote quebra dependências. Essas dependências devem ser alteradas também?%sSelecionar Sim para alterar todas as dependências listadas.%sSelecionar Ignorar para quebrar as dependências e continuar."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "começa"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Relacionado anteriormente"
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
#, fuzzy
#| msgid "Always Build before Run"
msgid "Always build before run"
msgstr "Sempre construir antes de executar"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Comando de construção"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Ao invés de construir o projeto, rodar o comando Construir Arquivo"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Ao invés de executar o projeto, rodar o comando Executar Arquivo"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Comando Executar"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
#, fuzzy
#| msgid "When this file is active in source editor ..."
msgid "When this file is active in source editor"
msgstr "Quando este arquivo estiver ativo no editor de código ..."
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
#, fuzzy
#| msgid "Working directory (Leave empty for file path)"
msgid "Working directory (leave empty for file path)"
msgstr "Diretório de trabalho (Deixar vazio para caminho de arquivo)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Valores não padrão em negrito"
#: lazarusidestrconsts.lisborderspace
#, fuzzy
#| msgid "BorderSpace"
msgid "Border space"
msgstr "Espaço da Borda"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Espaço da Borda Base. Este valor será adicionado para espaço da borda base e usado para o espaço inferior do controle."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Ancoragem Base"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Bases"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Este é o controle irmão ao qual o lado base está ancorado. Deixar vazio para o controle-pai."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Justificar espaço base"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Interromper"
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Propriedades Pontos de Paradas"
#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Navegador para Compilador (%s)"
#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Adicionar"
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Fechar"
#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Excluir"
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Substituir ..."
#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "&Ativo"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Localizar"
#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "&Sair"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Remover"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Substituir"
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Construir"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "construir todos arquivos do projeto/pacote/IDE"
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Construir"
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "construir IDE com pacotes"
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Construção Lazarus falhou"
#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr "Modo construção"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Diferenças entre modos construção"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr "Diferenças para outros modos construção"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Modo:"
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Modos construção"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Construir novo projeto"
#: lazarusidestrconsts.lisbuildnumber
#, fuzzy
#| msgid "Build Number"
msgid "Build number"
msgstr "Número da construção"
#: lazarusidestrconsts.lisbuildproject
msgid "Build project"
msgstr ""
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Construir"
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Chamando %s para criar \"Makefile\" de %s falhou."
#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr ""
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Cancelar"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Cancelar carregamento deste componente"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Cancelar carregamento de Unidade"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Cancelar renomeação"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Impossível compilar projeto"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Não é possível copiar o componente de nível superior."
#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Não é possível criar o arquivo %s%s%s"
#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Não é possível localizar o iniciador do lazarus:%s%s"
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Somente pode ser alterada a classe de TComponents."
#: lazarusidestrconsts.liscaptiondiff
msgctxt "lazarusidestrconsts.liscaptiondiff"
msgid "Diff"
msgstr "Diferenciar (Diff)"
#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr ""
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Alterar Classe de %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "sem classe"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Compilador ambíguo"
#: lazarusidestrconsts.lisccochecktestdir
#, fuzzy
#| msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Favor verificar o diretório Teste em %sAmbiente -> Opções Ambiente -> Arquivos -> Diretório para contrução de projetos teste"
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "O compilador \"%s\" não é um arquivo executável.%sDetalhes: %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "contém"
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Copiar saída para Área de Transferência"
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "As datas dos arquivos .ppu do FPC diferem em mais de uma hora.%sIsto pode significar que eles são de duas instalações diferentes.%sArquivo1: %s%sArquivo2: %s"
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr "arquivo de mensagens em inglês do FPC está faltando:components/codetools/fpc.errore.msg"
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Erro"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ERRO:"
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Caminho de unidade FPC contém um fonte:"
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "Símbolos de nova linha"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "DICA:"
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Compilador inválido"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Caminho de busca inválido"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Diretório de teste inválido"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Unidade faltando"
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "Unidade compilada FPC não encontrada: %s.ppu"
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "Configurações múltiplas do compilador encontradas:"
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "\"fpc.cfg\" não encontrado"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "não é ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu duplicado: %s, %s"
#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "A unidade compilada FPC %s.ppu não foi encontrada.%sTipicamente significa que o seu \"fpc.cfg\" tem um erro. Ou sua instalação FPC está danificada."
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Há um arquivo .ppu mais antigo que o próprio compilador:%s%s"
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "caminho relativo de unidade encontrado no \"fpc.cfg\": %s"
#: lazarusidestrconsts.lisccoseveralcompilers
#, fuzzy
#| msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Há vários compiladores Free Pascal no caminho. %s%s%sTalvez você tenha se esquecido de excluir um compilador antigo?"
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Pular"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "caracteres especiais"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Sucesso em todos os testes"
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Impossível criar Arquivo Teste"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "Impossível criar arquivo pascal Teste \"%s\"."
#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "Impossível obter data do arquivo %s."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "caracteres não usuais"
#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Aviso"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "AVISO:"
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "delimitador de caminho incorreto"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Categorias"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Complexidade"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Constantes"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Blocos vazios"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Seções de classe vazias"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Construções vazias"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Procedimentos vazios"
#: lazarusidestrconsts.liscefilter
#, fuzzy
#| msgid "(Filter)"
msgid "(filter)"
msgstr "(Filtro)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Seguir cursor"
#: lazarusidestrconsts.liscein
msgid "%s in %s"
msgstr "%s no %s"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "É um controle raiz"
#: lazarusidestrconsts.liscelongparamlistcount
#, fuzzy
#| msgid "Parameters count treating as \"many\""
msgid "Parameters count treated as \"many\""
msgstr "Núm. parâmetros tratados como \"muitos\""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Procedimentos longos"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Núm. linhas de procedimentos tratados como \"longo\""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Muitos procedimentos aninhados"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Muitos parâmetros"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Exibir Categorias"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Exibir Nós Fonte"
#: lazarusidestrconsts.liscenestedproccount
#, fuzzy
#| msgid "Nested procedures count treating as \"many\""
msgid "Nested procedures count treated as \"many\""
msgstr "Núm. procedimentos aninhados tratados como \"muitos\""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
#, fuzzy
#| msgid "Center control horizontally relative to the given sibling"
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Centralizar controle horizontalmente em relação ao controle-irmão especificado"
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
#, fuzzy
#| msgid "Center control vertically relative to the given sibling"
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Centralizar controle verticalmente em relação ao controle-irmão especificado"
#: lazarusidestrconsts.liscenterform
#, fuzzy
#| msgid "Center form"
msgid "Center Form"
msgstr "Centralizar formulário"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centralizar na janela"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Centros"
#: lazarusidestrconsts.lisceomode
#, fuzzy
#| msgid "Preferred Exhibition Mode"
msgid "Preferred exhibition mode"
msgstr "Modo Preferido Exibição"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Categoria"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Fonte"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nunca, apenas manualmente"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Somente usado no modo categoria"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Quando ocioso"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Atualizar automaticamente"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Outros"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Atualizar"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Quando alternar arquivo no editor fonte"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedimentos"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Propriedades"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Propriedades publicadas sem padrão"
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr "Exibir observações sobre"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Estilo"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Para Fazer (ToDos)"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Tipos"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Constantes sem nome"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Membros sem classificação"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Visibilidade sem classificação"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "\"Uses\""
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Variáveis"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Recuo incorreto"
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occured during deletion of%s\"%s:%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr ""
#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr ""
#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr ""
#: lazarusidestrconsts.liscfeinfile
msgid "%sIn file %s%s"
msgstr ""
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr ""
#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr ""
#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr ""
#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr ""
#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr ""
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr ""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr ""
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Alterar"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Alterar modo construção"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Alterar Classe"
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Alterar codificação"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Alterar arquivo"
#: lazarusidestrconsts.lischangeparent
#, fuzzy
#| msgid "Change Parent..."
msgid "Change Parent"
msgstr "Alterar controle-pai ..."
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr ""
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr ""
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr ""
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Caracter"
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Mapa de Caracteres"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr ""
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontentratherthantimesta
msgid "Check for disk file changes via content rather than timestamp"
msgstr ""
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr "verifique se a próxima sílaba (token) no código é um fim e se não retorna fimlinha + fim; + fimlinha"
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Opções verificação"
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Verificar o alvo (OS, CPU, Tipo \"widget\" LCL). Talvez você tenha que recompilar o pacote para este alvo ou definir outro alvo para o projeto."
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Escolha um nome diferente"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Escolha um vínculo \"FPDOC\""
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Escolha uma tecla ..."
#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "Escolha um nome para o novo componente"
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr ""
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr ""
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr "Escolha um arquivo pascal para exemplos recuo"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Escolha o arquivo de mensagens do compilador"
#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Escolher nome de arquivo do compilador (%s)"
#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Escolher nome de arquivo do depurador"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Escolha um pacote Delphi (*.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Escolha um projeto Delphi (*.dpr)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Escolher Unidade Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Escolher diretório"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Escolher diretório fonte FPC"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Escolher Diretório Lazarus"
#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Escolher caminho do make"
#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Escolha nome"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Escolha um desses items para criar um novo Arquivo"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Escolha um desses items para criar um novo Pacote"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Escolha um desses items para criar um novo Projeto"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Escolha um desses itens para herdar de outro já existente"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Escolher fonte do programa (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Escolha a estrutura para circundar a seleção"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Escolha o diretório para testes"
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Complemento Classe"
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Classe em conflito com arquivo .lfm:%sA unidade %s%susa a unidade %s%sao qual contém a classe %s,%smas o arquivo .lfm já contém outra classe.%sDeve haver somente um classe planejada por unidade.%sFavor mover %s para outra unidade."
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Classes e propriedades existem. Valores não foram verificados."
#: lazarusidestrconsts.lisclassesppunotfoundcheckyourfpccfg
msgid "classes.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Classe %s%s%s não é uma classe de componente registrado.%sImpossível colar."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Classe não encontrada"
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Classe %s%s%s do método %s%s%s não encontrada."
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Limpar Diretório"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Limpar subdiretórios"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Manter todos os arquivos de texto"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Manter arquivos conforme filtro"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Remover arquivo conforme filtro"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Sintaxe Simples (ex: * em vez de .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr ""
#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr ""
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Limpar o Fonte do Lazarus (Clean)"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr ""
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuild
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr ""
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Limpar caminho da unidade?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Limpar"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Limpar Diretório?"
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Clique aqui para navegar no arquivo"
#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr "Clique para ver usos possíveis"
#: lazarusidestrconsts.lisclose
#, fuzzy
#| msgid "&Close"
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "&Fechar"
#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Fechar tudo"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Fechar arquivos"
#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "Ocultar janela"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Fechando uma Janela Editor Fonte. Deseja fechar todos os arquivos ou ocultar a janela?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Fechar Janela Editor Fonte"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opções especificas da Interface LCL"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parâmetro"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Componentes"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Herança"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Lista"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Paleta"
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Arquivo adicional de configuração do compilador ambíguo"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Chamar em:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sClique OK se você tem certeza disso."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Comando:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Código"
#: lazarusidestrconsts.liscodebrowser
#, fuzzy
#| msgid "Code browser"
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Navegador de código"
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Explorador de Código"
#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "padrão (%s)"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Opções geração código"
#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Adicionar vínculo"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Adicionar caminho"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Navegar"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Confirmar substituição"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Criar item ajuda"
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Excluir vínculo"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Remover caminho"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Descrição"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Erros"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Exemplo"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr ""
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Inserir \"tag\" formatação em negrito"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Inserir \"tag\" de formatação de código"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Inserir \"tag\" de formatação itálico"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Inserir \"tag\" de comentário da formatação"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Inserir \"tag\" de formatação de sublinhado"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Inserir \"tag\" de formatação de variável"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Herança"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Inserir um vínculo ..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Inserir \"tag\" de formatação de parágrafo"
#: lazarusidestrconsts.liscodehelpmainformcaption
#, fuzzy
#| msgid "FPDoc editor"
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr "(nenhum)"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(nenhuma descrição de herança encontrada)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NENHUM>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Veja também"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Descrição curta de"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Curto"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Ignorar constantes nas próximas funções"
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Localizar constantes de caracteres não nomeadas"
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Observador de Código"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Ignorar próximas constantes não nomeadas"
#: lazarusidestrconsts.liscodetempladd
#, fuzzy
#| msgid "Add"
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Adicionar"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Adicionar Modelo de Código"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "Uma marca %s%s%s já existe!"
#: lazarusidestrconsts.liscodetemplautocompleteon
#, fuzzy
#| msgid "Auto complete on ..."
msgid "Auto complete on"
msgstr "Auto completar em ..."
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Alterar"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Comentário:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Editar Modelo de Código"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Erro"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Sílaba:"
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Ação: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Nós auto-criados não podem ser editados,%snem podem possuir filhos não auto-criados."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, auto gerado"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Nós auto criados não podem ser editados."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Bloco"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor de definições das ferramentas de código"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Visualiza definições das ferramentas de código"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
#, fuzzy
#| msgid "compiler path"
msgid "Compiler path"
msgstr "Caminho do compilador"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Converter nó"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Criar definições para diretório %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Criar definições para o compilador Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Criar definições para os fontes SVN do Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Criar definições para diretório Lazarus"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Criar definições para o projeto %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Criar macros FPC e caminhos para um diretório de projeto FPC"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definir"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definir Recursão"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Excluir nó"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sPor exemplo: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sque são usados por este %s projeto.%sPor exemplo: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Descrição:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "Diretório %s"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "\"Else\""
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "\"ElseIf\""
#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Erro lendo %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Erro lendo arquivo de informações do projeto %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Erro durante escrita %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Erro durante escrita do arquivo de informações do projeto %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Sair sem Salvar"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Diretório SVN do fonte FPC"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "\"If\""
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "\"IfDef\""
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "\"IfNDef\""
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Diretório"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Inserir modelo de compilador Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Inserir modelo de diretório Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Inserir modelo de projeto Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Inserir modelo de compilador Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Inserir modelo de diretório Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Inserir modelo de projeto Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Inserir modelo de compilador Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Inserir modelo de diretório Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Inserir modelo de projeto Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Inserir modelo de compilador Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Inserir modelo de projeto Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Inserir modelo de Fonte SVN Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Inserir modelo de compilador Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Inserir modelo de diretório Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Inserir modelo de projeto Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Inserir modelo de Diretório Lazarus"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Inserir nó como filho"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Inserir nó abaixo"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Inserir Modelo"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Controle-Pai Inválido"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Nó do Controle-Pai inválido"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Nó anterior inválido"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sPor exemplo: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sque são usados por este %s projeto.%sPor exemplo: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Diretório Lazarus"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Mover nó abaixo"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Mover nó um nível abaixo"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Move nó um nível acima"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Mover nó acima"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Novo nó"
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Nós e seus filhos são válidos apenas para este projeto"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Nó somente leitura"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Nenhum selecionado"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Nó do controle-pai não pode conter filhos."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Nó anterior não pode conter filhos."
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Diretório do projeto"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "Diretório do projeto %s"
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, específico do projeto"
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Erro de Leitura"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Salvar e Sair"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Nó selecionado:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
#, fuzzy
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "O diretório SVN do fonte Free Pascal. Não requerido. Isto irá aprimorar a procura de declaração e depuração."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "O diretório de projeto Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "O diretório SVN do fonte Free Pascal."
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "O diretório principal do Lazarus."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, fuzzy
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "O caminho para compilador Free Pascal.%s Por exemplo %s/usr/bin/%s -n%s ou %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
#, fuzzy
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "O caminho para o compilador Free Pascal deste projeto. Requerido apenas se você marcar o fonte SVN do FPC abaixo. Usado para auto-criar macros."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "O diretório de projeto %s, %sque contém os arquivos .dpr, .dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Indefinir"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Indefinir Tudo"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Indefinir Recursão"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Valor como Caminho Arquivos"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Valor como Texto"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variável:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Erro de Escrita"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Em"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Parentêse"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Dois Pontos"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Vírgula"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identificador"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Palavra-Chave"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nova linha"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Nenhum"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Número"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Ponto"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Ponto e vírgula"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Espaço"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Const. \"String\""
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Símbolo"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Executar após"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Executar antes"
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr ""
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Retrair todas as classes"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Retrair todos os pacotes"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Retrair todas as unidades"
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Comando posterior"
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Comando posterior inválido"
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Comando posterior à publicação do módulo"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parâmetros de linha de comando do programa"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Compilar"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compilador"
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Compilador \"%s\" não suporta o alvo %s-%s"
#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "Erro do compilador"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Erro: compilador inválido: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nome de arquivo do compilador"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
#, fuzzy
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Dica: Você pode definir o caminho do compilador em Ambiente->Opções de Ambiente->Arquivos->Caminho do Compilador"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "NOTA: Arquivo de configuração das ferramentas de código não encontrado - usando padrão"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "NOTA: carregando arquivo antigo de configurações das ferramentas de código"
#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Opções do Compilador para o Projeto: %s"
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Compilar"
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (compilando ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Exibir dicas longas"
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Estender à extrema esquerda"
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Estender pouco à esquerda"
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Nunca"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Estender apenas à direita"
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr "Nome componente \"%s\" é uma palavra-chave pascal."
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Nome de componente %s%s%s é uma palavra-chave"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Nome de componente %s%s%s não é um identificador válido"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr ""
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Abrir pacote"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Abrir unidade"
#: lazarusidestrconsts.liscomptest
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Testar"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Condição"
#: lazarusidestrconsts.lisconditionals
#, fuzzy
#| msgid "Conditionals:"
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Condicionais:"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Diretório de configuração do Lazarus"
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Configurar Construir %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Configurar %sConstrução Lazarus%s"
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr ""
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus será reconstruído com o seguinte perfil:%sContinuar?"
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Confirmar alterações"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Confirmar exclusão"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#| msgid "Do you want to rebuild Lazarus?"
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "Você deseja reconstruir o Lazarus com o perfil: %s?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Confirmar novo conjunto pacote para a IDE"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Novo conjunto pacote"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Antigo conjunto pacote"
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Aplicação console"
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Código do construtor"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "contém"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Sensível ao contexto"
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Continuar"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Continuar e não perguntar mais"
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Continuar sem carregar o formulário"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Colaboradores"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Controle precisa de um controle-pai"
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Um deslocamento é adicionado à coordenada \"Topo\" dos controles dentro do contâineres visuais"
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Deslocamentos coordenadas"
#: lazarusidestrconsts.lisconvdelphiaddedpackagerequirement
msgid "Added Package %s as a requirement."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Todos os subdiretórios serão escaneados por arquivos unidades"
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "\"BeginCodeTools\" fahou!"
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Categorias:"
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Convsersão abortada."
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Conversão Pronta."
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Converter pacote Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Converter projeto Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Converter unidade Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertingfile
msgid "* Converting file %s *"
msgstr "* Convertendo arquivo %s *"
#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
#, fuzzy
#| msgid "*** Converting unit files... ***"
msgid "*** Converting unit files ... ***"
msgstr "*** Convertendo arquivos unidades... ***"
#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr "Arquivo fonte principal (.dpk) do pacote Delphi não encontrado para o pacote%s%s"
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Erro=\"%s\""
#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr "%s(%s,%s) Erro: Impossível localizar unidade %s"
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Falha ao converter unidade"
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr "Falha ao converter unidade%s%s%s"
#: lazarusidestrconsts.lisconvdelphifindallunitfiles
#, fuzzy
#| msgid "*** Find all unit files... ***"
msgid "*** Find all unit files ... ***"
msgstr "*** Localizar todos arquivos unidade ***"
#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Corrigido maiúsculas/minúsculas da unidade \"%s\" para \"%s\"."
#: lazarusidestrconsts.lisconvdelphifixingusedunits
msgid "* Fixing used units for file %s *"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Função Delphi"
#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr "Manter ambos"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) arquivo inclusão faltando"
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Nome Delphi"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Nome do pacote já existe"
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
msgid "Removed unit \"%s\" in uses section."
msgstr "Unidade \"%s\" removida na seção \"uses\"."
#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr "Remover primeiro"
#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr "Remover segundo"
#: lazarusidestrconsts.lisconvdelphirepairingformfile
#, fuzzy
#| msgid "Repairing form file %s"
msgid "* Repairing form file %s *"
msgstr "Reparando arquivo formulário %s"
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
#, fuzzy
#| msgid "*** Repairing form files... ***"
msgid "*** Repairing form files ... ***"
msgstr "*** Reparando arquivos formulários... ***"
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Unidade \"%s\" substituída com \"%s\" na seção \"uses\"."
#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr "Há duas unidades com o mesmo nome de unidade:%s%s%s%s%s"
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Já existe um pacote com o nome \"%s\"%sFavor fechar este pacote primeiro."
#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr "Nome de unidade duplicado"
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Unidades à substituir em %s"
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Erro de conversão"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Converter"
#: lazarusidestrconsts.lisconvertencoding
#, fuzzy
#| msgid "Convert encoding"
msgid "Convert Encoding"
msgstr "Converter codificação"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Converter codificação do projeto/pacotes"
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Converter projeto ou pacote"
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Conversor adiciona compilação condicional para suportar alvos diferentes"
#: lazarusidestrconsts.lisconverttargetmultiplatform
msgid "Multi-Platform"
msgstr ""
#: lazarusidestrconsts.lisconverttargetmultiplatformhint
msgid "Multi-Platform versus Windows-only"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Substituições de Funções"
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Algumas funções Delphi podem ser substituídas por funções LCL"
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Funções / procedimentos à subsituir"
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Deslocamento esquerda"
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Novo Nome"
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Contâiner Pai"
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Deslocamento Topo"
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Substituições Tipos"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Tipos desconhecidos no arquivo de formulário (DFM/LFM)"
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Tipos à substituir"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Substituições Unidades"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Nomes de unidades na seção \"uses\" de uma unidade fonte"
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Unidades à substituir"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Propriedades desconhecidas"
#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Copiar"
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Copiar Tudo"
#: lazarusidestrconsts.liscopyallitemstoclipboard
#, fuzzy
#| msgid "Copy all items to clipboard"
msgid "Copy All Items to Clipboard"
msgstr "Copiar todos os items para a Área de Transf."
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Copiar toda saída para área transferência"
#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
#, fuzzy
#| msgid "Copy all shown and hidden messages to clipboard"
msgid "Copy All Shown and Hidden Messages to Clipboard"
msgstr "Copiar todas as mensagens exibidas e escondidas para Área Transferência"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
#, fuzzy
#| msgid "Copy all shown messages to clipboard"
msgid "Copy All Shown Messages to Clipboard"
msgstr "Copiar todas as mensagens exibidas para Área Transferência"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Copiar descrição para área transferência"
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Erro na cópia"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Erro na cópia"
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr "Copiar %s%s%s para área transferência"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Cópiar um formulário inteiro não está implementado."
#: lazarusidestrconsts.liscopyitemtoclipboard
#, fuzzy
#| msgid "Copy item to clipboard"
msgid "Copy Item to Clipboard"
msgstr "Copiar item para Área Transferência"
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
#, fuzzy
#| msgid "Copy selected items to clipboard"
msgid "Copy Selected Items to Clipboard"
msgstr "Copiar itens selecionados para Área Transf."
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
#, fuzzy
#| msgid "Copy selected messages to clipboard"
msgid "Copy Selected Messages to Clipboard"
msgstr "Copiar mensagens selecionadas para Área de Transferência"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Localizar mensagens FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Localizar mensagens Make"
#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr ""
#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Exibir todas as mensagens"
#: lazarusidestrconsts.liscoskipcallingcompiler
#, fuzzy
#| msgid "Skip calling Compiler"
msgid "Skip calling compiler"
msgstr "Saltar chamada de Compilador"
#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Opções específicas do SO Alvo"
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr "Não pode adicionar %s{$I %s%s} ao código fonte principal!"
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr "Não pode adicionar %s{$R %s%s} ao código fonte principal!"
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr "Não pode adicionar %s%s%s ao código fonte principal!"
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr "Não pode remover %s%s%s do código fonte principal!"
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr "Não pode remover %s{$I %s%s} do código fonte principal!"
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr "Não pode remover %s{$R %s%s} do código fonte principal!"
#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (vários)"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
#, fuzzy
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Aviso: O arquivo adicional de configuração de compilador tem o mesmo nome de um dos arquivos de configuração padrão que o compilador Free Pascal está buscando. Isto pode resultar SOMENTE na análise da configuração adicional, saltando a configuração padrão."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Abrir pacote %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Abrir unidade %s"
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Crie um projeto primeiro!"
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Criar diretório?"
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Criar função"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Criar nó Ajuda"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Criá-lo"
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr ""
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Criar projeto"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Criar/atualizar arquivo .po ao salvar o arquivo lfm"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Criando índice arquivos fontes FPC %s ..."
#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "Base"
#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "Topo"
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Escolha o diretório"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Valores do diretório de Ferramentas de Código"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Modelos definições"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<nenhuma variável selecionada>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Abrir Visualização"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Ferramentas"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Variável: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nome da Variável"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Modelos"
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "favor selecionar uma macro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Selecionar Código de Macro"
#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Atual"
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr ""
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Coluna do cursor no editor atual"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Linha do cursor no editor atual"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed directly to the compiler. Macros are replaced, line breaks are replaced with single spaces."
msgstr ""
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "Opções personalizadas"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Opções personalizadas"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Programa personalizado"
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
#| msgid "Custom Program%sA freepascal program."
msgid "Custom Program%sA Free Pascal program."
msgstr "Programa personalizado%sUm programa Free Pascal."
#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Recortar"
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Data Module"
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Data"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Excluir tudo"
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Excluir tudo"
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Desativar tudo"
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Desativar tudo"
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Ativar tudo"
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Ativar tudo"
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
#, fuzzy
#| msgid "Copy to clipboard"
msgid "Copy to Clipboard"
msgstr "Copiar para Área Transferência"
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr ""
#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr ""
#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr ""
#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr ""
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr ""
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr ""
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr "Excluir"
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Excluir"
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Desativar"
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Desativar"
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Ativar"
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Ativar"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nenhum depurador especificado"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Marcar ponto de parada assim mesmo"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Não há um depurador especificado.%sConfiguração de pontos de parada não tem efeito até que você configure um Depurador, no diálogo de opções de depurador, no menu."
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Ligar/Desligar"
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Desativar/Ativar atualizações para toda a janela"
#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "Erro do Depurador "
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Erro do Depurador%sOoops, o depurador entrou em uma condição de erro%sSalve seu trabalho agora !%sClique Parar e espere pelo melhor, estamos puxando a tomada."
#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr ""
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Depurador inválido"
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (depurando ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic type-cast for objects"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Adicionar Exceção"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Caminho de busca adicional"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Ponto de parada"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Limpar registro de eventos ao executar"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Depurador"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Opções gerais do Depurador"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Opções específicas do Depurador (dependem do tipo de depurador)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Duplicar nome da Exceção"
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Digitar o nome da exceção"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Registro de Eventos"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Manipulado por"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Manipulado pelo Depurador"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Manipulado pelo Programa"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorar estas exceções"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Exceções de Idioma"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
#, fuzzy
#| msgid "Limit linecount to"
msgid "Limit line count to"
msgstr "Limitar contagem de linha em"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Módulo"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "Notificar Exceções Lazarus"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Exceções do SO"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Saída"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Processo"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Retomar"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Retomar Manipulados"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Retomar não Manipulados"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Exibir mensagem na parada"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Sinais"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Impossível carregar arquivo"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Impossível carregar arquivo %s%s%s."
#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Decimal"
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr ""
#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr "Valor padrão"
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Atraso para dicas longas na caixa de conclusão"
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Atraso para dicas e caixa de conclusão"
#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Excluir"
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Excluir Tudo"
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Excluir todos os pontos de parada?"
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Excluir todos os pontos de parada no arquivo %s%s%s?"
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Excluir Tudo no mesmo código fonte"
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Excluir todos os pontos de parada selecionados?"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Excluir todos esses arquivos?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Excluir arquivo ambíguo?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Excluir Ponto de parada"
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Excluir ponto de parada na%s\"%s\" linha %d?"
#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr "Excluir modo construção"
#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr "Excluir modo construção?"
#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr "Excluir modo construção %s%s%s?"
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Falha na exclusão do arquivo"
#: lazarusidestrconsts.lisdeletemacro
#, fuzzy
#| msgid "Delete macro %s"
msgid "Delete macro %s%s%s?"
msgstr "Excluir macro %s"
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Excluir modo \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Excluir arquivo antigo %s%s%s?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Excluir arquivo antigo?"
#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr "Excluir linha"
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Excluir arquivos selecionados"
#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr "Excluir configuração"
#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr "Excluir configuração?"
#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr "Excluir configuração %s%s%s?"
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr "Excluir valor %s%s%s"
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Excluir valor %s"
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Falha ao eliminar arquivo %s%s%s"
#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"
#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "Pacote Delphi"
#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Projeto Delphi"
#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "Unidade Delphi"
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Já existe outro componente com o nome %s%s%s."
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Diretório de destino"
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Diretório de destino %s%s%s é inválido.%sFavor escolher um caminho completo."
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Código do Destruidor"
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Não diferenciar maiúsc./minúsc."
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorar se linhas em branco foram adicionadas ou removidas"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorar diferenças no final de linha (ex. #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorar quantidade de espaços em branco"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorar espaços (caracteres de nova linha não incluídos)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorar espaços no final da linha"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorar espaços no início da linha"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Somente seleção"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Abrir \"Diff\" no editor"
#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Texto1"
#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Texto2"
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Dígitos:"
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Diretivas"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Diretivas para nova unidade"
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr "Diretório %s%s%s não encontrado."
#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr ""
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Diretório não gravável"
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Diretório onde a IDE coloca os arquivos .po"
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Desativar Tudo no mesmo código fonte"
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Desativar Ponto de Parada"
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Desativado"
#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr ""
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Desativar I18N para LFM"
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lisdisassgotoaddress
#, fuzzy
#| msgid "Goto address"
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "Ir para endereço"
#: lazarusidestrconsts.lisdisassgotoaddresshint
#, fuzzy
#| msgid "Goto address"
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "Ir para endereço"
#: lazarusidestrconsts.lisdisassgotocurrentaddress
#, fuzzy
#| msgid "Goto current address"
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "Ir para endereço atual"
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
#, fuzzy
#| msgid "Goto current address"
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "Ir para endereço atual"
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "&Descartar alterações"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Descartar todas alterações"
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Arquivos alterados:"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Clique em um dos items acima para ver as diferenças"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Erro lendo o arquivo: %s"
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignorar alterações no disco"
#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Recarregar do disco"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Alguns arquivos foram alterados no disco:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Distinguir letras grandes e pequenas, ex: A e a"
#: lazarusidestrconsts.lisdlgeditorwindowmanager
msgid "Editor Window Manager ..."
msgstr ""
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Abrir ..."
#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Salvar ..."
#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Editor de Documentação"
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr "%s não existe: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Não fechar a IDE"
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Não fechar o projeto"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "não compilar dependências"
#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr "Não instalar"
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Não exibir a tela de início"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Não exibir este diálogo para este projeto"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Não exibir esta mensagem novamente"
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Abaixo"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr ""
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Desenhar linhas da grade"
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copiar componentes selecionados para Área de Transferência"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Recortar componentes selecionados para Área de Transferência"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Mover componente um atrás"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Mover componente um adiante"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Mover componente para trás"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Mover componente para frente"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Colar componentes selecionados da Área de Transferência"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Selecionar componente pai"
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr ""
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr "Valor duplicado encontrado %s%s%s."
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Nome duplicado: Um componente chamado %s%s%s já existe no componente herdado %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Arquivos ppu duplicados. Exclua um ou certifique-se de que todos os caminhos de busca tenham a ordem correta (Dica: FPC usa o último caminho primeiro)."
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Caminho busca duplicado"
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Fontes duplicados. Exclua um ou certifique-se de que todos os caminhos de busca tenham a ordem correta (Dica: FPC usa o último caminho primeiro)."
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Editar"
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Editar ajuda contextual"
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr ""
#: lazarusidestrconsts.liseditorfiletypes
msgid "Editor file types"
msgstr ""
#: lazarusidestrconsts.liseditorwindowmanager
msgid "Editor Window Manager"
msgstr ""
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr ""
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Todos os pacotes"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Projeto Atual"
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Diretório do Projeto Atual"
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Caminho adicional para Fontes Globais"
#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Caminho \"IncPath\""
#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Caminho \"SrcPath\""
#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Caminhos para as unidades do Projeto"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Todos os projetos"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "definir modo FPC para DELPHI"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "definir modo FPC para FPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "definir modo FPC para GPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "definir modo FPC para MacPas"
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "definir modo FPC para TP"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "definir IOCHECKS=ON"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "definir OVERFLOWCHECKS=ON"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "definir RANGECHEKS=ON"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "usar unidade HeapTrc"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "usar unidade LineInfo"
#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Uma ferramenta válida necessita no mínimo de um título e um nome de arquivo."
#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Editar Ferramenta"
#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr "Ocultar formulário principal"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Tecla"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Macros"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parâmetros:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Nome do programa:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Examinar saída por mensagens do compilador Free Pascal"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Examinar saída por mensagens do Make"
#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Título e Nome do Arquivo requerido"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Diretório trabalho:"
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Tudo"
#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Métodos Vazios"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Métodos vazios encontrados:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr ""
#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Somente publicados"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Público"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Publicado"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Remover métodos"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Localizar nestas seções de classe:"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr ""
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Vazio"
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Ativar Tudo"
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Ativar tudo no mesmo código fonte"
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Ativar Ponto de Parada"
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Ativo"
#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr ""
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Ativar internacionalização e suporte a tradução"
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Ativar Macros"
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = replace whole identifier, Disable = replace prefix"
msgstr ""
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Circundar"
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Codificação do arquivo %s%s%s%sno disco é %s. Nova codificação é %s."
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Codificação no arquivo %s%s%s%sno disco é %s. Nova codificação é %s."
#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr ""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Variável ambiente, nome como parâmetro"
#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr "Saltar da mensagem para linha do fonte no clique duplo (senão: clique único)"
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Diretório não encontrado"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nome de arquivo do depurador inválido"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "O arquivo do depurador \"%s\" não é um executável."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Diretório de teste \"%s\" não encontrado."
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "NOTA: somente caminhos absolutos são suportados agora"
#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "Largura de tabulações"
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Opção inválida na posição %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Opção na posição %d não permite um argumento: %s"
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Opção na posição %d precisa de um argumento : %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Erro:"
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Erro ao criar arquivo"
#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Erro criando lrs"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Erro na exclusão do arquivo"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Erro em %s"
#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Erro inicializando o programa%s%s%s%s%sErro: %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Erro no nome do arquivo do compilador:"
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Erro nas opções customizadas do compilador (Outro):"
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Linking / Pass options to linker):"
msgstr "Erro nas opções customizadas do vinculador (Vinculando / Passar opções ao vinculador):"
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Erro no \"caminho adicional Depurador\":"
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Erro no caminho de busca para \"Arquivos de inclusão\":"
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Erro no caminho de busca para \"Bibliotecas\":"
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Erro no caminho de busca para \"Arquivos objeto\":"
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Erro no caminho de busca para \"Outros fontes\":"
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Erro no caminho de busca para \"Outros arquivos de unidade\":"
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Erro no \"diretório de saída de unidades\":"
#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "ERROR: invalid build mode \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Erro carregando arquivo"
#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr "Erro ao carregar arquivo \"%s\":%s%s"
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Erro carregado %s de%s%s%s%s"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Erro ao mover o componente"
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Erro ao mover o componente %s%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Erro ao nomear componente"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Erro abrindo componente"
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Erro na análise do fluxo de componente no arquivo LFM."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Erro na leitura da lista de pacotes do arquivo%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Erro lendo XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Erro lendo arquivo xml %s%s%s%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Erro na renomeação do arquivo"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Erros"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Erro salvando %s to%s%s%s%s"
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Erro ao definir o nome de um componente %s para %s"
#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Erro na escrita do lista de pacotes para arquivo%s%s%s%s"
#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Editar \"scanners\" personalizados (%s)"
#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "Avaliar expressão"
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "A&valiar"
#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr ""
#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr ""
#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr ""
#: lazarusidestrconsts.liseverynthlinenumber
#, fuzzy
#| msgid "Every n-th line number:"
msgid "Every n-th line number"
msgstr "Todo enésimo número linha:"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Arquivo exemplo:"
#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Exemplos:%sIdentificador%sTMyEnum.Enum%sNomeUnidade.Identificador%s#NomePacote.NomeUnidade.Identificador"
#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr ""
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Notificação Exceções Depurador"
#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr ""
#: lazarusidestrconsts.lisexcludefilter
#, fuzzy
#| msgid "Exclude Filter"
msgid "Exclude filter"
msgstr "Filtro de Exclusão"
#: lazarusidestrconsts.lisexecutable
msgid "Executable"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Executando comando posterior"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Executando comando anterior"
#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Execução pausada"
#: lazarusidestrconsts.lisexecutionpausedadress
#, fuzzy
#| msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgid "Execution paused%s Address: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Execução pausada%s Endereço: $%s%s Procedimento: %s%s Arquivo %s%s (Algum dia uma janela assembler poderá aparecer aqui :)%s"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Execução parada"
#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Programas"
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Sair"
#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Expandir todas as classes"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Expandir todos os pacotes"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Expandir todas as unidades"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Nome de arquivo expandido do editor de arquivo atual"
#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "Exportar..."
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr ""
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Exportar Lista"
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Expressão:"
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Estender caminho da unidade?"
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Extrair"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Extrair Procedimento"
#: lazarusidestrconsts.lisexttoolexternaltools
#, fuzzy
#| msgid "External tools"
msgid "External Tools"
msgstr "Ferramentas externas"
#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Falha ao executar ferramenta"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Máximo de Ferramentas atingido"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Há um máximo de %s ferramentas."
#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" completado"
#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Impossível executar ferramenta %s%s%s:%s%s"
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Falha ao criar Aplicação Encartada para \"%s\""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Falha ao carregar estado retração"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Reduzir atualização de janela"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Atualizar itens da janela do editor quando ocioso.(Reduz pico processamento para computadores lentos)"
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Arquivo"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Arquivo %s%s%s%snão parece ser um arquivo texto.%sAbrir assim mesmo?"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Arquivo %s%s%s%snão parece ser um arquivo texto.%sAbrir assim mesmo?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Extensões de arquivos de programas"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtro arquivo"
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr ""
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr ""
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Arquivo %s%s%s foi alterado. Salvar?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Arquivo não tem projeto"
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr ""
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr ""
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Arquivo não aceita escrita"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Arquivo é um vínculo simbólico"
#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Arquivo %s%s%s é virtual."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Erro vínculo arquivo"
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Nome de arquivo/Endereço"
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Arquivo não encontrado"
#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Arquivo %s%s%s não encontrado.%s"
#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Arquivo %s%s%s não encontrado.%sDeseja criá-lo?%s"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Arquivo não está em minúsculo"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Arquivo não é texto"
#: lazarusidestrconsts.lisfilesettings
#, fuzzy
#| msgid "File Settings ..."
msgid "File Settings"
msgstr "Configurações Arquivo ..."
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Arquivos em ASCII ou codificação UTF-8"
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Arquivos não está em ASCII nem na codificação UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "arquivo, onde saída do depurador é escrita. Se não for especificado, a saída será para o console."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtro"
#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Filtro: %s"
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Definições Filtro"
#: lazarusidestrconsts.lisfindfiledirectory
msgid "D&irectory"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Opções de diretório"
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr ""
#: lazarusidestrconsts.lisfindfileincludesubdirectories
#, fuzzy
#| msgid "Include sub directories"
msgid "Include &sub directories"
msgstr "Incluir subdiretórios"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Padrão linhas &múltiplas"
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Apenas arquivos texto"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "Localizar todos os arquivos no &projeto"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "Localizar todos &os arquivos abertos"
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "Localizar nos &diretórios"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Onde"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Localizar combinação teclas"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Localizar unidade faltante"
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Primeiro"
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Corrigir arquivo LFM"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Ponto Flutuante"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Forçar renomeação"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Formulário"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Erro formatação"
#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "Erro carga formulário"
#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr ""
#: lazarusidestrconsts.lisfpccfgismissing
msgid "fpc.cfg is missing."
msgstr ""
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "\"fpcmake\" falhou"
#: lazarusidestrconsts.lisfpcmessagefile
msgid "FPC message file"
msgstr ""
#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Componentes"
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr "Recursos FPC"
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Erro no diretório de Fonte FPC"
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr ""
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC muito antigo"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Versão FPC:"
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Versão FPC (ex. 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "Erro gravando \"%s\"%s%s"
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Erro sintaxe FPDoc"
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr ""
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Há um erro de sintaxe no elemento fpdoc \"%s\":%s%s"
#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Localizar componente da paleta"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Quadro com bordas"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "Localizar para &trás"
#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"
#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Compilador Free Pascal não encontrado"
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
#| msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "Programa Free Pascal usando \"TCustomApplication\" para verificar de forma fácil as opções de linha de comando, tratamento de exceções, etc. O fonte do programa é mantido automaticamente pelo Lazarus."
#: lazarusidestrconsts.lisfreepascalsourcedirectory
#, fuzzy
#| msgid "Freepascal source directory"
msgid "Free Pascal source directory"
msgstr "Diretório fonte do Free Pascal"
#: lazarusidestrconsts.lisfreepascalsourcefile
#, fuzzy
#| msgid "FreePascal source file"
msgid "Free Pascal source file"
msgstr "Arquivo fonte Free Pascal"
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Fontes do Free Pascal não encontrados"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Localizar para fre&nte"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Arquivos adicionais à localizar (ex: /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Localizar ou Renomear Identificador"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Localizar Referências"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identificador: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "em todos os pacotes e projetos abertos"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "na unidade atual"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "no projeto principal"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "no projeto/pacote proprietário da unidade atual"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Identificador Inválido"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Renomear todas as Referências"
#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Renomear para"
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Localizar também nos comentários"
#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Localizar onde"
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Função"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Geral"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "obter palavra na posição atual do cursor"
#: lazarusidestrconsts.lisgotoline
#, fuzzy
#| msgid "Goto line"
msgid "Goto Line"
msgstr "Ir para a linha"
#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Ir para linha de código selecionada"
#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEstes fontes são software livre; você pode redistribuir e/ou modificá-los sob os termos da GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior. %sEste código é distribuído na esperança de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.%sVocê deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Grupo"
#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr ""
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group..."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr ""
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Aumentar para o maior"
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Tem Ajuda"
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Cabeçalho de comentário para classe"
#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Ajuda"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Entradas da Ajuda"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Seletor de Ajuda"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Hexadecimal"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
#, fuzzy
#| msgid "Help for FreePascal Compiler message"
msgid "Help for Free Pascal Compiler message"
msgstr "Ajuda para mensagem do Compilador Free Pascal"
#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr "Ocultar mensagem via diretiva"
#: lazarusidestrconsts.lishint
msgid "Hint"
msgstr "Dica"
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Dica: Um valor padrão pode ser definido nas condicionais."
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Dica: Verificar se dois pacotes contém uma unidade com o mesmo nome."
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Salvar tudo"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Passar Dentro"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Executar até o retorno da função"
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Passar Sobre"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Dica: A função \"Make Resourcestring\" espera uma constante de sequência de caracteres.%sFavor selecionar a expressão e tentar novamente."
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Dica: A função \"Make Resourcestring\" espera uma constante de sequência de caracteres.%sFavor selecionar apenas uma expressão de deste tipo e tentar novamente."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Alternar Formulário/Unidade"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Exibir Formulários"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Exibir Unidades"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Conta acertos"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Banco de Dados"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Opções de Ajuda"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Propriedades:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Visualizadores"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Caminho do Doc HTML do FPC"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontal"
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Opções construção IDE"
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Criando \"Makefile\" para pacote %s"
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Erro: execução ferramenta 'compilar após\" falhou para o pacote %s"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informações sobre a IDE"
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "AVISO: nome unidade inválido %s, pacote=%s"
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr ""
#: lazarusidestrconsts.lisidemacrovaluesforfpcmacrosusecustomoptions
msgid "IDE macro values (for FPC macros use custom options)"
msgstr ""
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "identificador"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Identificadores começam com ..."
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Identificadores contêm ..."
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Opções da IDE:"
#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr "Exibir diretório do projeto no título da IDE"
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Título IDE começa com o nome do projeto"
#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Erro ao acessar XML"
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Erro ao acessar arquivo XML %s%s%s:%s%s"
#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Erro ao carregar XML"
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Erro ao carregar arquivo XML %s%s%s:%s%s"
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Arquivo exportado já existe"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Arquivo exportado %s%s%s já existe.%sAbrir arquivo e substituir somente as opções do compilador?%s(Outras configurações serão mantidas.)"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Carregar do arquivo"
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Abrir ou carregar opções de compilador"
#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Abrir recente"
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Arquivos recentes"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Salvar para arquivo"
#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Salvar no recente"
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%s%sFor example:%s"
msgstr ""
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignorar tudo"
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignorar e continuar"
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Ignorar binários"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ignorar este tipo de exceção"
#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Ignorar arquivo faltante"
#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Ignorar, usar TForm como ancestral"
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Seguir exemplo recuo da unidade atual, projeto ou pacote"
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Comentário implementação para classe"
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Importar lista"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Impossível"
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr "No diretório fonte do pacote \"%s\"."
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "No diretório fonte do projeto. Verificar duplicidades."
#: lazarusidestrconsts.lisincludeexamples
msgid "Include Examples"
msgstr ""
#: lazarusidestrconsts.lisincludefilter
#, fuzzy
#| msgid "Include Filter"
msgid "Include filter"
msgstr "Filtro de Inclusão"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "caminho de inclusão"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Caminhos de inclusão"
#: lazarusidestrconsts.lisincludetestcases
msgid "Include Testcases"
msgstr ""
#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr "Recuo"
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr "Identação para fontes pascal"
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Índice"
#: lazarusidestrconsts.lisinfobuildabort
#, fuzzy
#| msgid "Aborted..."
msgid "Aborted ..."
msgstr "Abortado..."
#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Compilar Projeto"
#: lazarusidestrconsts.lisinfobuildcomplile
#, fuzzy
#| msgid "Compiling..."
msgid "Compiling ..."
msgstr "Compilando..."
#: lazarusidestrconsts.lisinfobuilderror
#, fuzzy
#| msgid "Error..."
msgid "Error ..."
msgstr "Erro..."
#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Erros:"
#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Dicas:"
#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Linhas:"
#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Abortar"
#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Notas:"
#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr "Projeto:"
#: lazarusidestrconsts.lisinfobuildsuccess
#, fuzzy
#| msgid "Success..."
msgid "Success ..."
msgstr "Sucesso..."
#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Avisos:"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Informação"
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informação sobre %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informação sobre FPC usado"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "No caminho de busca de unidades FPC. Provavelmente instalado pelo pacote FPC. Verificar se o compilador e o arquivo ppu são da mesma instalação."
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Na frente do relacionado"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Item herdado"
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Componente projeto herdado"
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Com o propósito de criar uma cópia \"limpa\" do projeto/pacote, todos os arquivos no seguinte diretório serão excluídos e todo o seu conteúdo será perdido.%s%sExcluir todos os arquivos em %s%s%s?"
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Inserir"
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "inserir data"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "inserir data e hora"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "Inserir data e hora. Opcional: seq.caracteres formatação"
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "Inserir data. Opcional: seq.caracteres formatação"
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "inserir fim se necessário"
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Inserir Macro"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "inserir nome do procedimento atual"
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Inserir \"tag PrintShort\""
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Inserir \"tag printshort\""
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "inserir cabeçalho procedimento"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "inserir nome procedimento"
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "inserir hora"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr "Inserir hora. Opcional: seq.caracteres formatação"
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Inserir \"tag\" url"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "Na sessão"
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Inspecionar"
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Dados"
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Inspetor do Depurador"
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Métodos"
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Propriedades"
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Falha na instalação"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr ""
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Install it, I like the fat"
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Instalar Seleção"
#: lazarusidestrconsts.lisinstalluninstallpackages
#, fuzzy
#| msgid "Install/Uninstall packages"
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Instalar/Desinstalar pacotes"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interativo"
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Comando inválido"
#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Nome de arquivo do compilador inválido"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Exclusão inválida"
#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Diretório de destino inválido"
#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Expressão inválida: %s%s%s%s"
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Expressão inválida.%sDica: A função \"Make Resourcestring\" espera uma constante de sequência de caracteres em um arquivo único. Favor selecionar a expressão e tentar novamente."
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Filtro inválido"
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Diretório fonte do Free Pascal inválido"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Linha, coluna inválida na mensagem%s%s"
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro %s%s%s. The macro name must be a pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr ""
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr ""
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Modo inválido %s"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Multi-seleção inválida"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Inválido (Desligado)"
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Inválido (Ligado)"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Identificador Pascal inválido"
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "O nome \"%s\" não é um identificador Pascal válido."
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "\"Proc name\" inválido"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nome do arquivo de projeto inválido"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Diretório de publicação inválido"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Seleção inválida"
#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr ""
#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr "%s é um grupo. Uma configuração pode ser adicionada apenas aos modos normais de contrução."
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s já faz parte do Projeto."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s é um nome de projeto inválido.%sFavor escolher outro nome (ex. projeto1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr ""
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr "Quero saber como você fez isso. Erro na %s:"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Quero saber como você fez isso: Erro no diretório base:"
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Saltar para Histórico"
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr ""
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Manter arquivos convertidos abertos no editor"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Todos os arquivos do projeto serão abertos no editor após conversão"
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Manter na lista instalação"
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Manter nome"
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "Manter identação relativa do modelo múltiplas linhas"
#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "Manter identação"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Mantê-los e continuar"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Tecla"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Comandos personalizados"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Comandos do Editor"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Comandos do Inspetor de Objetos"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Tecla (ou sequência de 2 teclas)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Abortar construção"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Adicionar observador"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Construir projeto/programa"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Escolha o esquema de mapeamento de teclas"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Clássico"
#: lazarusidestrconsts.liskmcleanupcompiled
msgid "Clean up build files"
msgstr ""
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Fechar projeto"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Editor definições das Ferramentas de Código"
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr ""
#: lazarusidestrconsts.liskmcompileroptions
#, fuzzy
#| msgid "Compiler options"
msgctxt "lazarusidestrconsts.liskmcompileroptions"
msgid "Compiler Options"
msgstr "Opções do compilador"
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Configurar %sConstruir Arquivo%s"
#: lazarusidestrconsts.liskmconfigurecustomcomponents
#, fuzzy
#| msgid "Configure custom components"
msgid "Configure Custom Components"
msgstr "Configurar componentes personalizados"
#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "Configurar Ajuda"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Ajuda contextual"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Converter pacote Delphi para Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project"
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Converter Projeto Delphi para Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit"
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Converter Unidade Delphi para Lazarus"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
#, fuzzy
#| msgid "Convert DFM file to LFM"
msgid "Convert DFM File to LFM"
msgstr "Converter arquivo DFM para LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Copiar componentes selecionados para a Área de Transferência"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Recortar componentes selecionados para a Área de Transferência"
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Excluir último caractere"
#: lazarusidestrconsts.liskmdiffeditorfiles
#, fuzzy
#| msgid "Diff editor files"
msgid "Diff Editor Files"
msgstr "Comparar arquivos do editor"
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Editar modelos de código"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Editar ajuda contextual"
#: lazarusidestrconsts.liskmencloseselection
#, fuzzy
#| msgid "Enclose selection"
msgid "Enclose Selection"
msgstr "Circundar seleção"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Avaliar/Modificar"
#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr ""
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Configurações Ferramentas Externas"
#: lazarusidestrconsts.liskmfindincremental
#, fuzzy
#| msgid "Find incremental"
msgid "Find Incremental"
msgstr "Localização incremental"
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Ir para marcador 0"
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Ir para marcador 1"
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Ir para marcador 2"
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Ir para marcador 3"
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Ir para marcador 4"
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Ir para marcador 5"
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Ir para marcador 6"
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Ir para marcador 7"
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Ir para marcador 8"
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Ir para marcador 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Ir para editor fonte 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Ir para editor fonte 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Ir para editor fonte 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Ir para editor fonte 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Ir para editor fonte 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Ir para editor fonte 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Ir para editor fonte 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Ir para editor fonte 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Ir para editor fonte 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Ir para editor fonte 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Inserir data e hora"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Inserir nome de usuário"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspecionar"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Esquema de mapeamento de teclas"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (padrão)"
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Mac OS X (estilo Apple)"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Mac OS X (estilo Lazarus)"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Novo pacote"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Novo projeto"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Novo projeto do arquivo"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nova Unidade"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Nota: Todas as teclas serão definidas para os valores do esquema escolhido."
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Abrir arquivo de pacote"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Colar componentes da Área de Transferência"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Pausar programa"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publicar projeto"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Compilação rápida, sem vinculação"
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr ""
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Executar programa"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "SalvarTudo"
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "SalvarComo"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Salvar projeto"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Salvar projeto como"
#: lazarusidestrconsts.liskmselectlineend
#, fuzzy
#| msgid "Select line end"
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Selecionar fim linha"
#: lazarusidestrconsts.liskmselectlinestart
#, fuzzy
#| msgid "Select line start"
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Selecionar início linha"
#: lazarusidestrconsts.liskmselectpagebottom
#, fuzzy
#| msgid "Select page bottom"
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Selecionar base da página"
#: lazarusidestrconsts.liskmselectpagetop
#, fuzzy
#| msgid "Select page top"
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Selecionar topo da página"
#: lazarusidestrconsts.liskmselectwordleft
#, fuzzy
#| msgid "Select word left"
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Selecionar palavra a esquerda"
#: lazarusidestrconsts.liskmselectwordright
#, fuzzy
#| msgid "Select word right"
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Selecionar palavra a direita"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Definir Marcador livre"
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Definir marcador 0"
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Definir marcador 1"
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Definir marcador 2"
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Definir marcador 3"
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Definir marcador 4"
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Definir marcador 5"
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Definir marcador 6"
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Definir marcador 7"
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Definir marcador 8"
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Definir marcador 9"
#: lazarusidestrconsts.liskmstopprogram
#, fuzzy
#| msgid "Stop program"
msgid "Stop Program"
msgstr "Parar programa"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Alternar Unidade/Formulário"
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "Alternar marcador 0"
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "Alternar marcador 1"
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "Alternar marcador 2"
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "Alternar marcador 3"
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "Alternar marcador 4"
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "Alternar marcador 5"
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "Alternar marcador 6"
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "Alternar marcador 7"
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "Alternar marcador 8"
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "Alternar marcador 9"
#: lazarusidestrconsts.liskmtoggleviewassembler
#, fuzzy
#| msgid "Toggle view Assembler"
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Alternar exibição Assembler"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
#, fuzzy
#| msgid "Toggle view Breakpoints"
msgid "View Breakpoints"
msgstr "Alternar exibição pontos de parada"
#: lazarusidestrconsts.liskmtoggleviewcallstack
#, fuzzy
#| msgid "Toggle view Call Stack"
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Alternar exibição chamada de pilha"
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Alternar exibição explorador de código"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
#, fuzzy
#| msgid "Toggle view component palette"
msgid "Toggle View Component Palette"
msgstr "Alternar exibição paleta de componentes"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
#, fuzzy
#| msgid "Toggle view Debuger Event Log"
msgid "View Debuger Event Log"
msgstr "Alternar exibição Histórico Eventos Depuração"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
#, fuzzy
#| msgid "Toggle view Debugger Output"
msgid "View Debugger Output"
msgstr "Alternar exibição Saída do Depurador"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Alternar exibição Editor de Documentação"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Alternar exibição botões da IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
#, fuzzy
#| msgid "Toggle view Local Variables"
msgid "View Local Variables"
msgstr "Alternar exibição Variáveis Locais"
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Alternar exibição Mensagens"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Alternar exibição Inspetor de Objetos"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
#, fuzzy
#| msgid "Toggle view Registers"
msgid "View Registers"
msgstr "Alternar exibição Registradores"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Alternar exibição Resultados de Pesquisa"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Alternar exibição Editor Código"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
#, fuzzy
#| msgid "Toggle view Watches"
msgid "View Watches"
msgstr "Alternar exibição Observadores"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Exibir histórico de saltos"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Exibir opções de projeto"
#: lazarusidestrconsts.liskmviewprojectsource
#, fuzzy
#| msgid "View project source"
msgid "View Project Source"
msgstr "Exibir fonte do projeto"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Exibir informações da unidade"
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Aplicação iniciando inválida"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Iniciando linha de comando alvo"
#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Configurações da Área de Trabalho do Lazarus"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Diretório Lazarus"
#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Diretório Lazarus não encontrado"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "diretório para ser usado como diretório base"
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"
#: lazarusidestrconsts.lislazarusfile
#, fuzzy
#| msgid "Lazarus File"
msgid "Lazarus file"
msgstr "Arquivo Lazarus"
#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Formulário Lazarus"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "IDE do Lazarus"
#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Arquivo de inclusões Lazarus"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID de idioma do Lazarus (ex. en, de, br, fi)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nome de idioma do Lazarus (ex. inglês, alemão)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opções] <nome-de-arquivo-do-projeto>"
#: lazarusidestrconsts.lislazarusotherfile
msgid "Lazarus other file"
msgstr ""
#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Pacote Lazarus"
#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Projeto Lazarus"
#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Arquivo de informações de Projeto Lazarus"
#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Fonte de Projeto Lazarus"
#: lazarusidestrconsts.lislazarussource
msgid "Lazarus Source"
msgstr ""
#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Unidade Lazarus"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Escolha o diretório de saída do executável da IDE"
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Confirma a exclusão deste perfil de construção ?"
#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Construir Ferramentas de Código"
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "Construir componentes (SynEdit, Ferramentas de Código)"
#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "Construir IDE"
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Construir SynEdit"
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Configurações Comuns"
#: lazarusidestrconsts.lislazbuildconfirmbuild
#| msgid "Confirm before rebuilding Lazarus"
msgid "Confirm before build"
msgstr "Confirmar antes de construir"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Confirmar exclusão"
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Definições"
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Definições sem -d"
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Editar Definições"
#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr "Editar Definições"
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Editar lista de definições que podem ser usadas por qualquer perfil"
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Erro escrevendo arquivo"
#: lazarusidestrconsts.lislazbuildidewithoutpackages
msgid "IDE without Packages"
msgstr ""
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%s\"lazbuild\" não é interativo, abortando agora."
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Gerenciar Perfis Construção"
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Gerenciar perfis"
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Nome do perfil ativo"
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Adicionar Novo Perfil"
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Opções de contrução atuais estão associadas com:"
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opções:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Opções passadas ao compilador"
#: lazarusidestrconsts.lislazbuildprofile
#, fuzzy
#| msgid "Profile to Build"
msgid "Profile to build"
msgstr "Perfil à Construir"
#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "Atualizar"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Renomear Perfil"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Novo nome para perfil:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
#| msgid "Restart after building the IDE"
msgid "Restart after building IDE"
msgstr "Reiniciar após construir IDE"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Reiniciar Lazarus automaticamente após construção da IDE (sem efeito ao contruir outras partes)"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Selecione perfis à construir"
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Exibir diálogo confirmação ao contruir diretamente do menu Ferramentas"
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "CPU Alvo:"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Diretório alvo:"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "SO Alvo:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Impossível escrever arquivo \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Atualizar \"revision.inc\""
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Atualizar informação revisão no diálogo \"Sobre Lazarus\""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Limpar + Construir tudo"
#: lazarusidestrconsts.lislclwidgettype
#, fuzzy
#| msgid "LCL Widget Type"
msgid "LCL widget type"
msgstr "Tipo \"Widget\" LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Adicionar vínculo ao herdado"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copiar do herdado"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Mover entradas para herdado"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "A unidade %s não é propriedade de nenhum pacote ou projeto.%sFavor adicionar a unidade a um pacote ou projeto.%sImpossível criar o arquivo \"fpdoc\"."
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Esquefa"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Espaço da borda esquerda. Este valor será adicionado a base do espaço da borda e usado para o espaço esquerdo do controle."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ancoragem a esquerda"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Este é o controle irmão ao qual o lado esquerdo está ancorado. Deixar vazio para o controle-pai."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Lados Esquerdos"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Justificar a esquerda"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr ""
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Níveis"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "Arquivo LFM"
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Arquivo LFM corrompido"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM está ok"
#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEsta biblioteca é software livre; você pode redistribuí-la e/ou modificá-la sob os termos da GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior. %sEste programa é distribuido na esperanca de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.%sVocê deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
#| msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "Biblioteca%sUma biblioteca Free Pascal (.dll sobre Windows, .so sobre Linux, .dylib sobre MacOS X). O fonte da biblioteca é automaticamente mantido pelo Lazarus."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "caminho biblioteca."
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Linha:"
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Linha/Comprimento"
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Vínculo:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "Opções do Vinculador"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Alvo vínculo"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "lista de todos os valores \"case\""
#: lazarusidestrconsts.lisloadedsuccessfully
msgid "Loaded successfully"
msgstr ""
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Carga %s falhou."
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "Locais"
#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr ""
#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr ""
#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr ""
#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr ""
#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "Avaliar expressão"
#: lazarusidestrconsts.lislogmessage
#, fuzzy
#| msgid "Log message"
msgid "Log Message"
msgstr "Mensagem registro"
#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr "Logotipo"
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "Seq.caracteres minúsculas"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "Seq.caracteres minúsculas dada como parâmetro"
#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr "Arquivos inclusão lrs"
#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "Mac Pascal"
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Macro %s"
#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr "Nome macro"
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Inserir Dados"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Inserir parâmetros de execução"
#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr "Valor Macro"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
#, fuzzy
#| msgid "Main Unit has Application.CreateForm statements"
msgid "Main unit has Application.CreateForm statements"
msgstr "Unidade principal tem declarações \"Application.CreateForm\""
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
#, fuzzy
#| msgid "Main Unit has Application.Title statements"
msgid "Main unit has Application.Title statements"
msgstr "Unidade principal tem declarações \"Application.Title\""
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
#, fuzzy
#| msgid "Main Unit has Uses Section containing all Units of project"
msgid "Main unit has Uses section containing all units of project"
msgstr "Unidade principal tem Seção \"Uses\" contendo todas as unidades do projeto"
#: lazarusidestrconsts.lismainunitispascalsource
#, fuzzy
#| msgid "Main Unit is Pascal Source"
msgid "Main unit is Pascal source"
msgstr "Unidade principal é Fonte Pascal"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Gerar Executável"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "\"Make\" não encontrado"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Criar recurso de sequência de caracteres"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Adicionar a seção"
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "O recurso de sequência de caracteres %s%s%s já existe.%sFavor escolher outro nome.%sUse Ignorar para adicionar assim mesmo."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opções de Conversão"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identificador Personalizado"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identificador"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Comprimento identificador:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Prefixo identificador:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Inserir alfabeticamente"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Inserir contexto sensível"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Seção Recurso de sequência de carac. inválida"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Favor escolher um seção de recurso de sequência de caracteres da lista."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Recurso de sequência de carac. já existe"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Seção Recurso sequência caracteres:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Visualizar fonte"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Constante de sequência de caracteres no fonte"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Sequências de carac. com o mesmo valor:"
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Máximo %d"
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr "%s Talvez você tenha que recompilar o pacote."
#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Despejo Memória"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Abortar Construção"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Sobre FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
#, fuzzy
#| msgid "Add breakpoint"
msgid "Add &Breakpoint"
msgstr "Adicionar ponto de parada"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr ""
#: lazarusidestrconsts.lismenuaddjumppointtohistory
#, fuzzy
#| msgid "Add jump point to history"
msgid "Add Jump Point to History"
msgstr "Adicionar ponto de salto ao histórico"
#: lazarusidestrconsts.lismenuaddtoproject
#, fuzzy
#| msgid "Add editor file to Project"
msgid "Add Editor File to Project"
msgstr "Adicionar arquivo editor ao Projeto"
#: lazarusidestrconsts.lismenuaddwatch
#, fuzzy
#| msgid "Add watch ..."
msgid "Add &Watch ..."
msgstr "Adicionar observador ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
#, fuzzy
#| msgid "Break Lines in selection"
msgid "Break Lines in Selection"
msgstr "Interromper Linhas na seleção"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Construir Arquivo"
#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus with current profile"
msgid "Build Lazarus with Current Profile"
msgstr "Construir Lazarus com o perfil atual"
#: lazarusidestrconsts.lismenubuildlazarusprof
#, fuzzy
#| msgid "Build Lazarus with profile: %s"
msgid "Build Lazarus with Profile: %s"
msgstr "Construir Lazarus com perfil: %s"
#: lazarusidestrconsts.lismenuchecklfm
#, fuzzy
#| msgid "Check LFM file in editor"
msgid "Check LFM File in Editor"
msgstr "Verificar arquivo LFM no Editor"
#: lazarusidestrconsts.lismenucleandirectory
#, fuzzy
#| msgid "Clean directory ..."
msgid "Clean Directory ..."
msgstr "Limpar diretório ..."
#: lazarusidestrconsts.lismenucleanupcompiled
msgid "Clean up Build Files ..."
msgstr ""
#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close a&ll editor files"
msgid "Close A&ll Editor Files"
msgstr "Fechar &tudo"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Fechar Projeto"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
#, fuzzy
#| msgid "CodeTools defines editor ..."
msgid "CodeTools Defines Editor ..."
msgstr "Editor definições das ferramentas de código ..."
#: lazarusidestrconsts.lismenucommentselection
#, fuzzy
#| msgid "Comment selection"
msgid "Comment Selection"
msgstr "Comentar seleção"
#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Opções do Compilador ..."
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Completar Código"
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configurar arquivo Construir+Executar ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
#, fuzzy
#| msgid "Configure custom components ..."
msgid "Configure Custom Components ..."
msgstr "Configurar componentes personalizados ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
#, fuzzy
#| msgid "Configure external tools ..."
msgid "Configure External Tools ..."
msgstr "Configurar ferramentas externas ..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configurar \"Construção Lazarus\" ..."
#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Configurar Ajuda ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Ajuda de contexto sensível"
#: lazarusidestrconsts.lismenuconvertdelphipackage
#, fuzzy
#| msgid "Convert Delphi package to Lazarus package ..."
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Converter pacote Delphi para Lazarus..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project ..."
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Converter projeto Delphi para Lazarus..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit ..."
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Converter unidade Delphi para Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert binary DFM to text LFM + check syntax ..."
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "Converter arquivo binário DFM para LFM texto e verificar sintaxe..."
#: lazarusidestrconsts.lismenuconvertencoding
#, fuzzy
#| msgid "Convert encoding of projects/packages ..."
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Converter codificação dos projetos/pacotes ..."
#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "Criar arquivos \"FPDoc\""
#: lazarusidestrconsts.lismenudebugwindows
#, fuzzy
#| msgid "Debug windows"
msgid "Debug Windows"
msgstr "Janelas de Depuração"
#: lazarusidestrconsts.lismenudiff
#| msgid "Diff"
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff ..."
msgstr "Comparar (Diff)..."
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Editar"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Modelos de Código ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Editar Ajuda contexto sensível"
#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Install/Uninstall packages ..."
msgid "Install/Uninstall Packages ..."
msgstr "Instalar/Desinstalar pacotes ..."
#: lazarusidestrconsts.lismenueditor
#, fuzzy
#| msgid "Menu Editor..."
msgid "Menu Editor ..."
msgstr "Editor Menu..."
#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Criar Submenu"
#: lazarusidestrconsts.lismenueditordeletefromtemplate
#, fuzzy
#| msgid "Delete From Template..."
msgid "Delete From Template ..."
msgstr "Excluir do Modelo..."
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Excluir Item"
#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Manipulador Evento \"OnClick\""
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
#, fuzzy
#| msgid "Insert From Template..."
msgid "Insert From Template ..."
msgstr "Inserir do Modelo..."
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Inserir Novo Item (após)"
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Inserir Novo Item (antes)"
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor de Menu"
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Mover Abaixo (ou direita)"
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Mover Acima (ou esquerda)"
#: lazarusidestrconsts.lismenueditornewtemplatedescription
#, fuzzy
#| msgid "New Template Description..."
msgid "New Template Description ..."
msgstr "Nova Descrição de Modelo..."
#: lazarusidestrconsts.lismenueditorsaveastemplate
#, fuzzy
#| msgid "Save As Template..."
msgid "Save As Template ..."
msgstr "Salvar Como Modelo..."
#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Selecionar Menu:"
#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Selecionar Modelo:"
#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Visualizar Modelo"
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr ""
#: lazarusidestrconsts.lismenuencloseselection
#, fuzzy
#| msgid "Enclose selection ..."
msgid "Enclose Selection ..."
msgstr "Circundar seleção ..."
#: lazarusidestrconsts.lismenuevaluate
#, fuzzy
#| msgid "Evaluate/Modify ..."
msgid "E&valuate/Modify ..."
msgstr "Avaliar/Modificar ..."
#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr ""
#: lazarusidestrconsts.lismenuextractproc
#, fuzzy
#| msgid "Extract procedure ..."
msgid "Extract Procedure ..."
msgstr "Extrair procedimento ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Arquivo"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Localizar"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Localizar ..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
#, fuzzy
#| msgid "Find other end of code block"
msgid "Find Other End of Code Block"
msgstr "Localizar outro final do bloco de código"
#: lazarusidestrconsts.lismenufindcodeblockstart
#, fuzzy
#| msgid "Find code block start"
msgid "Find Start of Code Block"
msgstr "Localizar início do bloco de código"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
#, fuzzy
#| msgid "Find Declaration at cursor"
msgid "Find Declaration at Cursor"
msgstr "Localizar Declaração sob o cursor"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Localizar referências do identificador ..."
#: lazarusidestrconsts.lismenufindinfiles
#, fuzzy
#| msgid "Find &in files ..."
msgid "Find &in Files ..."
msgstr "Localizar &nos arquivos ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Localizar &Próxima"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Localizar &Anterior"
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Opções ..."
#: lazarusidestrconsts.lismenugotoincludedirective
#, fuzzy
#| msgid "Goto include directive"
msgid "Goto Include Directive"
msgstr "Ir para a diretiva de inclusão"
#: lazarusidestrconsts.lismenugotoline
#, fuzzy
#| msgid "Goto line ..."
msgid "Goto Line ..."
msgstr "Ir para linha ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced IFDEF/ENDIF"
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Adivinhar IFDEF/ENDIF fora de lugar"
#: lazarusidestrconsts.lismenuguessunclosedblock
#, fuzzy
#| msgid "Guess unclosed block"
msgid "Guess Unclosed Block"
msgstr "Adivinhar bloco não fechado"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "Aj&uda"
#: lazarusidestrconsts.lismenuideinternals
#, fuzzy
#| msgid "IDE internals"
msgid "IDE Internals"
msgstr "Interno IDE"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Pesquisa Incremental"
#: lazarusidestrconsts.lismenuindentselection
#, fuzzy
#| msgid "Indent selection"
msgid "Indent Selection"
msgstr "Recuar seleção"
#: lazarusidestrconsts.lismenuinsertchangelogentry
#, fuzzy
#| msgid "ChangeLog entry"
msgid "ChangeLog Entry"
msgstr "Entrada no registro alterações"
#: lazarusidestrconsts.lismenuinsertcharacter
#, fuzzy
#| msgid "Insert from Character Map"
msgid "Insert from Character Map ..."
msgstr "Inserir do Mapa de Caracteres"
#: lazarusidestrconsts.lismenuinsertcvskeyword
#, fuzzy
#| msgid "Insert CVS keyword"
msgid "Insert CVS Keyword"
msgstr "Palavra-Chave CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
#, fuzzy
#| msgid "Current date and time"
msgid "Current Date and Time"
msgstr "Data e hora atuais"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr ""
#: lazarusidestrconsts.lismenuinsertgeneral
#, fuzzy
#| msgid "General"
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Geral"
#: lazarusidestrconsts.lismenuinsertgplnotice
#, fuzzy
#| msgid "GPL notice"
msgid "GPL Notice"
msgstr "Aviso GPL"
#: lazarusidestrconsts.lismenuinsertlgplnotice
#, fuzzy
#| msgid "LGPL notice"
msgid "LGPL Notice"
msgstr "Aviso LGPL"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
#, fuzzy
#| msgid "Modified LGPL notice"
msgid "Modified LGPL Notice"
msgstr "Nota LGL modificada"
#: lazarusidestrconsts.lismenuinsertusername
#, fuzzy
#| msgid "Current username"
msgid "Current Username"
msgstr "Nome Usuário atual"
#: lazarusidestrconsts.lismenuinspect
#, fuzzy
#| msgid "Inspect ..."
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Inspecionar ..."
#: lazarusidestrconsts.lismenujumpback
#, fuzzy
#| msgid "Jump back"
msgid "Jump Back"
msgstr "Saltar atrás"
#: lazarusidestrconsts.lismenujumpforward
#, fuzzy
#| msgid "Jump forward"
msgid "Jump Forward"
msgstr "Saltar adiante"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Saltar para"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr ""
#: lazarusidestrconsts.lismenujumptonextbookmark
#, fuzzy
#| msgid "Jump to next bookmark"
msgid "Jump to Next Bookmark"
msgstr "Saltar para o próximo marcador"
#: lazarusidestrconsts.lismenujumptonexterror
#, fuzzy
#| msgid "Jump to next error"
msgid "Jump to Next Error"
msgstr "Saltar para o próximo erro"
#: lazarusidestrconsts.lismenujumptoprevbookmark
#, fuzzy
#| msgid "Jump to previous bookmark"
msgid "Jump to Previous Bookmark"
msgstr "Saltar para o marcador anterior"
#: lazarusidestrconsts.lismenujumptopreverror
#, fuzzy
#| msgid "Jump to previous error"
msgid "Jump to Previous Error"
msgstr "Saltar para o erro anterior"
#: lazarusidestrconsts.lismenulowercaseselection
#, fuzzy
#| msgid "Lowercase selection"
msgid "Lowercase Selection"
msgstr "Seleção em minúsculas"
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Criar recurso de sequência de caracteres ..."
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Novo Componente"
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Novo Formulário"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Novo ..."
#: lazarusidestrconsts.lismenunewpackage
#, fuzzy
#| msgid "New package ..."
msgid "New Package ..."
msgstr "Novo pacote ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Novo Projeto ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
#, fuzzy
#| msgid "New Project from file ..."
msgid "New Project from File ..."
msgstr "Novo Projeto do Arquivo ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nova Unidade"
#: lazarusidestrconsts.lismenuok
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&OK"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Ajuda Online"
#: lazarusidestrconsts.lismenuopen
#| msgid "Open ..."
msgid "&Open ..."
msgstr "A&brir ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
#, fuzzy
#| msgid "Open filename at cursor"
msgid "Open Filename at Cursor"
msgstr "Abrir arquivo sob o cursor"
#: lazarusidestrconsts.lismenuopenpackage
#, fuzzy
#| msgid "Open loaded package ..."
msgid "Open Loaded Package ..."
msgstr "Abrir pacote carregado ..."
#: lazarusidestrconsts.lismenuopenpackagefile
#, fuzzy
#| msgid "Open package file (.lpk) ..."
msgid "Open Package File (.lpk) ..."
msgstr "Abrir arquivo de pacote (.lpk)"
#: lazarusidestrconsts.lismenuopenpackageofcurunit
#, fuzzy
#| msgid "Open package of current unit"
msgid "Open Package of Current Unit"
msgstr "Abrir pacote da unidade atual"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Abrir Projeto ..."
#: lazarusidestrconsts.lismenuopenrecent
#| msgid "Open &Recent ..."
msgid "Open &Recent"
msgstr "Abrir &Recente"
#: lazarusidestrconsts.lismenuopenrecentpkg
#, fuzzy
#| msgid "Open recent package"
msgid "Open Recent Package"
msgstr "Abrir pacote recente"
#: lazarusidestrconsts.lismenuopenrecentproject
#| msgid "Open Recent Project ..."
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Abrir Projeto Recente"
#: lazarusidestrconsts.lismenupackage
#, fuzzy
#| msgid "&Package"
msgid "Pa&ckage"
msgstr "Pa&cotes"
#: lazarusidestrconsts.lismenupackagegraph
#, fuzzy
#| msgid "Package Graph ..."
msgid "Package Graph"
msgstr "Gráfico de Pacotes ..."
#: lazarusidestrconsts.lismenupackagelinks
#, fuzzy
#| msgid "Package links ..."
msgid "Package Links ..."
msgstr "Vínculos pacotes ..."
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr ""
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Lista de Procedimentos..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projeto"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspetor de Projetos"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Opções de Projeto ..."
#: lazarusidestrconsts.lismenuprojectrun
#, fuzzy
#| msgid "Run"
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Executar"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publicar Projeto ..."
#: lazarusidestrconsts.lismenuquickcompile
#, fuzzy
#| msgid "Quick compile"
msgid "Quick Compile"
msgstr "Compilação rápida"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
#, fuzzy
#| msgid "Quick syntax check"
msgid "Quick Syntax Check"
msgstr "Verificação rápida de sintaxe"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Verificação rápida de sintaxe OK"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Remover do Projeto ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Renomear Identificador ..."
#: lazarusidestrconsts.lismenureportingbug
#, fuzzy
#| msgid "Reporting a bug"
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Reportar uma falha (\"bug\")..."
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
#, fuzzy
#| msgid "Rescan FPC source directory"
msgid "Rescan FPC Source Directory"
msgstr "Reexaminar diretório fonte do FPC"
#: lazarusidestrconsts.lismenuresetdebugger
#, fuzzy
#| msgid "Reset debugger"
msgid "Reset Debugger"
msgstr "Parar Depurador"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Reverter"
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "Executa&r"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Executar Arquivo"
#: lazarusidestrconsts.lismenurunparameters
#, fuzzy
#| msgid "Run Parameters ..."
msgid "Run &Parameters ..."
msgstr "Parâmetros de Execução ..."
#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Run to &cursor"
msgid "Run to &Cursor"
msgstr "Executar até o Cursor"
#: lazarusidestrconsts.lismenusave
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Salva&r"
#: lazarusidestrconsts.lismenusaveas
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Salvar &Como ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Salvar Projeto"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Salvar Projeto Como ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Localizar"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Selecionar"
#: lazarusidestrconsts.lismenuselectall
#, fuzzy
#| msgid "Select all"
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Selecionar tudo"
#: lazarusidestrconsts.lismenuselectcodeblock
#, fuzzy
#| msgid "Select code block"
msgid "Select Code Block"
msgstr "Selecionar bloco de código"
#: lazarusidestrconsts.lismenuselectline
#, fuzzy
#| msgid "Select line"
msgid "Select Line"
msgstr "Selecionar linha"
#: lazarusidestrconsts.lismenuselectparagraph
#, fuzzy
#| msgid "Select paragraph"
msgid "Select Paragraph"
msgstr "Selecionar parágrafo"
#: lazarusidestrconsts.lismenuselecttobrace
#, fuzzy
#| msgid "Select to brace"
msgid "Select to Brace"
msgstr "Selecionar para fixar"
#: lazarusidestrconsts.lismenuselectword
#, fuzzy
#| msgid "Select word"
msgid "Select Word"
msgstr "Selecionar palavra"
#: lazarusidestrconsts.lismenusetfreebookmark
#, fuzzy
#| msgid "Set a free bookmark"
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Definir um marcador livre"
#: lazarusidestrconsts.lismenushowexecutionpoint
#, fuzzy
#| msgid "S&how execution point"
msgid "S&how Execution Point"
msgstr "Exibir ponto execução"
#: lazarusidestrconsts.lismenusortselection
#, fuzzy
#| msgid "Sort selection ..."
msgid "Sort Selection ..."
msgstr "Ordenar seleção ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr ""
#: lazarusidestrconsts.lismenustepinto
#, fuzzy
#| msgid "Step in&to"
msgid "Step In&to"
msgstr "Passar dentro"
#: lazarusidestrconsts.lismenustepintocontext
#, fuzzy
#| msgid "Step into (Context)"
msgid "Step Into (Context)"
msgstr "Passar dentro (Contexto)"
#: lazarusidestrconsts.lismenustepintoinstr
#, fuzzy
#| msgid "Step into instruction"
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "Passar dentro instrução"
#: lazarusidestrconsts.lismenustepintoinstrhint
#, fuzzy
#| msgid "Step into instruction"
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "Passar dentro instrução"
#: lazarusidestrconsts.lismenustepout
#, fuzzy
#| msgid "Step o&ut"
msgid "Step O&ut"
msgstr "Passar fora"
#: lazarusidestrconsts.lismenustepover
#, fuzzy
#| msgid "&Step over"
msgid "&Step Over"
msgstr "Passar sobre"
#: lazarusidestrconsts.lismenustepovercontext
#, fuzzy
#| msgid "Step over (Context)"
msgid "Step Over (Context)"
msgstr "Passar sobre (Contexto)"
#: lazarusidestrconsts.lismenustepoverinstr
#, fuzzy
#| msgid "Step over instruction"
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "Passar sobre instrução"
#: lazarusidestrconsts.lismenustepoverinstrhint
#, fuzzy
#| msgid "Step over instruction"
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "Passar sobre instrução"
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutabstospacesselection
#, fuzzy
#| msgid "Tabs to spaces in selection"
msgid "Tabs to Spaces in Selection"
msgstr "Tabulações para espaços na seleção"
#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Sobre"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Conteúdo"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Menu Editar Padrão"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Menu Arquivo Padrão"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Menu Ajuda Padrão"
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Localizar"
#: lazarusidestrconsts.lismenutemplatefindnext
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
msgid "Find Next"
msgstr "Localizar Próximo"
#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Abrir Recente"
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Tutorial"
#: lazarusidestrconsts.lismenutogglecomment
#, fuzzy
#| msgid "Toggle comment"
msgid "Toggle Comment in Selection"
msgstr "Alternar comentário"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Ferramentas"
#: lazarusidestrconsts.lismenuuncommentselection
#, fuzzy
#| msgid "Uncomment selection"
msgid "Uncomment Selection"
msgstr "Descomentar seleção"
#: lazarusidestrconsts.lismenuunindentselection
#, fuzzy
#| msgid "Unindent selection"
msgid "Unindent Selection"
msgstr "Retirar recuo da seleção"
#: lazarusidestrconsts.lismenuuppercaseselection
#, fuzzy
#| msgid "Uppercase selection"
msgid "Uppercase Selection"
msgstr "Seleção em maiúsculas"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr ""
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "E&xibir"
#: lazarusidestrconsts.lismenuviewanchoreditor
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Editor de Âncora"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Pontos de parada"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Chamada de Pilha"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Navegador Código"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Explorador de Código"
#: lazarusidestrconsts.lismenuviewcomponentpalette
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Paleta de Componentes"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Componentes"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Registro de Eventos"
#: lazarusidestrconsts.lismenuviewdebugoutput
#, fuzzy
#| msgid "Debug output"
msgid "Debug Output"
msgstr "Saída da Depuração"
#: lazarusidestrconsts.lismenuviewforms
#, fuzzy
#| msgid "Forms..."
msgid "Forms ..."
msgstr "Formulários..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lismenuviewidespeedbuttons
#, fuzzy
#| msgid "IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE Speed Buttons"
msgstr "Botões IDE"
#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump History ..."
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Saltar para histórico ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Variáveis Locais"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Mensagens"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspetor de Objetos"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr ""
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgid "Terminal Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registradores"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Navegador Restrições"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Resultados da busca"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor de Código"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr ""
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Lista ToDo (Para Fazer)"
#: lazarusidestrconsts.lismenuviewtoggleformunit
#, fuzzy
#| msgid "Toggle form/unit view"
msgid "Toggle Form/Unit View"
msgstr "Alternar exibição formulário/unidade"
#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "Unit Dependencies"
msgid "Unit Dependencies ..."
msgstr "Dependências da Unidade"
#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "Unit Information"
msgid "Unit Information ..."
msgstr "Informações da Unidade"
#: lazarusidestrconsts.lismenuviewunits
#, fuzzy
#| msgid "Units..."
msgid "Units ..."
msgstr "Unidades..."
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Observadores"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Janela"
#: lazarusidestrconsts.lismeother
#, fuzzy
#| msgid "Other"
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Outros"
#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr ""
#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr "Mensagem não contém informação de posição arquivo:%s%s"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor Mensagens"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Classe do método não encontrada"
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Eventos faltando"
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Identificadores faltando"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Pacotes faltando"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Suas opções são:"
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Comentar"
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Apenas para Delphi"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Comentar as unidades selecionadas."
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Usar as unidades apenas para Delphi."
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Procurar por unidades. Caminhos encontrados serão adicionados às configurações do projeto."
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Abortar agora, instalar pacotes ou corrigir caminhos e tentar novamente."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Caminho Busca Unidades"
#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr ""
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEsta biblioteca é software livre; você pode redistribuí-la e/ou moficá-la sob os termos da licença GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior com as seguintes modificações:%sComo uma exceção especial, os detentores do copyright desta biblioteca dão permissão para usá-la com módulos independentes para produzir um executável, independentemente dos termos de licença destes módulos independentes, e copiar e distribuir o executável resultante sob os termos de sua escolha, desde que você encontre, para cada módulo independente vinculado, os termos e condições da licença daquele módulo. Um módulo independente e um módulo que não é derivado ou baseado nesta biblioteca. Se você modificar esta biblioteca você deve estender esta exceção a sua versão da biblioteca, mas não é obrigado a fazer isto. Se você não quiser fazer isto, elimine o estatuto desta exceção da sua versão.%sEste programa é distribuido na esperança de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.%sVocê deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Modificar"
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Mais"
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Mover \"%s\" uma posição abaixo"
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Mover \"%s\" uma posição acima"
#: lazarusidestrconsts.lismovepage
#, fuzzy
#| msgid "Move Page ..."
msgid "Move Page"
msgstr "Mover Página ..."
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr ""
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr ""
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Salvar mensagens para arquivo (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Nome"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Conflito de nome"
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nome do novo procedimento"
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Nunca"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Novo"
#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "Novo Ancestral"
#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr "Novo modo construção"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nova Classe"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nova aplicação \"console\""
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
#| msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr "Criar uma nova aplicação \"CGI\".%sO fonte do programa é mantido pelo Lazarus."
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Criar um novo programa."
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Criar um novo arquivo do editor.%sEscolha um tipo."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Criar um novo arquivo de texto vazio."
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "Criar uma nova aplicação gráfica.%sO fonte da aplicação é mantido pelo Lazarus."
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Criar uma nova unidade Pascal."
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
#| msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr "Criar um novo programa.%sO fonte do programa é mantido pelo Lazarus."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Criar um novo projeto.%sEscolha um tipo."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Criar um novo pacote padrão.%sUm pacote é uma coleção de unidades e componentes."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Criar uma nova unidade com um \"datamodule\"."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
#| msgid "Create a new unit with a frame"
msgid "Create a new unit with a frame."
msgstr "Criar uma nova unidade com uma borda."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Criar uma nova unidade com um formulário LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Herdar de um formulário ou componente do projeto"
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nenhum item selecionado"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Favor selecionar um item primeiro."
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nova codificação:"
#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr "Novo grupo - um conjunto de modos"
#: lazarusidestrconsts.lisnewproject
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "(novo projeto)"
#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr "Nova configuração"
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
#, fuzzy
#| msgid "New units are added to uses sections:"
msgid "New units are added to uses sections"
msgstr "Novas unidades são adicionadas à seção \"uses\":"
#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Não"
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Sem arquivo de segurança"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Nenhum perfil selecionado para ser construído."
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Sem alterações"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nenhum código selecionado"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Nenhuma opção de compilador herdada."
#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr "Nenhum erro"
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "nenhuma dica"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Nenhuma janela da IDE selecionada"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Nenhum arquivo LFM"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Nenhuma macro selecionada"
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "sem nome"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%nenhum"
#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "nenhum"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "nenhum, clique para escolher"
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "Nenhum nó selecionado"
#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr "Nenhum arquivo pascal"
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Nenhum arquivo de programa %s%s%s encontrado."
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Seção de recurso sequência de carac. não encontrada."
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
#, fuzzy
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalmente o filtro é uma expressão regular. Em sintaxe simples \".\" é um caractere normal, \"*\" significa qualquer coisa, \"?\" significa qualquer caractere e \",\" e \";\" separam alternativas. Por exemplo: *.pas;*.pp corresponde a ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nenhuma constante de sequência de caracteres encontrada"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr ""
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Não é um pacote de instalação"
#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr "Não é um identificador pascal válido"
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Base"
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Esquefa"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Direita"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Topo"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "NOTA: Não foi possível criar Modelo Definições para fontes Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "NOTA: Não foi possível criar Modelo Definições para fontes Lazarus"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr ""
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Não implementado"
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Não implementado ainda:%s%s"
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Agora não"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr ""
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Criar"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Criar um novo projeto"
#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Selecione um tipo de projeto"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Número de arquivos à converter: %s"
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Padrão - \"Object Pascal\""
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "caminho objeto"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Alternar para aba Favoritos do Inspetor de Objetos"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr "Alternar para aba Favoritos do Inspetor de Objetos após pedir por um nome de componente"
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Desligado)"
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Adicionar as propriedades favoritas"
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Escolha uma classe base para a propriedade favorita %s%s%s."
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Classe %s%s%s não encontrada."
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Remover das propriedades favoritas"
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "instalação automática dinâmica"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "instalação automática estática"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Descrição: "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sDescrição: %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Nome de Arquivo: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "instalado dinamicamente"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "instalado estaticamente"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "faltando"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "modificado"
#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Nenhum pacote selecionado"
#: lazarusidestrconsts.lisoipopenloadedpackage
#, fuzzy
#| msgid "Open loaded package"
msgid "Open Loaded Package"
msgstr "Abrir pacote carregado"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nome do Pacote"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Favor selecionar um pacote"
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Favor selecionar um pacote para abrir"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "somente leitura"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Estado"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sEste pacote está instalado, mas o arquivo LPK não foi encontrado"
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sEste pacote foi criado automaticamente"
#: lazarusidestrconsts.lisok
#, fuzzy
#| msgid "ok"
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "ok"
#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "Ancestral Antigo"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Classe Antiga"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (Ligado)"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Na quebra linha (ou seja, teclas retorno ou \"enter\")"
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Somente localizar palavras inteiras"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Ao colar da Área de Transferência"
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Abrir"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Abrir como arquivo XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Abrir editor ao abrir unidade"
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Abrir arquivo existente"
#: lazarusidestrconsts.lisopenfile
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Abrir arquivo"
#: lazarusidestrconsts.lisopenfile2
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Abrir arquivo"
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Abrir %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Abrir Pacote?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Abrir pacote %s"
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Abrir Arquivo de Pacote"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Abrir Projeto?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Abrir projeto"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Abrir projeto novamente"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Abrir Arquivo de Projeto"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Abrir vínculo simbólico"
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Abrir alvo"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Abrir arquivo como código normal"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Abrir o pacote %s?"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Abrir o projeto %s?"
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr ""
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr ""
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "ou"
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Sobrepor idioma. Por exemplo --language=de. Veja os valores possíveis no diretório \"languages\"."
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%ssobrepor o compilador padrão. ex. ppc386 ppcx64 ppcppc etc. padrão é armazenado em \"environmentoptions.xml\""
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
#, fuzzy
#| msgid "%soverride the project build mode."
msgid "%soverride the project or IDE build mode."
msgstr "%ssobrepõe o modo de construção do projeto."
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%ssobrepor a cpu do projeto. ex. i386 x86_64 powerpc powerpc_64 etc. padrão: %s"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%ssobrepor o sistema operacional do projeto. ex. win32 linux. padrão: %s"
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%ssobregarrega o \"widgetset\" do projeto. ex. gtk gtk2 qt win32 carbon. padrão: %s"
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Sobrescrever arquivo?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Sobrescrever arquivo em disco"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Proprietário' já usado por TReader/TWriter. Favor escolher outro nome."
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Pacote"
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "pacote %s"
#: lazarusidestrconsts.lispackageinfo
#, fuzzy
#| msgid "Package Info"
msgid "Package info"
msgstr "Informações Pacote"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Nome do pacote começa com ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Nome do pacote contém ..."
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Pacote necessita instalação"
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr ""
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr ""
#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Pacotes a instalar na IDE"
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "unidade pacote"
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", analisado"
#: lazarusidestrconsts.lispascalfile
msgid "Pascal file"
msgstr ""
#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "Arquivo fonte Pascal"
#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "unidade Pascal"
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Núm. Passos"
#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Colar"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "colar área de transferência"
#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr "Colar texto da área de transferência"
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Caminho"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Navegar"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr ""
#: lazarusidestrconsts.lispatheditmovepathdown
#, fuzzy
#| msgid "Move path down"
msgid "Move path down (Ctrl+Down)"
msgstr "Mover caminho abaixo"
#: lazarusidestrconsts.lispatheditmovepathup
#, fuzzy
#| msgid "Move path up"
msgid "Move path up (Ctrl+Up)"
msgstr "Move caminho acima"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr ""
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr ""
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr ""
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Modelos de caminho"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Caminhos de busca:"
#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Selecione o diretório"
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr ""
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Caminho do utilitário \"make\""
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Caminho para Instância com falha:"
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Pausar"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr ""
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr ""
#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Adicionar um item"
#: lazarusidestrconsts.lispckeditaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Adicionar ao projeto"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Aplicar alterações"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Chamar procedimento de %sRegistro%s da unidade selecionada"
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Limpar nome arquivo padrão/preferencial da dependência"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Compilar tudo?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compilar pacote"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Opções do Compilador para o Pacote %s"
#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Opções do Compilador"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Criar \"Makefile\""
#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, padrão: %s"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Propriedades de Dependência"
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Editar Opções Gerais"
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Editar Opções para compilar o pacote"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Propriedades do Arquivo"
#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Opções Gerais"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Instalar"
#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Instalar pacote na IDE"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Versão máxima inválida"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Versão mínima inválida"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Versão Máxima:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Versão Mínima:"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Modificado: %s"
#: lazarusidestrconsts.lispckeditmore
#| msgid "More ..."
msgid "More >>"
msgstr "Mais >>"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Mover dependência abaixo"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Mover dependência acima"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Pacote %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Pacote %s%s%s foi alterado.%sSalvar pacote?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "pacote %s não salvo"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Página: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Re-adicionar dependência"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Re-adicionar arquivo"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Somente Leitura: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
#, fuzzy
#| msgid "Recompile all required"
msgid "Recompile All Required"
msgstr "Recompilar todos requeridos"
#: lazarusidestrconsts.lispckeditrecompileclean
#, fuzzy
#| msgid "Recompile clean"
msgid "Recompile Clean"
msgstr "Recompilar e Limpar"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Re-compilar este e todos os pacotes requeridos?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Complementos registrados"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Unidade de registro"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Remover dependência"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Remover Dependência?"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Remover dependência %s%s%s%s do pacote %s%s%s?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Pacotes requeridos removidos"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Remover arquivo"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Remover arquivo?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Remover arquivo %s%s%s%sdo pacote %s%s%s?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Remover item selecionado"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Pacotes Requeridos"
#: lazarusidestrconsts.lispckeditsavepackage
#, fuzzy
#| msgid "Save package"
msgid "Save Package"
msgstr "Salvar pacote"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Armazenar nome arquivo como padrão para esta dependência"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Armazenar nome arquivo como preferencial para esta dependência"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "A versão máxima %s%s%s não é uma versão de pacote válida.%s(bom exemplo 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "A versão mínima %s%s%s não é uma versão de pacote válida.%s(bom exemplo 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Desinstalar"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Exibir Fonte do Pacote"
#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "Auto criado"
#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Instalado"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Instalar na próxima inicialização"
#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Pacote selecionado é requerido por:"
#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Pacotes Carregados:"
#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Pacote %s não encontrado"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sEstado: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Desinstalar na próxima inicialização"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Adicionar opções para pacotes e projetos dependentes"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Adicionar caminhos para pacotes/projetos dependentes"
#: lazarusidestrconsts.lispckoptsauthor
#, fuzzy
#| msgid "Author:"
msgid "Author"
msgstr "Autor:"
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Auto incrementar a versão ao reconstruir"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Auto reconstruir se necessário"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Auto reconstruir quando reconstruindo tudo"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Personalizado"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
#, fuzzy
#| msgid "Description/Abstract"
msgid "Description / Abstract"
msgstr "Descrição/Abstrato"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
#, fuzzy
#| msgid "Designtime and Runtime"
msgid "Designtime and runtime"
msgstr "Tempo Projeto e Tempo Execução"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integração com a IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Incluir"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Tipo de pacote inválido"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Biblioteca"
#: lazarusidestrconsts.lispckoptslicense
#, fuzzy
#| msgid "License:"
msgid "License"
msgstr "Licença:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Vinculador"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Maior:"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Compilação manual (nunca automaticamente)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Menor:"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objeto"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Opções do Pacote"
#: lazarusidestrconsts.lispckoptspackagetype
#, fuzzy
#| msgid "PackageType"
msgid "Package type"
msgstr "Tipo de Pacote"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Provisão"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Lançamento"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "O pacote %s%s%s tem o \"flag\" de instalação automática.%sIsto significa que ele será instalado na IDE. Pacotes de Instalação%sdevem ser pacotes de Tempo Projeto."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Este pacote provê o mesmo que os pacotes à seguir:"
#: lazarusidestrconsts.lispckoptsupdaterebuild
#, fuzzy
#| msgid "Update/Rebuild"
msgid "Update / Rebuild"
msgstr "Atualizar/Reconstruir"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Uso"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr ""
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr ""
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr ""
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Abortar"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progresso"
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Uma unidade pascal deve ter extensão .pp ou .pas"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Retrair diretório"
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Conflito encontrado"
#: lazarusidestrconsts.lispedirectories
msgid "Directories"
msgstr "Diretórios"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Editar Unidade Virtual"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Expandir diretório"
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Arquivo:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Corrigir Caixa Nome Arquivos"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nome de arquivo de unidade inválido"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nome de unidade inválido"
#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr "Arquivos faltando no pacote %s"
#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr "Mover arquivo abaixo"
#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr "Mover arquivo acima"
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Novo arquivo não está no caminho de inclusões"
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Nenhum arquivo faltando. Todos existem."
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Remover arquivos"
#: lazarusidestrconsts.lisperemoveselectedfiles
msgid "Remove selected files"
msgstr "Remover arquivos selecionados"
#: lazarusidestrconsts.lisperevertpackage
#, fuzzy
#| msgid "Revert package"
msgid "Revert Package"
msgstr "Reverter pacote"
#: lazarusidestrconsts.lispesavepackageas
#, fuzzy
#| msgid "Save package as"
msgid "Save Package As ..."
msgstr "Salvar pacote como"
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Exibir hierarquia diretório"
#: lazarusidestrconsts.lispeshowmissingfiles
#, fuzzy
#| msgid "Show missing files"
msgid "Show Missing Files"
msgstr "Exibir arquivos faltando"
#: lazarusidestrconsts.lispesortfiles
#, fuzzy
#| msgid "Sort Files"
msgid "Sort Files Permanently"
msgstr "Ordenar arquivos"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Ordenar arquivos alfabeticamente"
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "O arquivo \"%s\" não está atualmente no caminho de inclusões do pacote.%sAdicioná-lo?"
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Já existe uma unidade com este nome.%sArquivo: %s"
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "O nome de unidade não é um identificador pascal válido."
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nome de unidade:"
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Nome de unidade e nome de arquivo não coincidem.%sEx: unit1.pas e Unit1"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Usar todas as unidades no diretório"
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Não usar nenhuma unidade no diretório"
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Caminho adicional para fontes compilados"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Diretório de saída"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Marca do Diretório Fonte do Pacote"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Caminho de unidade"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Você deseja realmente ignorar todas as alterações no pacote %s e recarregá-lo do arquivo?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nova unidade não está no caminho de unidades"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publicar Pacote"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Reverter pacote?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#| msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
msgstr "O arquivo %s%s%s%snão está atualmente no caminho de unidades do pacote.%s%sAdicionar %s%s%s ao caminho de unidades?"
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Clique com o botão direito na árvore de itens para obter um menu com todas as funções do pacote disponíveis."
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Há mais funções no menu \"PopUp\""
#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Binário"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Arquivo de Inclusão"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Despacha arquivo xml"
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Lazarus Form Text (Formulários)"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus Resource (Recursos)"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Unidade Principal"
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Texto"
#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Unidade"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Unidade Virtual"
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sAdicionando nova dependência para o pacote %s: pacote %s%s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sAdicionando nova dependência para o projeto %s: pacote %s%s"
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Adicionar unidade à cláusula \"uses\" do pacote. Desative isto apenas para unidades, que não devem ser compiladas em todos os casos."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Unidade ambígua encontrado"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Pacotes instalados automaticamente"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sAmbos os pacotes estão vinculados. Isto significa que um pacote usa o outro, ou ambos são usados por um terceiro pacote."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dependência quebrada"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr ""
#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr "Compilando pacote %s"
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Falha na exclusão"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Excluir arquivo de pacote antigo?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Excluir arquivo de pacote antigo %s%s%s?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Dependência sem proprietário: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Erro na leitura do arquivo"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Erro na leitura do Pacote"
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Erro: atualização arquivos \"po\" falhou para pacote %s"
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Erro na escrita do arquivo"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Erro na escrita do Pacote"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Arquivo já está no pacote"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Arquivo está no Projeto"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Nome do arquivo difere do Nome do Pacote"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Nome de arquivo em uso por outro pacote"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Nome de arquivo em uso pelo projeto"
#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Arquivo %s%s%s não encontrado."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Arquivo não salvo"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Instalando o pacote %s instalará automaticamente o pacote:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Instalando o pacote %s instalará automaticamente os pacotes:"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Nome de arquivo do compilador inválido"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Extensão de arquivo inválida"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Extensão do arquivo de pacote inválida"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nome de arquivo do pacote inválido"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nome de pacote inválido"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nome de Pacote Inválido"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Carregar o pacote %s substituirá o pacote %s%sdo arquivo %s.%sO pacote antigo pacote será alterado.%s%sSalvar pacote antigo %s?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "NovoPacote"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Pacote: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Conflitos de Pacotes"
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Pacote %s%s%s não tem um diretório de saída válido:%s%s%s%s"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Pacote não é de Tempo Projeto"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Pacote requerido"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "arquivo fonte principal do pacote"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "O nome do pacote já existe"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Pacotes devem ter a extensão .LPK"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Favor salvar o arquivo antes de adicioná-lo a um pacote."
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Projeto: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Reconstruir Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Renomear Arquivo para minúsculas?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Substituir arquivo existente %s%s%s?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Substituir Arquivo"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackage
#, fuzzy
#| msgid "Save Package?"
msgid "Save package?"
msgstr "Salvar Pacote?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Salvar Pacote %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "O arquivo deve ser renomeardo para minúsculas para%s%s%s%s?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Saltar este pacote"
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "Arquivo de configuração de pacotes estáticos"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "O arquivo de compilador para o pacote %s não é um executável válido:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "O arquivo %s%s%s%sjá está no pacote %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "O arquivo %s%s%s não é um pacote lazarus."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "O nome de arquivo %s%s%s não corresponde ao nome de pacote %s%s%sno arquivo.%sAlterar nome do pacote para %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "O nome de arquivo %s%s%s é parte do projeto atual.%sProjetos e Pacotes não devem compartilhar arquivos."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "O nome de arquivo %s%s%s está em uso por %sno pacote %s%s%s%sno arquivo %s%s%s."
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Falha ao carregar o seguinte pacote:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Falha ao carregar os seguintes pacotes:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sAs seguintes unidades serão adicionadas a seção \"uses\" de%s%s:%s%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Falha ao compilar o pacote %s%s%s.%sRemovê-lo da lista de instalação?"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "O nome de arquivo do pacote %s%s%s em%s%s%s%s não é um nome de pacote lazarus válido."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "O pacote %s é um pacote somente de tempo de execução.%sOs pacotes somente de tempo de execução, não podem ser instalados no IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also uses the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "O pacote %s%s%s está marcado para instalaçãoo, mas não pode ser encontrado.%sRemover dependência da lista de instalação de pacotes?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "O pacote %s é requerido por %s, que está marcado para instalação.%sVeja o gráfico de pacotes."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "O nome de pacote %s%s%s não é válido%sFavor escolher outro nome (ex: package1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "O nome de pacote %s%s%s de%sdo arquivo %s%s%s é inválido."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "O pacote %s%s%s foi marcado.%sAtualmente Lazarus apenas suporta pacotes estaticamente vinculados. A desinstalação real necessita reconstruir e reiniciar o Lazarus.%s%sReconstruir o Lazarus agora?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "O pacote %s%s%s foi marcado para instalação.%sAtualmente Lazarus apenas suporta pacotes estaticamente vinculados. A instalação real necessita reconstruir e reiniciar o Lazarus.%s%sReconstruir o Lazarus agora?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "O Projeto requer o pacote %s%s%s.%sMas ele não foi encontrado. Veja Projeto -> Inspetor de Projetos."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Há duas unidades com o mesmo nome:%s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Há uma unidade FPC com o mesmo nome do pacote:%s%s%s%s%s%s "
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Há uma unidade FPC com o mesmo nome como: %s%s%s%s%s de %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Há outro pacote com o nome %s%s%s.%sPacote em conflito: %s%s%s%sArquivo: %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, fuzzy
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Há um pacote %s%s%s carregado%sdo arquivo %s%s%s.%sVeja Componentes -> Gráfico de Pacotes.%sImpossível substituir."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Há um pacote não salvo nos pacotes requeridos. Veja o gráfico de pacotes."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Há uma unidade com o mesmo nome do pacote:%s%s1. %s%s%s de %s%s2. %s%s%s%s"
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Este é um pacote virtual. Ele não tem um fonte ainda. Favor salvar o pacote primeiro."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Impossível criar o diretório"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Impossível criar o diretório de saída %s%s%s%spara o pacote %s."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Impossível criar um diretório fonte de pacote %s%s%s%spara o pacote %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Impossível criar diretório alvo para lazarus:%s%s%s%s.%sEste diretório é necessário para a nova IDE alterada com seus pacotes personalizados."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Impossível excluir arquivo %s%s%s."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Impossível excluir arquivo"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Impossível excluir arquivo de estado antigo %s%s%s%spara pacote %s."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Impossível carregar pacote"
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Impossível abrir o pacote %s%s%s.%sEsse pacote foi marcado para instalação."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Impossível ler arquivo de estado %s%s%s%sdo pacote %s.%sErro: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Impossível escrever pacote %s%s%s%spara o arquivo %s%s%s.%sErro: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Impossível escrever arquivo de estado %s%s%s%sdo pacote %s.%sErro: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Desinstalar pacote?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Desinstalar pacote %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Pacote não salvo"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Usar unidade"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Aviso: O arquivo %s%s%s%spertence ao projeto atual."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "mantém"
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "novo"
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "remover"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr ""
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Não se pode registrar componentes sem unidade"
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "Ferramentas de código - ferramentas e funções para analisar, navegar e editar fontes Pascal"
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Classe de componente %s%s%s já definida"
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sNome do Aquivo: %s%s%s"
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Classe de componente inválida"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Nome de unidade inválido: %s"
#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Arquivo de pacote não encontrado"
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "Erro registro pacote"
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Procedimento de Registro nulo (\"nil\")"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Unidade de Registro foi chamada, mas o nenhum pacote está registrando."
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - O componente Editor utilizado pelo Lazarus. http://sourceforge.net/projects/synedit/"
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
#, fuzzy
#| msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgid "The FCL - Free Pascal Component Library provides the base classes for Object Pascal."
msgstr "A FCL - Free Pascal Component Library (Biblioteca de Componentes do Free Pascal) provê as classes básicas do Object Pascal."
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "A LCL - Lazarus Component Library (Biblioteca de Componentes do Lazarus) contém todos os componentes básicos para edição de formulários. "
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr ""
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "O pacote %s%s%s está instalado, mas nenhum arquivo de pacote válido (.LPK) foi encontrado.%sUm pacote fictício foi criado."
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "A RTL - Run-Time Library (Biblioteca de Tempo de Execução) é a base de todos os programas Free Pascal."
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Este é o pacote padrão. Usado apenas para componentes sem um pacote. Estes componentes são obsoletos."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Este pacote está instalado, mas o arquivo LPK não foi encontrado. Todos os seus componentes estão desativados. Favor corrigir."
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sNome da unidade: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr ""
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr ""
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "O arquivo não está em nenhum pacote carregado."
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Impossível ler arquivo de pacote %s%s%s.%sErro: %s"
#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr "Existe"
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Global"
#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr "Somente arquivos existentes"
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Vínculos Pacote"
#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Exibir vínculos globais"
#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Exibir vínculos usuário"
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Usuário"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgstr ""
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Favor abrir uma unidade antes de executar."
#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr "Favor selecionar primeiro um modo de contrução"
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Favor selecionar algum código para extrair um novo procedimento/método."
#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Todos>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Alterar Fonte"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copiar nome de método para Área de Transferência"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrar comparando qualquer parte do método"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrar comparando com início do método"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Saltar para a seleção"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Nenhum>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objetos"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Lista Procedimentos"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Escolha o diretório do arquivo .po"
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Não salvar informações de sessão"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Ponteiro"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Salvar no diretório da IDE"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Salvar em arquivo .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Salvar em arquivo .lps no diretório de projeto"
#: lazarusidestrconsts.lisposavesessionfoldstate
msgid "Save fold info"
msgstr ""
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Salvar informação de sessão em"
#: lazarusidestrconsts.lisposavesessionjumphistory
msgid "Save jump history"
msgstr ""
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Palavra precedente"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "diretório primário de configuração, onde Lazarus armazena seus arquivos de configuração. O padrão é "
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Caminho primário configuração"
#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr ""
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Privado"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Método Privado"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Provavelmente você necessita instalar alguns pacotes antes de continuar.%s%sAviso:%sO projeto usa os seguintes pacotes de tempo de desenho, que podem ser necessários para abrir o formulário no editor. Se você continuar, poderá obter erros de componentes faltando e a carga do formulário provavelmente criará resultados indesejáveis.%s%sÉ recomendado cancelar e instalar estes pacotes primeiro.%s%s"
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedimento"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedimento com interface"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programa"
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Programa%sUm programa Free Pascal. O fonte do programa é automaticamente mantido pelo Lazarus."
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Programa detectado"
#: lazarusidestrconsts.lisprogramnotfound
msgid "Program %s not found"
msgstr ""
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "O fonte do programa precisa ter uma extensão Pascal como .pas, .pp ou .lpr"
#: lazarusidestrconsts.lisprojaddaddfilestoproject
#, fuzzy
#| msgid "Add files to project"
msgid "Add Files to Project"
msgstr "Adicionar arquivos ao projeto"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Já existe a dependência"
#: lazarusidestrconsts.lisprojaddeditorfile
#, fuzzy
#| msgid "Add editor files"
msgid "Add Editor Files"
msgstr "Adicionar arquivos do editor"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Versão Min-Max inválida"
#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Nome de pacote inválido"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Nome de unidade Pascal inválido"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Versão Inválida"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Versão Máxima (opcional):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Versão Mínima (opcional):"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Novo Requerimento"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nome do Pacote:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Pacote não encontrado"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "A dependência %s%s%s não foi encontrada.%sFavor escolher um pacote existente."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "A Versão Máxima %s%s%s é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "A Versão Máxima é menor que a Versão Mínima."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "A Versão Mínima %s%s%s é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "O nome do pacote %s%s%s é inválido.%sPor favor escolha um pacote existente."
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "o projeto já tem uma dependência para o pacote %s%s%s"
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "O nome da unidade %s%s%s já existe no projeto%scom arquivo: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "O nome da unidade %s%s%s já existe na seleção%scom arquivo: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "O nome de unidade %s%s%s não é um identificador Pascal válido."
#: lazarusidestrconsts.lisprojaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to Project"
msgstr "Adicionar ao Projeto"
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Nome da unidade já existe"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projeto alterado"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Projeto alterado no disco"
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Diretório do projeto"
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Título na Barra de Tarefas também mostra o caminho do projeto"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nome de arquivo do projeto"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Caminho inclusões do projeto"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Arquivo de informações de projeto detectado"
#: lazarusidestrconsts.lisprojectinformation
#, fuzzy
#| msgid "Project Information"
msgid "Project information"
msgstr "Informação do Projeto"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projeto é executável"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Propriedades macro do projeto"
#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "macro \"ProjectUnitPath\""
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Diretório de saída do Projeto (ex. o diretório ppu)"
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr ""
#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr "Caminho Projeto:"
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Diretório onde o arquivo principal do projeto deve estar"
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr ""
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Projeto %s elevou classe exceção '%s'."
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Projeto %s elevou classe exceção '%s' com a mensagem:%s%s"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Caminho Fonte do Projeto"
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "Projeto %s%s%s criado com sucesso."
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "unidade projeto"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Caminho unidades do projeto"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Assistente de Projeto"
#: lazarusidestrconsts.lisprojfiles
msgid "Files:"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Confirmar exclusão de dependência"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Confirmar remoção arquivo"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Excluir dependência para %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inspetor de Projetos - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Pacotes requeridos removidos"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Remover arquivo %s do projeto?"
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Impossível ler arquivo de estado %s do projeto %s%sErro: %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Impossível escrever arquivo de estado para o projeto %s%sErro: %s"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Sempre construir (mesmo se nada for alterado)"
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Erro"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Impossível alterar a lista de auto-criação de formulários no fonte do programa.%sFavor corrigir os erros primeiro."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Marca do Diretório Fonte do Projeto"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Perguntar por valor"
#: lazarusidestrconsts.lisproperties
#| msgid "Properties (replace or delete)"
msgid "Properties (replace or remove)"
msgstr "Propriedades (substituir ou excluir)"
#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr "Propriedades das opções condicionais do compilador"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protegido"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Método Protegido"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Método Publico"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Método Publicado"
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Diretório publicação do projeto"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr ""
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
#, fuzzy
#| msgid "Invalid Exclude filter"
msgid "Invalid exclude filter"
msgstr "Filtro de Exclusão inválido"
#: lazarusidestrconsts.lispublprojinvalidincludefilter
#, fuzzy
#| msgid "Invalid Include filter"
msgid "Invalid include filter"
msgstr "Filtro de Inclusão inválido"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Salvar arquivo .LRS no diretório de saída."
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Uma unidade Pascal deve ter extensão .pp ou .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Editar unidade virtual"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Já existe uma unidade com este nome.%sArquivo: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "O nome de unidade não é um identificador pascal válido."
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
#, fuzzy
#| msgid "The unitname is used when the IDE extends uses clauses."
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "O nome de unidade é usado quando a IDE extende a cláusula \"uses\"."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Nome de unidade e Nome de arquivo não coincidem.%sEx: unit1.pas e Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Converter Projeto Delphi"
#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr "Novo Projeto"
#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr "Abrir Projeto"
#: lazarusidestrconsts.lispwopenrecentproject
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Abrir Projeto Recente"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View Example Projects"
msgstr ""
#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr "Criar variável local"
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Reparos rápidos"
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Correção rápida: Remover unidade"
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Localizar identificador"
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Sair"
#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Sair do Lazarus"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Erro de Leitura"
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr ""
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Registro/Estrutura"
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Refazer"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Registradores"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Expressão regular"
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Caminhos relativos"
#: lazarusidestrconsts.lisremove
#, fuzzy
#| msgid "remove"
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "remover"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Remover todas as propriedades inválidas"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Remover todas unidades"
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Remover da lista instalação"
#: lazarusidestrconsts.lisremovefromproject
#, fuzzy
#| msgid "Remove from project"
msgid "Remove from Project"
msgstr "Remover do projeto"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Remover do caminho de busca"
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr ""
#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Remover variável local %s"
#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr "Remover variável local"
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr "Remover arquivos inexistentes"
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Remover unidades selecionadas"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Removê-los"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Remover caminhos de \"Outros fontes\""
#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr "Remover unidade da seção \"uses\""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr ""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Renomear"
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Renomear arquivo?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Falha ao renomear arquivo"
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Renomear para %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Renomear para minúsculas"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Reabrir projeto"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Reabrir com outra codificação"
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Núm. Repetição:"
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Substituir"
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Substituição"
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Funções de substituição"
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Substituições"
#: lazarusidestrconsts.lisreplaceremoveunknown
#| msgid "Replace unknown types and properties"
msgid "Fix unknown properties and types"
msgstr "Corrigir propriedades e tipos desconhecidos"
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr ""
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Substituição da seleção falhou."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr "Requer FPC 2.4 ou maior. Como recursos Delphi"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Re-examinar"
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr ""
#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Erro no carregamento de recurso"
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Erro ao salvar recurso"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
#, fuzzy
#| msgid "Resource type of project:"
msgid "Resource type of project"
msgstr "Tipo recurso do projeto:"
#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr "Resposta: %sContinuar ?"
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Reiniciar"
#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr "Resulta :="
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Resultado:"
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "retorna lista de todos os valores da variável \"case\" em frente da variável"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Falha na reversão"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Direito"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Ancoragem a direita"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Espaço da borda Direita. Este valor será adicionado ao espaço da borda base e usado para o espaço direito do controle."
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Este é o controle irmão ao qual o lado direito está ancorado. Deixar vazio para o controle-pai."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Lados Direito"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Justificar à direita"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Raiz"
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Executar"
#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Executar"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "%s (executando ...)"
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Arquivo não executável"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "A aplicação servidora %s%s%s não é executável."
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Executar"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, can not be installed in IDE"
msgstr ""
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Falha executar até"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
#, fuzzy
#| msgid "Abstract methods - not yet overridden"
msgid "Abstract Methods - not yet overridden"
msgstr "Métodos abstratos - não sobrepostos ainda"
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Método abstrato de %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Cursor não está em uma declaração de classe"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE está ocupada"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s é uma classe abstrata, e tem %s métodos abstratos."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Nenhum método abstrato encontrado"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Sobrepor todos selecionados"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Sobrepor primeiro selecionado"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Selecionar nenhum"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Existem %s métodos abstratos para sobrepor.%sSelecionar os métodos para os quais devem ser criados \"stubs\":"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Não existem métodos abstrados sobrando para sobrepor."
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Este método não pode ser sobreposto porque está definido na classe atual"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Impossível exibir métodos abstratos da classe atual, porque"
#: lazarusidestrconsts.lissave
#, fuzzy
#| msgid "Save ..."
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Salvar ..."
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Salvar Tudo"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr ""
#: lazarusidestrconsts.lissaveallmessagestofile
#, fuzzy
#| msgid "Save all messages to file"
msgid "Save All Messages to File"
msgstr "Salvar todas as mensagens para arquivo"
#: lazarusidestrconsts.lissaveallmodified
#, fuzzy
#| msgid "save all modified files"
msgid "Save all modified files"
msgstr "salvar todos os arquivos alterados"
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Salvar e fechar diálogo"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Salvar e reconstruir IDE"
#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Salvar Como"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr ""
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Salvar alterações?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Salvar alterações no projeto \"%s\"?"
#: lazarusidestrconsts.lissavecurrenteditorfile
#, fuzzy
#| msgid "save current editor file"
msgid "Save current editor file"
msgstr "salvar o arquivo atual do editor"
#: lazarusidestrconsts.lissavedsuccessfully
msgid "Saved successfully"
msgstr ""
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Salvar informações do editor de arquivos que não são do projeto"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Salvar arquivo como"
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Salvar arquivo %s%s%s%santes de fechar o formulário %s%s%s?"
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Salvar informações de arquivos fechados do editor"
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Salvar projeto %s (*%s)"
#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr ""
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Salvar Configurações"
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Salvar "
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Fator de Escala:"
#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Localizar por"
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr ""
#: lazarusidestrconsts.lissearchprojectsfrom
msgid "Search projects from"
msgstr ""
#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr "Procurar unidade"
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "diretório de configuração secundário, onde Lazarus procura por arquivos de configuração de modelos. Padrão é"
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Caminho secundário configuração"
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Veja mensagens."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sVer Projeto -> Inspetor de Projetos"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Selecionar um item de ajuda:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Selecione um nó"
#: lazarusidestrconsts.lisselectanotherlclwidgetsetmacrolclwidgettype
msgid "Select another LCL widget set (macro LCLWidgetType)"
msgstr "Selecionar outro conjunto \"LCL widget\" (macro LCLWidgetType)"
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Selecionar arquivos de formulários Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Selecionado"
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(vizinho da base selecionado)"
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(vizinho da esquerda selecionado)"
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(vizinho da direita selecionado)"
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(vizinho do topo selecionado)"
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Selecionar o arquivo"
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Seleção excede a constante de sequência de caracteres"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Ferramenta de seleção"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr ""
#: lazarusidestrconsts.lisselectpathof
msgid "Select path of %s"
msgstr ""
#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr ""
#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr "Selecione o modo construção ativo"
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Definir padrão"
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr "(Configurar identação padrão)"
#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr "Definir valor"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Curto:"
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Exibir dicas declarações"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Exibir diferenças entre modos ..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Exibir unidades/pacotes vazios"
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr "Exibir Glifos para"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Exibir medianiz"
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr ""
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Exibir dicas no Inspetor de Objetos"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Exibir identificadores"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Exibir caixa de informação"
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview Gutter"
msgstr ""
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Exibir pacotes"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr ""
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr ""
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Exibir caracteres especiais"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr "Exibir barra de estado"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Exibir unidades"
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Exibir dicas de valores durante a depuração"
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "Exibir versão e sair"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Encolher ao menor"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Irmão"
#: lazarusidestrconsts.lissimplesyntax
#, fuzzy
#| msgid "Simple Syntax"
msgid "Simple syntax"
msgstr "Sintaxe Simples"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr ""
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Saltar arquivo"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Saltar arquivo e continuar carregando"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Ignorar carregamento do último projeto"
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr "Menor ao invés de mais rápido"
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Resultados"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Desculpe, este tipo ainda não foi implementado"
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Ascendente"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Sensível maiúsc./minúsc."
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Descendente"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domínio"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorar Espaço"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Linhas"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opções"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Parágrafos"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Visualizar"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Aceitar"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Ordenar Seleção"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Palavras"
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Fonte e Destino são os mesmos:%s%s"
#: lazarusidestrconsts.lissourcebreakpoint
#, fuzzy
#| msgid "&Source Breakpoint..."
msgid "&Source Breakpoint ..."
msgstr "&Ponto de parada Fonte"
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Diretório Fonte %s%s%s%s e diretório destino %s%s%s%ssão os mesmos.%s%sTalvez você não tenha entendido este recurso.%sEle irá limpar/recriar o diretório destino%se copiar o pacote/projeto para lá."
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Diretório fonte %s%s%s não existe."
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Fonte modificado"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Fonte da página %s%s%s foi alterado. Salvar?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr "Fontes de mais de uma página foram alterados. Salvar página %s%s%s? (mais %d)"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Caminhos dos fontes"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Justificar"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "SO Fonte"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Localizando"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Localizar texto"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Iniciar Conversão"
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Iniciar com um novo projeto"
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Parar"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Parar a depuração atual e reconstruir o projeto?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Parar Depuração?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Parar depuração?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Parar em exceções"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Parar a depuração?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr ""
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Arquivo lpi estranho"
#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr "Erro de Fluxo"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Erro de Fluxo"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Sequência de caracteres"
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Estilo"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Sub procedimento"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Sub procedimento no mesmo nível"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Sucesso"
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr ""
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Caminho inclusões suspeito"
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Caminho unidade suspeito"
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Revisão SVN: "
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nome de variável inválido"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s não é um identificador válido."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Sobrepor variável de sistema"
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Modo sintaxe"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tabulação"
#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr ""
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr ""
#: lazarusidestrconsts.listaborderof
#, fuzzy
#| msgid "Tab Order of"
msgid "Tab Order of %s"
msgstr "Ordem tabulação de"
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr ""
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr ""
#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr ""
#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr ""
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "CPU Alvo"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
#| msgid "Target file name: (empty = use unit output directory)"
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Nome arquivo alvo: (-o, vazio = usar diretório de saída de unidades)"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Nome arquivo alvo (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Nome de arquivo alvo do projeto"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Nome Arquivo Alvo + parâmetros"
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "SO Alvo"
#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Erro interno do compilador (%d)"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Célula Editável"
#: lazarusidestrconsts.listemplateeditparamcellhelp
#, fuzzy
msgid "Inserts an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgstr ""
"Insere uma Célula editável, com um valor padrão\n"
"\"\",Sync=n (,S=n), para Sincr. com uma célula anterior (n=1 maior célula anterior\n"
"\"padrão\",Sync, para Sincr. com uma célula anterior de igual padrão\n"
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Diretório de teste"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "A Aplicação Encartada foi criada para \"%s\""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "A classe %s%s%s é um TControl e não pode ser colada em um objeto que não é um controle.%sImpossível colar."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "As ferramentas de código encontraram um erro:%s%s%s"
#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "O comando posterior %s%s%s não é executável."
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "O comando após a publicação é inválido:%s%s%s%s"
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "O componente %s não pode ser excluído, porque é propriedade de %s."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "O editor de componente da classe %s%s%s criou o erro:%s%s%s%s"
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "O componente editor da classe %s%s%schamado com o verbob #%s %s%s%s%sfoi criado com o erro:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "O componente %s é herdado de %s.%sPara excluir o componente herdado, abra o ancestral e exclua de lá."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "O componente %s é herdado de %s.%sPara renomear um componente herdado abra seu ancestral e renomei-o lá."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr "O nome do componente deve ser único entre todos os componentes no formulário/\"datamodule\".O nome é comparado de forma insensível à caixa como um identificador pascal normal."
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr ""
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
msgid "The %s contains a not existing directory:%s%s"
msgstr "O %s contém um diretório inexistente:%s%s"
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "O %s contém um asterisco (*).%sLazarus usa este como um caractere normal e não o expande como uma máscara de arquivo."
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
#, fuzzy
#| msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "O nome de arquivo atual do compilador %s%s%s%s não é um executável válido.%sClique Ok para escolher o padrão %s%s%s.%sCaso contrário verifique Ambiente -> Opções de Ambiente -> Arquivos"
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
#, fuzzy
#| msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Tools -> Options -> Files"
msgstr "O nome de arquivo atual do compilador %s%s%s%snão é um executável válido.%sFavor verificar Ambiente -> Opções de Ambiente -> Arquivos"
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "O FPC atual não tem um arquivo de configuração. Ele irá provavelmente perder algumas unidades. Verificar sua inslatação do FPC."
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
#, fuzzy
#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "O diretório atual do fonte do Free Pascal %s%s%s%snão parece correto.%sClique Ok para escolher o padrão %s%s%s.%sCaso contrário verifique Ambiente -> Opções de Ambiente -> Arquivos"
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
#, fuzzy
#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Tools -> Options -> Files"
msgstr "O diretório atual do fonte do Free Pascal %s%s%s%snão parece correto.%sVerifique Ambiente -> Opções de Ambiente -> Arquivos"
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
#, fuzzy
#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "O diretório atual do Lazarus %s%s%s%snão parece correto.%sSem ele você não poderá criar aplicações LCL.%sClique Ok para escolher o padrão %s%s%s.%sCaso contrário verifique Ambiente -> Opções de Ambiente -> Arquivos"
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
#, fuzzy
#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Tools -> Options -> Files"
msgstr "O diretório atual do Lazarus %s%s%s%snão parece correto.%sSem ele você não poderá criar aplicações LCL.%sVerifique Ambiente -> Opções de Ambiente -> Arquivos"
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, fuzzy
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
msgstr "O depurador %s%s%s%snão existe ou não é executável.%s%sVeja Ambiente -> Opções do Depurador"
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "O diretório de destino%s%s%s%s não existe."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "O diretório destino %s%s%s não existe.%sFavor verificar o nome do arquivo alvo do projeto. Menu -> Projeto -> Opções Projeto."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "O diretório %s%s%s não é mais necessário no caminho das unidades.%sRemovê-lo?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr "O diretório %s%s%s não é gravável"
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "O diretório %s%s%s ainda não está no caminho de unidades.%sAdicioná-lo?"
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "O diretório %s não foi encontrado."
#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "O arquivo %s%s%s"
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "O arquivo %s não parece ser um arquivo lpi."
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "O índice de arquivo é necessário para funcções como a localização de declarações. Enquanto escaneando você pode editar e compilar os fontes, mas funções como a localização de declarações exibirão erros de unidade-não-encontrada. Isto pode levar alguns minutos."
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "O arquivo %s%s%s é um vínculo simbólico;%s%sAbrir %s%s% ao invés dele?"
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr "O arquivo %s%s%s não é um projeto lazarus.%sCriar um novo projeto para este %s?"
#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "O arquivo %s%s%s%sparece ser um programa. Feche o projeto atual e crie um novo projeto Lazarus para esse programa:%s\"Não\" carregará o arquivo como um fonte normal."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "O arquivo %s parece ser um arquivo de programa de um projeto Lazarus existente."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "O arquivo %s%s%s%s foi encontrado em um dos diretórios fontes do pacote %s e parece uma unidade compilada. Unidades compiladas devem estar no diretório de saída do pacote, caso contrário outros pacotes podem ter problemas ao usar este.%s%sExcluir arquivo ambíguo?"
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "O arquivo %s%s%s%s não foi encontrado.%sDeseja localizá-lo você mesmo?%s"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "O arquivo %s%s%s%s não foi encontrado.%sIgnorar continuará carregando o projeto,%sAbortar irá parar o carregamento."
#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "O primeiro modo de construção é o padrão e deve estar armazenado no projeto, não na sessão."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Os seguintes métodos usados por %s não estão no fonte%s%s%s%s%s%sRemover as referências pendentes?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "O compilador Free Pascal (nome do arquivo: %s) não foi encontrado.%sRecomenda-se que você instale o fpc."
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
#, fuzzy
#| msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sTools -> Options -> Files"
msgstr "O diretório do fonte Free Pascal não foi encontrado.%sAlgumas funções não funcionarão.%sRecomenda-se que você instale e configure o caminho%sAmbiente -> Opções de Ambiente -> Arquivos"
#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr "O depurador GNU através do \"ssh\" permite depuração remota via conexão \"ssh\". Veja docs/RemoteDebugging.txt para detalhes. O caminho deve conter o nome do arquivo cliente \"ssh\", o servidor com um nome de usuário opcional e o nome do arquivo do \"gdb\" no computador remoto. Por exemplo: %s/usr/bin/ssh nomeusuario@servidor gdb%s ou: %s/usr/bin/setsid /usr/bin/ssh nomeusuario@servidor gdb%s"
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "O identificador é uma unidade. Favor usar Salvar Arquivo como função para renomear a unidade."
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "A tecla %s%sjá está atribuída para %s;%s%sRemover a atribuição antiga e atribuir a tecla para a nova função%s%s?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "A Aplicação encartada %s%snecessária para execução não existe ou não é executável.%sDeseja criar uma?%s%sVeja Projeto -> Opções de Projeto -> Configuração da Aplicação."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "A aplicação iniciando %s%s%s%s não existe ou não é executável.%s%sVeja Executar -> Parâmetros de Execução -> Local"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
#, fuzzy
#| msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Tools -> Options -> Files"
msgstr "O diretório Lazarus não foi encontrado.%sVocê não poderá criar aplicações LCL.%sFavor verificar Ambiente -> Opções de Ambiente -> Arquivos"
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "O arquivo LFM (Formulário Lazarus) contém propriedades inválidas. Isto significa por ex., que ele contém algumas propriedades/classes, que não existem na LCL atual. A correção natural é remover essas propriedades do LFM e corrigir o código Pascal manualmente."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "O nome %s%s%s não é um identificador Pascal válido."
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "O novo arquivo de inclusão não está no caminho de busca.%sAdicionar diretório %s?"
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "A nova unidade ainda não está no caminho de unidades.%sAdicionar diretório %s?"
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr ""
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "Os \"Outros fontes\" contém um diretório já existente em \"Outros arquivos de unidades\".%s%s"
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "O diretório de saída %s%s%s está faltando."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "O diretório de saída de %s está listado no caminho de busca de inclusões de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "O diretório de saída de %s está listado no caminho de busca herdada de inclusões de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "O diretório de saída de %s está listado no caminho de busca herdada de unidade de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "O diretório de saída de %s está listado no caminho de busca de unidade de %s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "O diretório de saída deve ser separado e não deve conter quaisquer arquivos fonte."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "A classe proprietária tem este nome"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "O proprietário tem este nome"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "O pacote %s adiciona o caminho \"%s\" ao caminho de inclusões da IDE.%sProvavelmente trata-se de uma má configuração do pacote."
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "O pacote %s adiciona o caminho \"%s\" ao caminho de unidades da IDE.%sProvavelmente trata-se de uma má configuração do pacote."
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "O pacote já contém uma unidade com este nome."
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
msgid "The package %s can not be installed, because it requires the package \"%s\", which is a runtime only package."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "O pacote %s não pode ser desinstalado, porque é necessário pela própria IDE."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "O pacote %s não tem nenhum procedimento \"Register\", o que tipicamente significa que não é para a IDE. Instalá-lo provavelmente apenas aumentará o tamanho da IDE, tornando-a instável.%s%sDica: Se deseja usar um pacote em seu projeto, use o item de menu \"Adicionar ao projeto\""
#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr ""
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It can not be installed in the IDE"
msgstr ""
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "O programa %s\"make\"%s não foi encontrado.%s Esta ferramenta é necessária para construir o lazarus.%s"
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "As opções de compilação do projeto e as diretivas do fonte principal diferem. Para a nova unidade, o modo e o tipo \"string\" das opções do projeto são usados:"
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, fuzzy
#| msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "O projeto não usa a unidade interfaces LCL, mas parece que necessita dela.%sVocê obterá erros estranhos do vinculador se utilizar formulários LCL sem interfaces."
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "O projeto não possui um arquivo fonte principal."
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "O arquivo de informações de projeto %s%s%s%sé o mesmo que o fonte principal do projeto!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "O arquivo de informações do projeto %s%s%s%sfoi alterado no disco."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, fuzzy
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "O projeto deve ser salvo antes de construir%sSe você definir o diretório de Teste nas opções de ambiente,%svocê poderá criar novos projetos e contruí-los imediatamente.%sSalvar projeto?"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "O projeto usa SO alvo=%s e CPU=%s.%s O \"system.ppu\" para este alvo não foi encontrado no diretório binário do FPC. %sCertifique-se que o FPC está instalado corretamente para este alvo e que \"fpc.cfg\" contenha os diretórios certos."
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "O projeto usa os novos recursos FPC, que requer ao menos FPC 2.4"
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Há outros arquivos no diretório com o mesmo nome,%sque apenas diferem em:%s%s%sExcluí-los?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Há um arquivo com o mesmo nome e extensão similar no disco:%sArquivo: %s%sArquivo Ambíguo: %s%s%sExcluir arquivo ambí­guo?"
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Já existe um componente com este nome"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Já existe um formulário com o nome %s%s%s"
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Já existe uma macro IDE com o nome \"%s\"."
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Já existe uma unidade com o nome %s%s%s. Identificadores Pascal devem ser únicos."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Há uma unidade com o nome %s%s%s no projeto.%sFavor escolher um nome diferente"
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Deve haver ao menos um modo de contrução."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "A classe do recurso %s%s%s descende de %s%s%s. Provavelmente isto é um erro de digitação para \"TForm\";"
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Ocorreu um erro durante a escrita do componente selecionado %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Ocorreu um erro ao converter o fluxo binário do componente selecionado %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Ocorreu um erro ao copiar o fluxo do componente para Área de Transferência:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "O componente raiz não pode ser excluído."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr ""
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Estas configurações são armazenadas com o projeto."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Estas unidades não foram encontradas:"
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "A unidade %s%s%s já existe.%sIgnorar forçará a renomeação,%sCancelar cancelará o salvamento deste fonte e%sAbortar abortará todo o salvamento."
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "A unidade pertence ao pacote %s."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "A unidade %s existe duas vezes no caminho de unidades da %s:"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "A unidade tem este nome"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, fuzzy
#| msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "O nome de arquivo da unidade %s%s%s não está em minúsculas.%sO compilador Free Pascal não é indiferente a maiúsc./minúsc. É recomendado usar nomes de arquivos em minúsculas.%s%sRenomear arquivo para minúsculas?"
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr ""
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "A unidade %s é usada por outro arquivo.%sAtualizar referências automaticamente?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "A própria unidade já tem o nome %s%s%s. Identificadores Pascal devem ser únicos."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "O caminho de busca unidade de %s%s%s contém o diretório fonte %s%s%s do pacote %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "O diretório de trabalho %s%s%s não existe.%sFavor verificar no Menu -> Executar -> Parâmetros de Execução."
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Esta função requer um arquivo .lfm aberto no editor código."
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "esta mensagem de ajuda"
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Este parece um arquivo Pascal.%sÉ recomendado usar nomes de arquivo em minúsculas, para evitar vários problemas em alguns sistemas de arquivos e compiladores diferentes.%sRenomeá-lo usando minúsculas?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Este projeto não tem um arquivo fonte principal"
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr ""
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Este conjunto de opções para contrução do Lazarus não é suportado por esta instalação.%sO diretório %s%s%s não é gravável.%sConsulte a página internet do Lazarus para outras maneiras de instalação."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Esta declaração não pode ser extraída.%sFavor selecionar algum código para extrair um novo procedimento/método."
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr ""
#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Atual"
#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "Função"
#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr ""
#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Linha"
#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr ""
#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Fonte"
#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Estado"
#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr "&Auto fechar em caso de sucesso"
#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr "Compilando:"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Título"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Título na barra de tarefas mostra por exemplo: project1.lpi - Lazarus"
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Título (deixar vazio para padrão)"
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Função: adicionar o delimitador de caminho"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Função: retirar o delimitador de caminho"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Função: extrair extensão do arquivo"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Função: extrair nome+extensão do arquivo"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Função: extrair apenas nome do arquivo"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Função: extrair caminho do arquivo"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(macro desconhecida: %s)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Caminho:"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Alterar exibição nomes de arquivo com caminho completo ou relativo"
#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr "Para instalar você deve compilar e reiniciar a IDE"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Ancoragem superior"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Espaço da Borda Superior. Este valor será adicionado ao espaço da borda base e usado para o espaço superior do controle."
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Topos"
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Este é o controle irmão o qual o lado superior está ancorado. Deixar vazio para o controle-pai."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Justificar acima"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Árvore necessita atualização"
#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Tipos (não removidos se nenhuma substituição)"
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Não exibir esta mensagem novamente."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Error em expressão regular"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Fonte sem UTF-8"
#: lazarusidestrconsts.lisuegotoline
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Ir para Linha :"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Não encontrado"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Substituir esta ocorrência de %s%s%s%s com %s%s%s?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Localizando: %s"
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Sequência \"%s\" não encontrada!"
#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "A fonte atual do editor não suporta UTF-8, mas seu sistema parece utilizá-la.%sIsto significa que caracteres não ASCII provavelmente serão vistos incorretamente.%sVocê pode selecionar outra fonte nas opções do editor."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Limpar cache de inclusões"
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s bytes"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Incluído por:"
#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "no Projeto:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Linhas:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "não"
#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Caminhos (Somente Leitura)"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Tamanho:"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Tipo:"
#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Unidade"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "sim"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Exibir Valores de Ferramentas de Código"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Impossível converter fluxo binário em texto"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Impossível copiar componentes para Área de Transferência"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Impossível adicionar comentário de cabeçalho de recurso no arquivo de recurso %s%s%s%s.%sProvavelmente um erro de syntaxe."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Impossível adicionar recurso T%s:FORMDATA para arquivo de recurso %s%s%s%s.Provavelmente um erro de sintaxe."
#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr "Impossível adicionar configuração"
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread2
msgid "Unable to add the dependency %s, because the package %s has already a dependency to %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Impossível adicionar %s ao projeto, porque já existe uma unidade com o mesmo nome no Projeto."
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Impossível fazer cópia de segurança do arquivo %s%s%s para %s%s%s!"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sImpossível alterar classe de %s para %s"
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Impossível limpar o diretório de destino"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Impossível limpar %s%s%s.%sFavor verificar as permissões."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Impossível converter texto componente em formato binário:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Impossível converter arquivo %s%s%s%sErro: %s"
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Impossível converter LFM para LRS e escrever arquivo LRS"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Impossível converter os dados texto do arquivo %s%s%s%s em um fluxo binário (%s)"
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Impossível copiar arquivo"
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Impossível copiar o arquivo %s%s%spara %s%s%s"
#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Impossível copiar o arquivo %s%s%s%spara %s%s%s."
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Impossível criar diretório de cópia de segurança %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Impossível criar diretório %s%s%s"
#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Impossível criar diretório %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Impossível criar arquivo"
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Impossível criar arquivo %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Impossível criar arquivo%s%s%s%s"
#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Impossível criar arquivo %s%s%s."
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Impossível criar vínculo %s%s%s com alvo %s%s%s"
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file, because there is already a directory with this name."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Impossível criar \"buffer\" LFM temporário."
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Impossível excluir"
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Impossível excluir arquivo ambíguo %s%s%s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Impossível localizar uma seção de recurso de sequência de caracteres nesta ou em qualquer outra unidade usada."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Impossível localizar um nome de classe válido em %s%s%s"
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Impossível localizar o arquivo %s%s%s."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, fuzzy
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Impossível localizar arquivo %s%s%s.%sSe ele pertence ao seu projeto, verifique caminho de busca em%sProjeto->Opções Compilador...->Caminhos de Busca->Outros Arquivos Unidade. Se ele pertence a um pacote, verifique as opções de compilador do pacote apropriadas. Se ele pertence ao Lazarus, tenha certeza de uma compilação limpa. Se ele pertence ao FPC, verifique \"fpc.cfg\". Se não tiver certeza, verifique Projeto -> Opções Compilador... -> Teste"
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Impossível localizar %s no Fluxo LFM"
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr ""
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr "Impossível localizar unidade pascal (.pas,.pp) para arquivo .lfm %s%s%s%s"
#: lazarusidestrconsts.lisunabletofindthelfmfileofcomponentclassneededbyunit
msgid "Unable to find the lfm file of component class \"%s\".%sNeeded by unit:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Impossível coletar alterações do editor."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Impossível obter o fonte para o editor."
#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr "Incapaz de carregar arquivo:%s%s"
#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Impossível carregar o arquivo antigo de recurso.%sO arquivo de recurso é o primeiro arquivo de inclusãoo na%s seção de inicialização.%sPor exemplo {$I %s.lrs}.%sProvável erro de sintaxe."
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Impossível carregar pacote %s%s%s"
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Impossível carregar classe componente %s%s%s, porque ele depedente dele mesmo."
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Impossível abrir componente ancestral"
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Impossível abrir editor.%sA classe %s não descende de uma classe designável como \"TForm\" ou \"TDataModule\"."
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Impossível ler %s"
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Impossível ler arquivo"
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Impossível ler arquivo %s%s%s"
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Impossível ler arquivo %s%s%s%sErro: %s"
#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Impossível ler arquivo %s%s%s."
#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Impossível ler arquivo informações projeto%s%s%s%s."
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Impossível ler arquivo informações projeto%s%s%s%s."
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Impossível remover arquivo antigo da cópia de segurança %s%s%s!"
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Impossível renomear arquivo ambíguo %s%s%s%spara %s%s%s"
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Impossível renomear arquivo"
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Impossível renomear arquivo %s%s%s para %s%s%s!"
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Impossível renomear arquivo %s%s%s%spara %s%s%s."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Impossível renomear formulário no fonte."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Impossível renomear método. Favor corrigir o erro mostrado na janela de mensagens."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Impossível renomear variíavel no fonte."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Impossível executar"
#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Impossível salvar arquivo %s%s%s"
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Impossível definir lado ancoragem do controle."
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr ""
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Impossível obter fluxo dos componentes selecionados."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Impossível obter fluxo dos componentes selecionados."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Impossível obter fluxo %s:T%s"
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Impossível transformar fluxo binário do componente de %s:T%s em texto."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Impossível atualizar declaração \"CreateForm\" no fonte do projeto"
#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Impossível escrever %s%s%s%s%s."
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Impossível escrever %s%s%s"
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Impossível escrever arquivo"
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Impossível escrever arquivo %s%s%s%sErro: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr "Impossível gravar o arquivo info. projeto%s%s%s%s.%sErro: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Incapaz de gravar o arquivo de sessão do projeto%s\"%s\".%sErro: %s"
#: lazarusidestrconsts.lisunabletowritetofile
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Impossível gravar para arquivo %s%s%s!"
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "Incapaz de gravar o arquivo \"%s\"."
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Impossível escrever fluxo xml para %s%sErro: %s"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr ""
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Desfazer"
#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr "Resultado inesperado:%sO depurador irá encerrar"
#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Impossível desinstalar"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Desinstalar seleção"
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Unidade %s%s%s foi alterada. Salvar?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identificador de unidade existe"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s unidade %s no pacote %s%s"
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Nome de unidade já existe no projeto"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Nome unidade começa com ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Nome unidade contém ..."
#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Diretório de saída de unidade"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "caminho das unidades"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Caminho das unidades"
#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "Não assinado"
#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr "Unidades não usadas"
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Acima"
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Atualizar referências?"
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr ""
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "seq.caracteres maiúsculas"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "Seq.caracteres maiúsculas dada como parâmetro"
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Mensagem forma de uso (opção -h)"
#: lazarusidestrconsts.lisuse
#| msgid "Use>>"
msgid "Use >>"
msgstr "Usar >>"
#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr "Usar \"Ansistrings\""
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr ""
#: lazarusidestrconsts.lisuseexcludefilter
#, fuzzy
#| msgid "Use Exclude Filter"
msgid "Use exclude filter"
msgstr "Usar Filtro de Exclusão"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Usar identificador"
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Usar identificador %s em %s no %s"
#: lazarusidestrconsts.lisuseincludefilter
#, fuzzy
#| msgid "Use Include Filter"
msgid "Use include filter"
msgstr "Usar Filtro de Inclusão"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Inicializando aplicação"
#: lazarusidestrconsts.lisusemessagefile
msgid "Use message file:"
msgstr ""
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Usar pacote %s no pacote %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Usar pacote no pacote"
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Usar pacote %s no projeto"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Usar pacote no projeto"
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Diretório padrão do usuário"
#: lazarusidestrconsts.lisuseunit
#, fuzzy
#| msgid "Add unit to uses section"
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Adicionar unidade à seção \"uses\""
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Usar unidade %s na unidade %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 com Marca Ordem \"Byte\" (BOM)"
#: lazarusidestrconsts.lisvalue
#, fuzzy
#| msgid "Value:"
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Valor:"
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Valor%s"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Valor:"
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Valores"
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Variável"
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Verificar chamadas de método"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versão"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr ""
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Vertical"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Copiar informações de versão para Área de Transferência"
#: lazarusidestrconsts.lisviewbreakpointproperties
#, fuzzy
#| msgid "Breakpoint Properties..."
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Exibir Propriedades Pontos de Paradas"
#: lazarusidestrconsts.lisviewprojectunits
msgctxt "lazarusidestrconsts.lisviewprojectunits"
msgid "View Project Units"
msgstr "Exibir Unidades do Projeto"
#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr ""
#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "Alternar exibição Assembler"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Exibir Fonte (.lfm)"
#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr "Localizar adiante"
#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr "Redefinir Lista Resultados"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr ""
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Aviso: arquivo ambíguo encontrado: %s%s%s. Arquivo fonte é : %s%s%s"
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sAviso: Esta é a unidade principal. A nova unidade principal será %s.pas"
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Observar"
#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr ""
#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr ""
#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr ""
#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr ""
#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr ""
#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Propriedades Observador"
#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr ""
#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "Global"
#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr ""
#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr ""
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%s%sThere is already a configuration from version %s in%s%s%s"
msgstr ""
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
#, fuzzy
#| msgid "When a unit is renamed, update references ..."
msgid "When a unit is renamed, update references"
msgstr "Quando uma unidade for renomeada, atualizar referências ..."
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "Quando ativo, as opções atuais são salvas para um modelo, que é usado ao criar novos projetos"
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Ao mover o cursor do editor fonte, exibir o nó atual no explorador de código"
#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr "%s, que inclue %s"
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", que inclui"
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr ""
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Com pacotes requeridos"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "E&liminar tudo"
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "D&esabilitar Tudo"
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "H&abillitar tudo"
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Expressão"
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Propriedades"
#: lazarusidestrconsts.liswlwatchlist
#, fuzzy
#| msgid "Watch list"
msgid "Watch List"
msgstr "Lista observadores"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Palavra sob o cursor no editor atual"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Diretório de trabalho para construção"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Diretório de trabalho para execução"
#: lazarusidestrconsts.lisworkingdirectorynotfound
msgid "Working directory %s not found"
msgstr ""
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Erro de Escrita"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Erro escrita: %s%sArquivo: %s%s%s"
#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr ""
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Erro XML"
#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "Arquivos XML"
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Erro análise XML no arquivo %s%sErro: %s"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Você pode desativar isto para formulários individuais através do menu de contexto no inspetor de projeto"
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Você não pode reconstruir o Lazarus enquanto estiver depurando ou compilando."
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor de Código"
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Adicionar unidade pacote à cláusula \"uses\""
#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Binário"
#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Decimal"
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr ""
#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr ""
#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr ""
#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Adicionar Reverso"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Auto incrementar número construção"
#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "\"Scanners\" disponíveis"
#: lazarusidestrconsts.rsbuild
#| msgid "Build:"
msgid "&Build:"
msgstr "&Construção:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Conjunto caracteres:"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Fechar página atual"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Definições condicionais"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Criar nova definição"
#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr "Criação diretório \"%s\" falhou!"
#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr "Criação vínculo simbólico \"%s\" falhou!"
#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr "Criação de vínculos simbólicos não suportada por esta plataforma!"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Ativar \"i18n\""
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr ""
#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Arquivo dados de formulário (*.dfm)|*.dfm"
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "Encontrado, mas não listado aqui:"
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Opções \"i18n\""
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
#, fuzzy
#| msgid "Include Version Info in executable"
msgid "Include version info in executable"
msgstr "Incluir informações de versão no executável"
#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Posição personalizada"
#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "Padrão"
#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Aportado"
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Restaurar geometria da janela"
#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Restaurar tamanho da janela"
#: lazarusidestrconsts.rsiwpsplittercustomposition
msgid "Custom Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterdefault
msgid "Default Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
msgid "Restore with window"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
msgid "Restore Size"
msgstr ""
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Usar configuração do gerenciador de janelas"
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Africâner"
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Árabe"
#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automático (ou inglês)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalão"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Chinês"
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Tcheco"
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Holandês"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Inglês"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finlandês"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Francês"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Alemão"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebraíco"
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonésio"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italiano"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japonês"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Lituano"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Opções idioma"
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polonês"
#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr ""
#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "Português do Brasil"
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Russo"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Seleção idioma:"
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Eslovaco"
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Espanhol"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Turco"
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ucraniano"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "Versão &Maior:"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Versão Me&nor:"
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Outras informações"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Diretório de saída PO"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revisão:"
#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "\"Scanners\""
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Selecionar uma entrada herdada"
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Iniciar nova busca"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Numeração versão"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Comandos do menu Ajuda"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Comandos de Comando"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Comandos das Ferramentas de Código"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Comandos seleção coluna texto"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Comandos de movimentação do Cursor"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Comandos de Edição de Texto"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Comandos do menu Arquivo"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Comandos retração texto"
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Macros"
#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Comandos do Marcador Texto"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Comandos do menu Pacotes"
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Comandos do menu Projeto"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Comandos do menu Executar"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Comandos de busca e substituição de Texto"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Comandos de seleção de texto"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Comandos Fonte do \"Notebook\""
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Edição Síncrona"
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Edição Síncrona (fora Célula)"
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Edição Síncrona (enquanto selecionando)"
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Edição Modelo"
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Edição Modelo (fora Célula)"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Comandos do menu Ferramentas"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Comandos do menu Exibir"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Comando:"
#: lazarusidestrconsts.srkmcommand1
msgid " command1 \""
msgstr " comando 1 \""
#: lazarusidestrconsts.srkmcommand2
msgid " command2 \""
msgstr " comando2 \""
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Conflito "
#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr " conflitos com "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "abortar construção"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
#, fuzzy
#| msgid "Add jump point"
msgid "Add Jump Point"
msgstr "Adicionar ponto de salto"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "adicionar observador"
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Complemento modelo de código"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Copiar Bloco"
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Excluir Bloco"
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Ir para início Bloco"
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Ir para final Bloco"
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Ocultar Bloco"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Recuar bloco"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Mover Bloco"
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Definir início bloco"
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Definir final bloco"
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Exibir Bloco"
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Alternar bloco"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Retirar recuo bloco"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Construir programa/projeto"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Construir arquivo"
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Construir Lazarus"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Caractere"
#: lazarusidestrconsts.srkmeccleanupcompiled
msgid "clean up build files"
msgstr ""
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Excluir todo o texto"
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Editor Definições das Ferramentas de Código"
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Selecionar coluna abaixo"
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Selecionar final absoluto da coluna"
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Selecionar ínicio absoluto da coluna"
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Seleciona coluna esquerda"
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Selecionar fim linha coluna"
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Selecionar início linha coluna"
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Seleção Coluna para início do texto na linha"
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Selecionar base página coluna"
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Selecionar página abaixo coluna"
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Selecionar topo página coluna"
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Selecionar página acima coluna"
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Selecionar coluna direita"
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Selecionar coluna acima"
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Selecionar palavra esquerda coluna"
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Selecionar palavra direita coluna"
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Modo de seleção de coluna"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr ""
#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "opções do compilador"
#: lazarusidestrconsts.srkmeccompletecode
#, fuzzy
#| msgid "Complete code"
msgctxt "lazarusidestrconsts.srkmeccompletecode"
msgid "Complete Code"
msgstr "Completar código"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "configurar arquivo de construção"
#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Copiar seleção para Área de Transferência"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Copiar editor para nova janela"
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Copiar editor para nova janela livre"
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Copia editor para janela livre anterior"
#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Recortar seleção para Área de Transferência"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Excluir até o início da linha"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Excluir caractere sob o cursor"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Excluir até o final da linha"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Excluir último caractere"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Excluir até o início da palavra"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Excluir linha atual"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Excluir até o final da palavra"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diferenciar (Diff)"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr ""
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Mover o cursor para o final absoluto"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Mover o cursor para o início absoluto"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Opções IDE"
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "avaliar/modificar"
#: lazarusidestrconsts.srkmecextractproc
#, fuzzy
#| msgid "Extract procedure"
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Extrair procedimento"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Ferramenta externa %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Configuração de ferramentas externas"
#: lazarusidestrconsts.srkmecfind
#, fuzzy
#| msgid "Find text"
msgid "Find Text"
msgstr "Localizar texto"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Localizar final do bloco"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Localizar início do bloco"
#: lazarusidestrconsts.srkmecfinddeclaration
#, fuzzy
#| msgid "Find declaration"
msgid "Find Declaration"
msgstr "Localizar declaração"
#: lazarusidestrconsts.srkmecfindidentifierrefs
#, fuzzy
#| msgid "Find identifier references"
msgid "Find Identifier References"
msgstr "Localizar referências do identificador"
#: lazarusidestrconsts.srkmecfindinfiles
#, fuzzy
#| msgid "Find in files"
msgid "Find in Files"
msgstr "Localizar em arquivos"
#: lazarusidestrconsts.srkmecfindnext
#, fuzzy
#| msgid "Find next"
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Localizar próximo"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
#, fuzzy
#| msgid "Find next word occurrence"
msgid "Find Next Word Occurrence"
msgstr "Localizar próxima ocorrência da palavra"
#: lazarusidestrconsts.srkmecfindoverloads
#, fuzzy
#| msgid "Find overloads"
msgid "Find Overloads"
msgstr "Localizar sobreposições"
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
#, fuzzy
#| msgid "Find previous"
msgid "Find Previous"
msgstr "Localizar anterior"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
#, fuzzy
#| msgid "Find previous word occurrence"
msgid "Find Previous Word Occurrence"
msgstr "Localizar ocorrência anterior da palavra"
#: lazarusidestrconsts.srkmecfindproceduredefinition
#, fuzzy
#| msgid "Find procedure definiton"
msgid "Find Procedure Definiton"
msgstr "Localizar definição de procedimento"
#: lazarusidestrconsts.srkmecfindproceduremethod
#, fuzzy
#| msgid "Find procedure method"
msgid "Find Procedure Method"
msgstr "Procurar método de procedimento"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Retrair sob o cursor"
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Retrair ao nível %d"
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Ir para editor %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
#, fuzzy
#| msgid "Go to to include directive of current include file"
msgid "Go to include directive of current include file"
msgstr "Ir para diretiva de inclusão do arquivo de inclusão atual"
#: lazarusidestrconsts.srkmecgotolinenumber
#, fuzzy
#| msgid "Go to line number"
msgid "Go to Line Number"
msgstr "Ir para o número da linha"
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Ir para Marcador %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Ir para XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced $IFDEF"
msgid "Guess Misplaced $IFDEF"
msgstr "Adivinhar $IFDEF mal colocado"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor half-word left"
msgstr ""
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor half-word right"
msgstr ""
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Inserir entrada Registro de Alterações"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Inserir do Mapa de Caracteres"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Inserir palavra-chave CVS \"Author\""
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Inserir palavra-chave CVS \"Date\""
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Inserir palavra-chave CVS \"Header\""
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Inserir palavra-chave CVS \"ID\""
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Inserir palavra-chave CVS \"Log\""
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Inserir palavra-chave CVS \"Name\""
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Inserir palavra-chave CVS \"Revision\""
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Inserir palavra-chave CVS \"Source\""
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Inserir data e hora atual"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr ""
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Inserir nota GPL"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Inserir um \"GUID\""
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Inserir nota LGPL"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Interromper linha, manter o cursor"
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Modo de Inserção"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Inserir nota LGPL modificada"
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Inserir nome de usuário atual"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspecionar"
#: lazarusidestrconsts.srkmecinvertassignment
#, fuzzy
#| msgid "Invert assignment"
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Inverter atribuição"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr ""
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Interromper linha e mover o cursor"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Mover o cursor para o final da linha"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Modo de seleção de linha"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Mover cursor para o início da linha"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Mover cursor para início do texto na linha"
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Bloquear Editor"
#: lazarusidestrconsts.srkmecmakeresourcestring
#, fuzzy
#| msgid "Make resource string"
msgid "Make Resource String"
msgstr "Criar recurso de sequência de caracteres"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Ir para o parêntese correspondente"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Mover editor a esquerda"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Mover editor extremo esquerdo"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Mover editor para nova janela"
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Mover editor para próxima janela livre"
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Mover editor para janela anterior livre"
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Mover editor a direita"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Mover editor extremo direito"
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Próximo Marcador"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Ir para o próximo editor"
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Ir para o próximo editor com o mesmo Fonte"
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Ir para nova janela"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Modo de seleção normal"
#: lazarusidestrconsts.srkmecopenfileatcursor
#, fuzzy
#| msgid "Open file at cursor"
msgid "Open File at Cursor"
msgstr "Abrir arquivo sob o cursor"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Modo Sobrescrever"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Mover o cursor para base da página"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Mover o cursor uma página abaixo"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Mover cursor uma página a esquerda"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Mover cursor uma página a direita"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Mover cursor para cabeçalho da página"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Mover o cursor uma página acima"
#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Colar conteúdo Área de Transferência na posição atual"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pausar programa"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Marcador Anterior"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Ir para o editor anterior"
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Ir para editor anterior com o mesmo Fonte"
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Ir para janela anterior"
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "compilação rápida, sem vinculação"
#: lazarusidestrconsts.srkmecremovebreakpoint
#, fuzzy
#| msgid "remove break point"
msgid "remove breakpoint"
msgstr "remover ponto de parada"
#: lazarusidestrconsts.srkmecremoveemptymethods
#, fuzzy
#| msgid "Remove empty methods"
msgid "Remove Empty Methods"
msgstr "Remover métodos vazios"
#: lazarusidestrconsts.srkmecremoveunusedunits
#, fuzzy
#| msgid "Remove unused units"
msgid "Remove Unused Units"
msgstr "Remover unidades não usadas"
#: lazarusidestrconsts.srkmecrenameidentifier
#, fuzzy
#| msgid "Rename identifier"
msgid "Rename Identifier"
msgstr "Renomear identificador"
#: lazarusidestrconsts.srkmecreplace
#, fuzzy
#| msgid "Replace text"
msgid "Replace Text"
msgstr "Substituir texto"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Reportando um erro"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "parar depurador"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr ""
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "executar programa"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "executar arquivo"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "parâmetros de execução"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Rolar abaixo uma linha"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Rolar a esquerda um caractere"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Rolar a direita um caractere"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Rolar acima uma linha"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Selecinar abaixo"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Selecionar Tudo"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Converter tabulações em espaços na seleção"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Selecionar o final absoluto"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Selecionar o início absoluto"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Selecionar ir para XY"
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select half-word left"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select half-word right"
msgstr ""
#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "SelLeft"
#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Selecionar o final da linha"
#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Selecionar o início da Linha"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Selecionar para ínicio do texto na linha"
#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Selecionar base da página"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Selecionar página abaixo"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Selecionar página a esquerda"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Selecionar página a direita"
#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Selecionar cabeçalho da página"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Selecionar página acima"
#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "SelRight"
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Selecionar acima"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Selecionar palavra a esquerda"
#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Selecionar palavra a direita"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Definir um Marcador livre"
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Definir Marcador %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
#, fuzzy
#| msgid "Show abstract methods"
msgid "Show Abstract Methods"
msgstr "Exibir métodos abstratos"
#: lazarusidestrconsts.srkmecshowcodecontext
#, fuzzy
#| msgid "Show code context"
msgid "Show Code Context"
msgstr "Exibir contexto código"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "exibir ponto execução"
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "parar programa"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Ir para última posição na célula"
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Ir para primeira posição na célula"
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Selecionar Célula"
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Escape"
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Próxima Célula"
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Próxima Célula (tudo selecionado)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Célula Anterior"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Célula Anterior (tudo selecionado)"
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Iniciar edição Sincro"
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Ir para última posição na célula"
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Ir para primeira posição na célula"
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Selecionar célula"
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Escape"
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Encerrar"
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Próxima Célula"
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Próxima Célula (rotacionar)"
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Próxima Célula (tudo selecionado)"
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Próxima Célula (rotacionar / tudo selecionado)"
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Célula Anterior"
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Célula Anterior (tudo selecionado)"
#: lazarusidestrconsts.srkmecsyntaxcheck
#, fuzzy
#| msgid "Syntax check"
msgid "Syntax Check"
msgstr "Verificação de Sintaxe"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Exibir assembler"
#: lazarusidestrconsts.srkmectogglebreakpoint
#, fuzzy
#| msgid "toggle break point"
msgid "toggle breakpoint"
msgstr "alternar ponto de parada"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Exibir Pontos de parada"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Exibir chamada de pilha"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Exibir navegador de código"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Exibir Explorador de Código"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Exibir paleta de componentes"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Exibir saída do depurador"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Alternar entre formulários e unidades"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Exibir Editor de Documentação"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Exibir botões da IDE"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Exibir variáveis locais"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "Alternar Marcador %d"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Alternar realce Palavra Atual"
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Exibir mensagens"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Modo alternado"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Exibir Inspetor de Objetos"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Exibir registradores"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Exibir navegador de restrições"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Exibir Resultados da Pesquisa"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Exibir Editor de Código"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Exibir observadores"
#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr "Expandir tudo"
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Expandir sob o Cursor"
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "comando do editor desconhecido"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr ""
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr ""
#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "Usuário Primeiro"
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Exibir editor de âncoras"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Exibir componentes"
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Exibir formulários"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr ""
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Exibir dependências da unidade"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Exibir informações da unidade"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Exibir unidades"
#: lazarusidestrconsts.srkmecwordcompletion
#, fuzzy
#| msgid "Word completion"
msgid "Word Completion"
msgstr "Complemento palavras"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Mover cursor uma palavra a esquerda"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Mover cursor uma palavra a direita"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Editar teclas do comando"
#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Teclas de Edição"
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Retrair comentários na seleção"
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Ocultar comentários na seleção"
#: lazarusidestrconsts.synfunfoldallinselection
#, fuzzy
#| msgid "Unfold all in Selection"
msgid "Unfold all in selection"
msgstr "Expandir tudo na Seleção"
#: lazarusidestrconsts.synfunfoldcommentsinselection
#, fuzzy
#| msgid "Unfold comments in Selection"
msgid "Unfold comments in selection"
msgstr "Expandir comentários na Seleção"
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Arquivo é somente leitura"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "O arquivo \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" não pode ser escrito."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Bloqueado"
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr ""
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr ""
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Adicionar &Observador sob o Cursor"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr ""
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Marcador"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Fechar todas as &Outras Páginas"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Fechar Página"
#: lazarusidestrconsts.uemcopyfilename
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Copiar nome de arquivo"
#: lazarusidestrconsts.uemcopytonewwindow
#, fuzzy
#| msgid "Clone to new Window"
msgid "Clone to New Window"
msgstr "Clonar para nova Janela"
#: lazarusidestrconsts.uemcopytootherwindow
#, fuzzy
#| msgid "Clone to other Window"
msgid "Clone to Other Window"
msgstr "Clonar para outra Janela"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nova Janela"
#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Depurar"
#: lazarusidestrconsts.uemeditorproperties
#, fuzzy
#| msgid "Editor properties"
msgid "Editor Properties"
msgstr "Propriedades do Editor"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Codificação"
#: lazarusidestrconsts.uemevaluatemodify
#, fuzzy
#| msgid "&Evaluate/Modify..."
msgid "&Evaluate/Modify ..."
msgstr "&Avaliar/Modificar..."
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Localizar Declaração"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr ""
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Ir para Marcador"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Realçador"
#: lazarusidestrconsts.ueminspect
#, fuzzy
#| msgid "&Inspect..."
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "&Inspecionar..."
#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Inverter Atribuição"
#: lazarusidestrconsts.uemlineending
#, fuzzy
#| msgid "Line ending"
msgid "Line Ending"
msgstr "Finalização linha"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Bloquear Página"
#: lazarusidestrconsts.uemmovepageleft
#, fuzzy
#| msgid "Move page left"
msgid "Move Page Left"
msgstr "Mover página esquerda"
#: lazarusidestrconsts.uemmovepageleftmost
#, fuzzy
#| msgid "Move page leftmost"
msgid "Move Page Leftmost"
msgstr "Mover página extrema esquerda"
#: lazarusidestrconsts.uemmovepageright
#, fuzzy
#| msgid "Move page right"
msgid "Move Page Right"
msgstr "Mover página direita"
#: lazarusidestrconsts.uemmovepagerightmost
#, fuzzy
#| msgid "Move page rightmost"
msgid "Move Page Rightmost"
msgstr "Mover página extrema direita"
#: lazarusidestrconsts.uemmovetonewwindow
#, fuzzy
#| msgid "Move to new Window"
msgid "Move to New Window"
msgstr "Mover para nova Janela"
#: lazarusidestrconsts.uemmovetootherwindow
#, fuzzy
#| msgid "Move to other Window"
msgid "Move to Other Window"
msgstr "Mover para outra Janela"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nova Janela"
#: lazarusidestrconsts.uemnextbookmark
#, fuzzy
#| msgid "Goto next Bookmark"
msgid "Goto Next Bookmark"
msgstr "Ir para o próximo Marcador"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Modificado"
#: lazarusidestrconsts.uemopenfileatcursor
#, fuzzy
#| msgid "&Open file at cursor"
msgid "&Open File at Cursor"
msgstr "&Abrir Arquivo sob o Cursor"
#: lazarusidestrconsts.uemprevbookmark
#, fuzzy
#| msgid "Goto previous Bookmark"
msgid "Goto Previous Bookmark"
msgstr "Ir para o Marcador Anterior"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Saltar para Procedimento"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Somente Leitura"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refatorar"
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "Executa&r até o Cursor"
#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Definir Marcador"
#: lazarusidestrconsts.uemsetfreebookmark
#, fuzzy
#| msgid "Set a free Bookmark"
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Definir um Marcador livre"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Exibir Número de Linhas"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Fonte"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Alternar Marcador"
#: lazarusidestrconsts.uemtogglebreakpoint
#, fuzzy
#| msgid "&Toggle Breakpoint"
msgid "Toggle &Breakpoint"
msgstr "&Alternar Pontos de Parada"
#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Exibir Chamada de Pilha"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Não implementado ainda"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Somente Leitura"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informações versão"