lazarus/languages/lazaruside.sk.po

msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2007-12-26 15:21+0100\n"
"PO-Revision-Date: 2008-04-05 14:13+0200\n"
"Last-Translator: Slavko <slavino@slavino.sk>\n"
"Language-Team: Slovenský <sk@li.org>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Generator: KBabel 1.11.4\n"
"Plural-Forms:  nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"

#: lazarusidestrconsts:srkmcommand1
msgid "    command1 \""
msgstr "    príkaz1 \""

#: lazarusidestrconsts:srkmcommand2
msgid "    command2 \""
msgstr "    príkaz2 \""

#: lazarusidestrconsts:liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "Token %s%s%s už existuje!"

#: lazarusidestrconsts:srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr " Kláves \"%s\" už je pripojený k \"%s\"."

#: lazarusidestrconsts:srkmconflicw
msgid " conflicts with "
msgstr " v konflikte s"

#: lazarusidestrconsts:liscompiling
msgid "%s (compiling ...)"
msgstr "%s (prekladám ...)"

#: lazarusidestrconsts:lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (ladím ...)"

#: lazarusidestrconsts:liscovarious
msgid "%s (various)"
msgstr "%s (rôzne)"

#: lazarusidestrconsts:lisnewproject
msgid "%s - (new project)"
msgstr "%s - (nový projekt)"

#: lazarusidestrconsts:lislazarusversionstring
msgid "%s beta"
msgstr "%s beta"

#: lazarusidestrconsts:lisuidbytes
msgid "%s bytes"
msgstr "%s bajtov"

#: lazarusidestrconsts:liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s adresár"

#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s nemá žiadnu platnú cestu LazDoc.%sNemožno vytvoriť súbor fpdoc pre %s"

#: lazarusidestrconsts:lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s už je časťou projektu."

#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s je abstraktná trieda a má %s abstraktných metód."

#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s adresár projektu"

#: lazarusidestrconsts:lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s jednotka %s v balíčku %s%s"

#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s nie je platné meno projektu.%sProsím vyberte iné  (napr. project1.lpi)"

#: lazarusidestrconsts:lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s nie je platný identifikátor."

#: lazarusidestrconsts:lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s nie je platné meno jednotky."

#: lazarusidestrconsts:liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sKliknite na OK, ak ste si istí vykonaním."

#: lazarusidestrconsts:lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sMeno súboru: %s%s%s"

#: lazarusidestrconsts:lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sNemožno zmeniť triedu %s na %s"

#: lazarusidestrconsts:lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sMeno jednotky: %s%s%s"

#: lazarusidestrconsts:lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Stránka: %s"

#: lazarusidestrconsts:liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, auto generované"

#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, špecifické pre projekt"

#: lazarusidestrconsts:lisuereadonly
msgid "%s/ReadOnly"
msgstr "%s/Len na čítanie"

#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sPridanie novej závislosti balíčka %s: balíček %s%s"

#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sPridanie novej závislosti projektu %s: balíček %s%s"

#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sOba balíčky sú spojené. To znamená, že jeden balíček používa druhý alebo sú oba použité tretím balíčkom."

#: lazarusidestrconsts:lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sPopis:  %s"

#: lazarusidestrconsts:lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sExistujúci súbor: %s%s%s"

#: lazarusidestrconsts:lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sPozrite Projekt -> Inšpektor projektu"

#: lazarusidestrconsts:lispckexplstate
msgid "%sState: "
msgstr "%sStav: "

#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sNasledujúce jednotky budú pridané do sekcie uses %s%s:%s%s%s"

#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sTento balíček je nainštalovaný, ale nebol nájdený súbor lpk"

#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sTento balíček bol vytvorený automaticky"

#: lazarusidestrconsts:lisnone
msgid "%snone"
msgstr "%sžiadne"

#: lazarusidestrconsts:liswladd
msgid "&Add"
msgstr "&Pridať"

#: lazarusidestrconsts:uemaddbreakpoint
msgid "&Add Breakpoint"
msgstr "&Pridať bod prerušenia"

#: lazarusidestrconsts:lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Spätné hľadanie"

#: lazarusidestrconsts:dlgcasesensitive
msgid "&Case Sensitive"
msgstr "&Citlivé na veľkosť"

#: lazarusidestrconsts:lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "&Citlivé na veľkosť"

#: lazarusidestrconsts:lisclose
msgid "&Close"
msgstr "&Zatvoriť"

#: lazarusidestrconsts:uemclosepage
msgid "&Close Page"
msgstr "&Zatvoriť stránku"

#: lazarusidestrconsts:lismenuviewcomponents
msgid "&Components"
msgstr "&Komponenty"

#: lazarusidestrconsts:liswldelete
msgid "&Delete"
msgstr "&Zmazať"

#: lazarusidestrconsts:lisdeleteall
msgid "&Delete All"
msgstr ""

#: lazarusidestrconsts:lismenuedit
msgid "&Edit"
msgstr "&Upraviť"

#: lazarusidestrconsts:lisenableall
msgid "&Enable All"
msgstr ""

#: lazarusidestrconsts:liswlenabled
msgid "&Enabled"
msgstr "&Povolené"

#: lazarusidestrconsts:dlgentirescope
msgid "&Entire Scope"
msgstr "&Celý rozsah"

#: lazarusidestrconsts:lismenufile
msgid "&File"
msgstr "&Súbor"

#: lazarusidestrconsts:lismenufind2
msgid "&Find ..."
msgstr "&Nájsť ..."

#: lazarusidestrconsts:uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Nájsť deklaráciu"

#: lazarusidestrconsts:dlgfromcursor
msgid "&From Cursor"
msgstr "&Od kurzora"

#: lazarusidestrconsts:dlgglobal
msgid "&Global"
msgstr "&Globálne"

#: lazarusidestrconsts:uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Choď na záložku"

#: lazarusidestrconsts:lismenuhelp
msgid "&Help"
msgstr "&Pomoc"

#: lazarusidestrconsts:lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Viacriadkový vzor"

#: lazarusidestrconsts:lisplistobjects
msgid "&Objects"
msgstr "&Objekty"

#: lazarusidestrconsts:lisok
msgid "&Ok"
msgstr "&OK"

#: lazarusidestrconsts:uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Otvoriť súbor pod kurzorom"

#: lazarusidestrconsts:lismenupackage
msgid "&Package"
msgstr "&Balíček"

#: lazarusidestrconsts:lismenuproject
msgid "&Project"
msgstr "&Projekt"

#: lazarusidestrconsts:dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "&Spýtať sa pri nahradení"

#: lazarusidestrconsts:liswlproperties
msgid "&Properties"
msgstr "&Vlastnosti"

#: lazarusidestrconsts:dlgregularexpressions
msgid "&Regular Expressions"
msgstr "&Regulárne výrazy"

#: lazarusidestrconsts:lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "&Regulárne výrazy"

#: lazarusidestrconsts:rsremove
msgid "&Remove"
msgstr "&Odstrániť"

#: lazarusidestrconsts:lismenureplace2
msgid "&Replace ..."
msgstr "Na&hradiť ..."

#: lazarusidestrconsts:dlgreplacewith
msgid "&Replace With"
msgstr "Na&hradiť s"

#: lazarusidestrconsts:lismenurun
msgid "&Run"
msgstr "Sp&ustiť"

#: lazarusidestrconsts:uemruntocursor
msgid "&Run to Cursor"
msgstr "&Spustiť po kurzor"

#: lazarusidestrconsts:lismenusearch
msgid "&Search"
msgstr "&Hľadať"

#: lazarusidestrconsts:dlgselectedtext
msgid "&Selected Text"
msgstr "&Vybratý text"

#: lazarusidestrconsts:uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Nastaviť záložku"

#: lazarusidestrconsts:lissourcebreakpoint
msgid "&Source breakpoint"
msgstr ""

#: lazarusidestrconsts:dlgtexttofing
msgid "&Text to Find"
msgstr "&Hľadaný text"

#: lazarusidestrconsts:lismenutools
msgid "&Tools"
msgstr "&Nástroje"

#: lazarusidestrconsts:lismenuview
msgid "&View"
msgstr "&Zobraziť"

#: lazarusidestrconsts:lismenuviewsource
msgid "&View Source"
msgstr "&Zobraziť zdrojový kód"

#: lazarusidestrconsts:dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "Len &celé slová"

#: lazarusidestrconsts:lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "Len &celé slová"

#: lazarusidestrconsts:lismenuwindow
msgid "&Window"
msgstr "&Okno"

#: lazarusidestrconsts:liscefilter
msgid "(Filter)"
msgstr "(Filter)"

#: lazarusidestrconsts:dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(bez podadresárov)"

#: lazarusidestrconsts:listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(neznáme makro: %s)"

#: lazarusidestrconsts:lisplistall
msgid "<All>"
msgstr "<Všetko>"

#: lazarusidestrconsts:liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NIČ>"

#: lazarusidestrconsts:lisplistnone
msgid "<None>"
msgstr "<Nič>"

#: lazarusidestrconsts:lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<zvoľte existujúci súbor>"

#: lazarusidestrconsts:lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts:lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts:lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""

#: lazarusidestrconsts:lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<premenná nezvolená>"

#: lazarusidestrconsts:lisoff
msgid "? (Off)"
msgstr ""

#: lazarusidestrconsts:lison
msgid "? (On)"
msgstr ""

#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s nemôže uchovávať TControls.%sMôžete do nej vložiť len nevizuálne komponenty."

#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Súbor %s%s%s už existuje.%sNahradiť ho?"

#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Jednotka Pascalu musí mať príponu .pp alebo .pas"

#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Vyžadovaný balíček nebol nájdený. Pozrite Graf balíčkov."

#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Súbor s jednoduchým programom Pascalu.%sMôže byť použitý na rýchle a nečisté testovanie.%sLepšie je vytvoriť nový projekt."

#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Platný nástroj musí mať aspoň titulok a meno súboru"

#: lazarusidestrconsts:lispdabort
msgid "Abort"
msgstr "Zrušiť"

#: lazarusidestrconsts:lismenuabortbuild
msgid "Abort Build"
msgstr "Zrušiť budovanie"

#: lazarusidestrconsts:lisabortall
msgid "Abort all"
msgstr "Zrušiť všetko"

#: lazarusidestrconsts:lisabortallloading
msgid "Abort all loading"
msgstr "Zrušiť všetky načítania"

#: lazarusidestrconsts:liskmabortbuilding
msgid "Abort building"
msgstr "Zrušiť budovanie"

#: lazarusidestrconsts:lisabortloadingproject
msgid "Abort loading project"
msgstr "Zrušiť načítanie projektu"

#: lazarusidestrconsts:lisabortwholeloading
msgid "Abort whole loading"
msgstr "Zrušiť celé načítanie"

#: lazarusidestrconsts:lismenutemplateabout
msgid "About"
msgstr "O ..."

#: lazarusidestrconsts:lisaboutlazarus
msgid "About Lazarus"
msgstr "O Lazarus"

#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr "Abstraktné metódy - zatiaľ neprepísané"

#: lazarusidestrconsts:lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Abstraktné metódy %s"

#: lazarusidestrconsts:srvk_accept
msgid "Accept"
msgstr "Prijať"

#: lazarusidestrconsts:lisacknowledgements
msgid "Acknowledgements"
msgstr "Poďakovanie"

#: lazarusidestrconsts:lislazbuildaboaction
msgid "Action"
msgstr "Akcia"

#: lazarusidestrconsts:liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Akcia: %s"

#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Aktivuje syntax regulárnych výrazov pre text a nahradzovanie (presne ako perl)"

#: lazarusidestrconsts:liscodetempladd
msgid "Add"
msgstr "Pridať"

#: lazarusidestrconsts:lisaddtoproject
msgid "Add %s to project?"
msgstr "Pridať %s do projektu?"

#: lazarusidestrconsts:uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "&Pridať pozorovanie v mieste kurzora"

#: lazarusidestrconsts:lisa2paddfile
msgid "Add File"
msgstr "Pridať súbor"

#: lazarusidestrconsts:lisa2paddfiles
msgid "Add Files"
msgstr "Pridať súbory"

#: lazarusidestrconsts:rsaddinverse
msgid "Add Inverse"
msgstr "Pridať obrátene"

#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Pridať súbory LFM a LRS, ak existujú"

#: lazarusidestrconsts:lisa2paddunit
msgid "Add Unit"
msgstr "Pridať jednotku"

#: lazarusidestrconsts:lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Pridať aktívnu jednotku do balíčka"

#: lazarusidestrconsts:liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "Pridať aktívnu jednotku do projektu"

#: lazarusidestrconsts:lispckeditaddanitem
msgid "Add an item"
msgstr "Pridať položku"

#: lazarusidestrconsts:dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Pridať operátor priradenia :="

#: lazarusidestrconsts:liskmaddbreakpoint
msgid "Add break point"
msgstr "Pridať bod prerušenia"

#: lazarusidestrconsts:lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Pridať bod prerušenia"

#: lazarusidestrconsts:liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Pridať šablónu kódu"

#: lazarusidestrconsts:lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Pridať z editora do projektu"

#: lazarusidestrconsts:lisprojaddeditorfile
msgid "Add editor files"
msgstr "Pridať súbory editora"

#: lazarusidestrconsts:lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Pridať súbor do balíčka"

#: lazarusidestrconsts:lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Pridať súbor do projektu:"

#: lazarusidestrconsts:lisprojaddfiles
msgid "Add files"
msgstr "Pridať súbory"

#: lazarusidestrconsts:lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Pridať súbory do balíčka"

#: lazarusidestrconsts:srkmecaddjumppoint
msgid "Add jump point"
msgstr "Pridať bod skoku"

#: lazarusidestrconsts:lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Pridať bod skoku do histórie"

#: lazarusidestrconsts:liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Pridať odkaz"

#: lazarusidestrconsts:lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Pridať odkaz k zdedeným"

#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Pridať voľby k závislostiam balíčkov a projektov"

#: lazarusidestrconsts:liscodehelpaddpathbutton
msgid "Add path"
msgstr "Pridať cestu"

#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Pridať cesty k závislým balíčkom/projektom"

#: lazarusidestrconsts:dlgaddsemicolon
msgid "Add semicolon"
msgstr "Pridať bodkočiarku"

#: lazarusidestrconsts:lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Pridať do obľúbených vlastností"

#: lazarusidestrconsts:lisa2paddtopackage
msgid "Add to package"
msgstr "Pridať do balíčka"

#: lazarusidestrconsts:lisprojaddtoproject
msgid "Add to project"
msgstr "Pridať do projektu"

#: lazarusidestrconsts:lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Pridať do cesty hľadania jednotiek?"

#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Pridať jednotku do klauzuly uses balíčka. Toto vypnúť len pre jednotky, ktoré nemusia byť prekladané vo všetkých triedach."

#: lazarusidestrconsts:liskmaddwatch
msgid "Add watch"
msgstr "Pridať pozorovanie"

#: lazarusidestrconsts:lismenuaddwatch
msgid "Add watch ..."
msgstr "Pridať pozorovanie ..."

#: lazarusidestrconsts:dlgedadd
msgid "Add..."
msgstr "Pridať..."

#: lazarusidestrconsts:dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Ďalšia cesta zdrojových kódov pre všetky projekty (.pp;.pas)"

#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Ďalšie voľby prekladača, zdedené z balíčkov"

#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Ďalšie súbory pre hľadanie (napr. /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts:rsadditionalinfo
msgid "Additional info"
msgstr "Ďalšie informácie"

#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Ďalšia prehľadávaná cesta"

#: lazarusidestrconsts:dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr ""

#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "Pokročilé voľby budovania"

#: lazarusidestrconsts:rslanguageafrikaans
msgid "Afrikaans"
msgstr "Africky"

#: lazarusidestrconsts:fdmalignword
msgid "Align"
msgstr "Zarovnať"

#: lazarusidestrconsts:lisalignment
msgid "Alignment"
msgstr "Zarovnanie"

#: lazarusidestrconsts:lisemdall
msgid "All"
msgstr ""

#: lazarusidestrconsts:lisallfiles
msgid "All Files"
msgstr "Všetky súbory"

#: lazarusidestrconsts:lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Všetky bloky vyzerajú OK."

#: lazarusidestrconsts:dlgallfiles
msgid "All files"
msgstr "Všetky súbory"

#: lazarusidestrconsts:lisedtdefallpackages
msgid "All packages"
msgstr "Všetky balíčky"

#: lazarusidestrconsts:lisedtdefsallprojects
msgid "All projects"
msgstr "Všetky projekty"

#: lazarusidestrconsts:lisccotestssuccess
msgid "All tests succeeded."
msgstr "Všetky testy úspešné."

#: lazarusidestrconsts:lisallowfunctio
msgid "Allow Function Calls"
msgstr ""

#: lazarusidestrconsts:dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Povoliť LABEL a GOTO"

#: lazarusidestrconsts:lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Dovoliť hľadanie na viacerých riadkoch"

#: lazarusidestrconsts:dlgalphabetically
msgid "Alphabetically"
msgstr "Podľa abecedy"

#: lazarusidestrconsts:srkm_alt
msgid "Alt"
msgstr ""

#: lazarusidestrconsts:dlgaltsetclmode
msgid "Alt-Key sets column mode"
msgstr "Alt nastavuje stĺpcový režim"

#: lazarusidestrconsts:srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Alternatívny kláves (alebo kombinácia dvoch)"

#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Pred spustením vždy vybudovať"

#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Vždy vybudovať (aj keď nezmenené)"

#: lazarusidestrconsts:dlgalwaysvisiblecaret
msgid "Always visible caret"
msgstr "Vždy zobrazovať striešku"

#: lazarusidestrconsts:lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Nejednoznačný typ predka"

#: lazarusidestrconsts:lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nejednoznačné meno triedy"

#: lazarusidestrconsts:lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nejednoznačné meno jednotky"

#: lazarusidestrconsts:lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Nájdená nejednoznačná jednotka"

#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Nejednoznačný dodatočný konfiguračný súbor prekladača"

#: lazarusidestrconsts:lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Nejednoznačný prekladač"

#: lazarusidestrconsts:dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Nejednoznačná akcia súboru:"

#: lazarusidestrconsts:lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Nájdený nejednoznačný súbor"

#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Nájdený nejednoznačný súbor: %s%s%s%sTento súbor môže byť poškodený %s%s%s%s%sZmazať nejednoznačný súbor?"

#: lazarusidestrconsts:lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Nájdený nejednoznačný súbor"

#: lazarusidestrconsts:lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Nájdená nejednoznačná jednotka"

#: lazarusidestrconsts:lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Nájdená nejednoznačné jednotky"

#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Pri poslednom štarte nastala chyba pri otváraní %s!%s%sOtvoriť projekt znova?"

#: lazarusidestrconsts:lisa2pancestortype
msgid "Ancestor Type"
msgstr "Typ predka"

#: lazarusidestrconsts:lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor ukotvenia - nevybratý prvok"

#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Ukotviť k spodne strane súrodenca, zachovať medzeru okraja"

#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Ukotviť·k·ľavej·strane·súrodenca,·zachovať·medzeru·okraja"

#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Ukotviť·k·pravej·strane·súrodenca,·zachovať·medzeru·okraja"

#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Ukotviť·k·hornej·strane·súrodenca,·zachovať·medzeru·okraja"

#: lazarusidestrconsts:lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ukotvenia vybratých prvkov"

#: lazarusidestrconsts:lismakeresstrappendtosection
msgid "Append to section"
msgstr "Pripojiť k výberu"

#: lazarusidestrconsts:dlgpoapplication
msgid "Application"
msgstr "Aplikácia"

#: lazarusidestrconsts:dlgapplicationsettings
msgid "Application Settings"
msgstr "Nastavenia aplikácie"

#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr "Aplkácia%sGrafický lcl/freepascal program. Súbor programu je automaticky spravovaný Lazarom."

#: lazarusidestrconsts:dlgbutapply
msgid "Apply"
msgstr "Použiť"

#: lazarusidestrconsts:lispckeditapplychanges
msgid "Apply changes"
msgstr "Použiť zmeny"

#: lazarusidestrconsts:rslanguagearabic
msgid "Arabic"
msgstr "Arabsky"

#: lazarusidestrconsts:dlgcoasis
msgid "As-Is"
msgstr "Ako je"

#: lazarusidestrconsts:lissortselascending
msgid "Ascending"
msgstr "Vzostupne"

#: lazarusidestrconsts:dlgenvask
msgid "Ask"
msgstr "Spýtať sa"

#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Spýtať sa pred nahradením nájdeného textu"

#: lazarusidestrconsts:dlgcoasmstyle
msgid "Assembler style:"
msgstr "Štýl Assembleru:"

#: lazarusidestrconsts:liscodetoolsoptsat
msgid "At"
msgstr ""

#: lazarusidestrconsts:lispckoptsauthor
msgid "Author:"
msgstr "Autor:"

#: lazarusidestrconsts:liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr "Automatické dokončovanie na ..."

#: lazarusidestrconsts:dlgautoform
msgid "Auto create form when opening unit"
msgstr "Auto vytvorenie formulára pri otvorení jednotky"

#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Automaticky vytvorené uzly nemôžu byť upravované,%sani nemôžu mať neautomaticky vytvorené podriadené uzly"

#: lazarusidestrconsts:dlgautodel
msgid "Auto delete file"
msgstr "Auto zmazanie súboru"

#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Automaticky generované uzly nemôžu byť upravované."

#: lazarusidestrconsts:dlgautoident
msgid "Auto indent"
msgstr "Automatické odsadenie"

#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automaticky prebudovať, pri prebudovaní všetkého"

#: lazarusidestrconsts:dlgautoren
msgid "Auto rename file lowercase"
msgstr "Automaticky na malé písmená"

#: lazarusidestrconsts:dlgautosave
msgid "Auto save"
msgstr "Auto ukladať"

#: lazarusidestrconsts:dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automaticky vytvárané formuláre:"

#: lazarusidestrconsts:lispckexplautocreated
msgid "AutoCreated"
msgstr "Automaticky vytvorené"

#: lazarusidestrconsts:rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automaticky (alebo anglický)"

#: lazarusidestrconsts:lisautomaticfeatures
msgid "Automatic features"
msgstr "Automatické vlastnosti"

#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Automaticky zvyšovať číslo vybudovania"

#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Pri budovaní automaticky zvyšovať verziu"

#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automaticky inštalované balíčky"

#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automaticky prebudovať, keď je to potrebné"

#: lazarusidestrconsts:dlgavailableforms
msgid "Available forms:"
msgstr "Dostupné formuláre:"

#: lazarusidestrconsts:lisavailablepackages
msgid "Available packages"
msgstr "Dostupné balíčky"

#: lazarusidestrconsts:dlgedback
msgid "Back"
msgstr "Späť"

#: lazarusidestrconsts:fdmorderbackone
msgid "Back one"
msgstr "Späť o jedna"

#: lazarusidestrconsts:dlgbackcolor
msgid "Background"
msgstr "Pozadie"

#: lazarusidestrconsts:srvk_back
msgid "Backspace"
msgstr ""

#: lazarusidestrconsts:dlgenvbckup
msgid "Backup"
msgstr "Záloha"

#: lazarusidestrconsts:lisbackupfilefailed
msgid "Backup file failed"
msgstr "Záložný súbor zlyhal"

#: lazarusidestrconsts:dlgbehindmethods
msgid "Behind methods"
msgstr "Za metódy"

#: lazarusidestrconsts:lispkgfiletypebinary
msgid "Binary"
msgstr "Binárny"

#: lazarusidestrconsts:liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"

#: lazarusidestrconsts:dlgblockindent
msgid "Block indent"
msgstr "Odsadenie bloku"

#: lazarusidestrconsts:dlgedbold
msgid "Bold"
msgstr "Tučné"

#: lazarusidestrconsts:uembookmarkn
msgid "Bookmark"
msgstr "Záložka"

#: lazarusidestrconsts:lisborderspace
msgid "BorderSpace"
msgstr "Medzera okraja"

#: lazarusidestrconsts:lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Okraj okolo prvku. Ostatné štyri okraje sú pridané k tejto hodnote."

#: lazarusidestrconsts:lisbottom
msgid "Bottom"
msgstr ""

#: lazarusidestrconsts:lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Spodné ukotvenie"

#: lazarusidestrconsts:lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Spodný okraj. Táto hodnota je pridaná k základnému okraju a použitá pre medzeru pod prvkom."

#: lazarusidestrconsts:lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Rovnaká spodná medzera"

#: lazarusidestrconsts:lisbottoms
msgid "Bottoms"
msgstr "Spodné okraje"

#: lazarusidestrconsts:dlgbrachighlight
msgid "Bracket highlighting"
msgstr "Zvýraznenie zátvoriek"

#: lazarusidestrconsts:lisbreak
msgid "Break"
msgstr ""

#: lazarusidestrconsts:lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Zalomiť riadky vo výbere"

#: lazarusidestrconsts:srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Zalomiť riadok a presunúť kurzor"

#: lazarusidestrconsts:srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Zalomiť·riadok·a·ponechať kurzor"

#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
msgid "Break on Lazarus Exceptions"
msgstr "Prerušiť pri výnimkách Lazarus"

#: lazarusidestrconsts:lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Body prerušenia"

#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Bod prerušenia"

#: lazarusidestrconsts:lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Porušené závislosti"

#: lazarusidestrconsts:lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Porušená závislosť"

#: lazarusidestrconsts:lispatheditbrowse
msgid "Browse"
msgstr "Prezerať"

#: lazarusidestrconsts:lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Nájsť prekladač (%s)"

#: lazarusidestrconsts:lismenubuild
msgid "Build"
msgstr "Vybudovať"

#: lazarusidestrconsts:lislazbuildqbobuildall
msgid "Build All"
msgstr "Vybudovať všetko"

#: lazarusidestrconsts:lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Vybudovať CodeTools"

#: lazarusidestrconsts:lisbfbuildcommand
msgid "Build Command"
msgstr "Príkaz Vybudovať"

#: lazarusidestrconsts:lismenubuildfile
msgid "Build File"
msgstr "Vybudovať súbor"

#: lazarusidestrconsts:lislazbuildbuildide
msgid "Build IDE"
msgstr "Vybudovať IDE"

#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr "Vybudovať IDE a balíčky"

#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr "Vybudovať IDE bez balíčkov"

#: lazarusidestrconsts:lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Vybudovať formulár JIT"

#: lazarusidestrconsts:lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr "Vybudovať LCL"

#: lazarusidestrconsts:lismenubuildlazarus
msgid "Build Lazarus"
msgstr "Vybudovať Lazarus"

#: lazarusidestrconsts:lisbuildnumber
msgid "Build Number"
msgstr "Číslo vybudovania"

#: lazarusidestrconsts:lislazbuildbuildoptions
msgid "Build Options"
msgstr "Voľby budovania"

#: lazarusidestrconsts:lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Vybudovať SynEdit"

#: lazarusidestrconsts:lismenubuildall
msgid "Build all"
msgstr "Vybudovať všetko"

#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "Vybudovať všetky súbory projektu/programu"

#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "Vybudovať komponenty (SynEdit, CodeTools)"

#: lazarusidestrconsts:lislazbuildbuildexamples
msgid "Build examples"
msgstr "Vybudovať príklady"

#: lazarusidestrconsts:srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Vybudovať Lazarus"

#: lazarusidestrconsts:lisbuildnewproject
msgid "Build new project"
msgstr "Vybudovať nový projekt"

#: lazarusidestrconsts:liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Vybudovať projekt/program"

#: lazarusidestrconsts:rsbuild
msgid "Build:"
msgstr "Vybudovať:"

#: lazarusidestrconsts:dlgcmacro
msgid "C Style Macros (global)"
msgstr "Makrá v štýle C (všeobevné)"

#: lazarusidestrconsts:dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Operátory v štýle C (*=, +=, /= and -=)"

#: lazarusidestrconsts:dlgcppinline
msgid "C++ Styled INLINE"
msgstr ""

#: lazarusidestrconsts:lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "Kľúčové slovo CVS"

#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Volá procedúru %sRegister%s zvolenej jednotky"

#: lazarusidestrconsts:lismenuviewcallstack
msgid "Call Stack"
msgstr "Zásobník volaní"

#: lazarusidestrconsts:liscocallon
msgid "Call on:"
msgstr "Volať na:"

#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Volanie %s na vytvorenie Makefile z %s zlyhalo."

#: lazarusidestrconsts:liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Namôžete kopírovať najvyšší komponent"

#: lazarusidestrconsts:liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Nemožno vytvoriť súbor %s%s%s"

#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Nemožno registrovať komponent bez jednotky"

#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Zmeniť možno len triedu TComponents"

#: lazarusidestrconsts:dlgcancel
msgid "Cancel"
msgstr "Zrušiť"

#: lazarusidestrconsts:liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Zrušiť načítanie tohoto komponentu"

#: lazarusidestrconsts:liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Zrušiť načítanie jednotky"

#: lazarusidestrconsts:liscancelrenaming
msgid "Cancel renaming"
msgstr "Zrušiť premenovanie"

#: lazarusidestrconsts:lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Nemôžem nájsť zoznam spolupracovníkov."

#: lazarusidestrconsts:liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Nemožno nájsť spúšťač Lazarus: %s%s"

#: lazarusidestrconsts:srvk_capital
msgid "Capital"
msgstr "Veľké písmená"

#: lazarusidestrconsts:dlgcaretskipsselection
msgid "Caret skips selection"
msgstr "Strieška preskakuje výber"

#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Necitlivé na veľkosť"

#: lazarusidestrconsts:rslanguagecatalan
msgid "Catalan"
msgstr "Katalánsky"

#: lazarusidestrconsts:liscecategories
msgid "Categories"
msgstr "Kategórie"

#: lazarusidestrconsts:listtodolcategory
msgid "Category"
msgstr "Kategória"

#: lazarusidestrconsts:dlgcentercursorline
msgid "Center Cursor Line"
msgstr ""

#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Centrovať prvky vodorovne, relatívne k daným súrodencom"

#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Centrovať·prvky·zvislo,·relatívne·k·daným·súrodencom"

#: lazarusidestrconsts:liscenterinwindow
msgid "Center in window"
msgstr "Centrovať v okne"

#: lazarusidestrconsts:liscenters
msgid "Centers"
msgstr "Stredy"

#: lazarusidestrconsts:liscodetemplchange
msgid "Change"
msgstr "Zmeniť"

#: lazarusidestrconsts:lischangeclass
msgid "Change Class"
msgstr "Zmeniť triedu"

#: lazarusidestrconsts:lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Zmeniť triedu %s"

#: lazarusidestrconsts:lisplistchangefont
msgid "Change Font"
msgstr "Zmeniť font"

#: lazarusidestrconsts:lischangeparent
msgid "Change parent ..."
msgstr "Zmeniť rodiča ..."

#: lazarusidestrconsts:lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Položka ChangeLog"

#: lazarusidestrconsts:lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Zmenené súbory:"

#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Zmena mena alebo verzie balíčka poruší závislosti. Majú byť zmenené aj tieto závislosti?%sZvoľte Áno pre zmenu všetkých zobrazených závislostí.%sZvoľte Ignorovať pre zrušenie závislostí a pokračovanie."

#: lazarusidestrconsts:srkmecchar
msgid "Char"
msgstr "Znak"

#: lazarusidestrconsts:lischaracter
msgid "Character"
msgstr ""

#: lazarusidestrconsts:lischaractermap
msgid "Character Map"
msgstr "Mapa znakov"

#: lazarusidestrconsts:rscharacterset
msgid "Character set:"
msgstr "Množina znakov:"

#: lazarusidestrconsts:lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Skontrolovať súbor LFM v editore"

#: lazarusidestrconsts:lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Skontrolovať zmeny pri načítaní"

#: lazarusidestrconsts:dlgcheckconsistency
msgid "Check consistency"
msgstr "Skontrolovať správnosť"

#: lazarusidestrconsts:dlgccocaption
msgid "Checking compiler options"
msgstr "Skontrolovať voľby prekladača"

#: lazarusidestrconsts:dlgcochecks
msgid "Checks:"
msgstr "Kontroly:"

#: lazarusidestrconsts:rslanguagechinese
msgid "Chinese"
msgstr "Čínsky"

#: lazarusidestrconsts:lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Zvoľte adresár súboru .po"

#: lazarusidestrconsts:lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Zvoliť balíček Delphi (*.dpk)"

#: lazarusidestrconsts:lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Zvoliť projekt Delphi (*.dpr)"

#: lazarusidestrconsts:lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Zvoliť jednotku Delphi (*.pas)"

#: lazarusidestrconsts:lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Zvoliť adresár"

#: lazarusidestrconsts:lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Vyberte adresár zdrojových kódov FPC"

#: lazarusidestrconsts:liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Zvoľte schému rozloženia klávesnica"

#: lazarusidestrconsts:lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Vyberte adresár Lazarus"

#: lazarusidestrconsts:lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Zvoľte schému"

#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Zvoľte základnú triedu pre obľúbenú vlastnosť %s%s%s."

#: lazarusidestrconsts:lischooseadifferentname
msgid "Choose a different name"
msgstr "Zvoľte iné meno"

#: lazarusidestrconsts:dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Zvoľte súbor šablón kódu (*.dci)"

#: lazarusidestrconsts:lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Vyberte meno súboru prekladača (%s)"

#: lazarusidestrconsts:lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Zvoľte meno súboru debugera"

#: lazarusidestrconsts:lischoosedirectory
msgid "Choose directory"
msgstr "Zvoľte adresár"

#: lazarusidestrconsts:lischoosemakepath
msgid "Choose make path"
msgstr "Vyberte cestu k make"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Zvoľte položku pre vytvorenie nového súboru"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Zvoľte položku pre vytvorenie nového balíčka"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Zvoľte položku pre vytvorenie nového projektu"

#: lazarusidestrconsts:lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Zvoľte výstupný adresár pre spustiteľné súbory IDE"

#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Zvoľte zdrojový kód programu (*.pp, *.pas, *.lpr)"

#: lazarusidestrconsts:lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Zvoľte štruktúru pre uzavretie výberu"

#: lazarusidestrconsts:lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Zvoľte adresár pre testy"

#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Zacyklené závislosti balíčka"

#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Trieda %s%s%s nie je triedou registrovaného komponenta.%sNemožno vložiť."

#: lazarusidestrconsts:lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Trieda %s%s%s nenájdená."

#: lazarusidestrconsts:lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Meno triedy už existuje"

#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Konflikty triedy so súborom .lfm:%sJednotka %s%spoužíva jednotku %s%s, ktorá obsahuje triedu %s,%s, ale súbor .lfm už obsahuje inú triedu .%sMôže existovať len jedna design trieda na jendotku.%sProsím presuňte %s do inej jednotky."

#: lazarusidestrconsts:lisclassnotfound
msgid "Class not found"
msgstr "Trieda nenájdená"

#: lazarusidestrconsts:dlgcdtclassorder
msgid "Class order"
msgstr "Poradie tried"

#: lazarusidestrconsts:dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Pravidlá vkaldania časti Class"

#: lazarusidestrconsts:liskmclassic
msgid "Classic"
msgstr ""

#: lazarusidestrconsts:liscldircleandirectory
msgid "Clean Directory"
msgstr "Vyčistiť adresár"

#: lazarusidestrconsts:liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Vyčistiť zdrojové kódy Lazarus"

#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr "Vyčistiť + Vybudovať všetko"

#: lazarusidestrconsts:lislazbuildcleanall
msgid "Clean all"
msgstr "Vyčistiť všetko"

#: lazarusidestrconsts:lismenucleandirectory
msgid "Clean directory ..."
msgstr "Vyčistiť adresár ..."

#: lazarusidestrconsts:liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Vyčistiť podadresáre"

#: lazarusidestrconsts:liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Vyčistiť cestu jednotky?"

#: lazarusidestrconsts:lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Vyčistiť + vybudovať"

#: lazarusidestrconsts:srvk_clear
msgid "Clear"
msgstr "Vymazať"

#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
msgid "Clear dependency filename"
msgstr "Zmazať meno súboru závislosti"

#: lazarusidestrconsts:lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Vymazať vyrovnávaciu pamäť include"

#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Pri spustení zmazať záznam"

#: lazarusidestrconsts:lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Pre prehľadávanie súboru kliknite tu"

#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Kliknite na jednu z položiek pre zobrazenie rozdielov"

#: lazarusidestrconsts:lismenuclose
msgid "Close"
msgstr "Zatvoriť"

#: lazarusidestrconsts:liskmcloseall
msgid "Close All"
msgstr "Zatvoriť všetko"

#: lazarusidestrconsts:lismenucloseproject
msgid "Close Project"
msgstr "Zatvoriť projekt"

#: lazarusidestrconsts:lismenucloseall
msgid "Close all editor files"
msgstr "Zatvoriť všetky súbory editora"

#: lazarusidestrconsts:lissrclosepage
msgid "Close page"
msgstr "Zatvoriť stránku"

#: lazarusidestrconsts:liskmcloseproject
msgid "Close project"
msgstr "Zatvoriť projekt"

#: lazarusidestrconsts:dlgcodegeneration
msgid "Code"
msgstr "Kód"

#: lazarusidestrconsts:lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Prehliadač kódu"

#: lazarusidestrconsts:dlgcodecreation
msgid "Code Creation"
msgstr "Tvorenie kódu"

#: lazarusidestrconsts:lismenuviewcodeexplorer
msgid "Code Explorer"
msgstr "Prieskumník kódu"

#: lazarusidestrconsts:lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Šablóny kódu ..."

#: lazarusidestrconsts:dlgcodetoolstab
msgid "Code Tools"
msgstr "CodeTools"

#: lazarusidestrconsts:liscodebrowser
msgid "Code browser"
msgstr "Prehliadač kódu"

#: lazarusidestrconsts:dlgusecodefolding
msgid "Code folding"
msgstr ""

#: lazarusidestrconsts:dlgedcodeparams
msgid "Code parameters"
msgstr ""

#: lazarusidestrconsts:srkmecautocompletion
msgid "Code template completion"
msgstr ""

#: lazarusidestrconsts:dlgedcodetempl
msgid "Code templates"
msgstr "Šablóny kódu"

#: lazarusidestrconsts:lisceocodeexplorer
msgid "CodeExplorer Options"
msgstr "Voľby CodeExplorer"

#: lazarusidestrconsts:liscodetools
msgid "CodeTools"
msgstr "CodeTools"

#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "CodeTools - nástroje pre spracovanie, prechádzanie a úpravu zdrojových kódov Pascalu"

#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr ""

#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr ""

#: lazarusidestrconsts:dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Voľby CodeTools"

#: lazarusidestrconsts:lismenucodetoolsoptions
msgid "CodeTools Options ..."
msgstr "Voľby CodeTools ..."

#: lazarusidestrconsts:srkmcatcodetools
msgid "CodeTools commands"
msgstr "Príkazy CodeTools"

#: lazarusidestrconsts:liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""

#: lazarusidestrconsts:lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr ""

#: lazarusidestrconsts:liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "Voľby CodeTools"

#: lazarusidestrconsts:srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr ""

#: lazarusidestrconsts:srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Voľby CodeTools"

#: lazarusidestrconsts:liscollapseallclasses
msgid "Collapse all classes"
msgstr "Zbaliť všetky triedy"

#: lazarusidestrconsts:liscollapseallpackages
msgid "Collapse all packages"
msgstr "Zbaliť všetky balíčky"

#: lazarusidestrconsts:liscollapseallunits
msgid "Collapse all units"
msgstr "Zbaliť všetky jednotky"

#: lazarusidestrconsts:lismenucollectpofil
msgid "Collect .po files"
msgstr "Zhromaždiť súbory .po"

#: lazarusidestrconsts:liscodetoolsoptscolon
msgid "Colon"
msgstr "Stĺpec"

#: lazarusidestrconsts:dlgedcolor
msgid "Color"
msgstr "Farba"

#: lazarusidestrconsts:dlgclrscheme
msgid "Color Scheme"
msgstr "Farebná schéma"

#: lazarusidestrconsts:dlgenvcolors
msgid "Colors"
msgstr "Farby"

#: lazarusidestrconsts:srkmeccolumnselect
msgid "Column selection mode"
msgstr "Stĺpcový režim výberu"

#: lazarusidestrconsts:liscodetoolsoptscomma
msgid "Comma"
msgstr "Čiarka"

#: lazarusidestrconsts:liscommandafter
msgid "Command after"
msgstr "Príkaz po"

#: lazarusidestrconsts:liscommandafterinvalid
msgid "Command after invalid"
msgstr ""

#: lazarusidestrconsts:liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr ""

#: lazarusidestrconsts:srkmcatcmdcmd
msgid "Command commands"
msgstr "Príkazy Command"

#: lazarusidestrconsts:dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Parametre príkazového riadku"

#: lazarusidestrconsts:dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametre príkazového riadku (bez mena aplikácie)"

#: lazarusidestrconsts:liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametre príkazového riadku programu"

#: lazarusidestrconsts:liscocommand
msgid "Command:"
msgstr "Príkaz:"

#: lazarusidestrconsts:lismenucommentselection
msgid "Comment selection"
msgstr "Zakomentovať výber"

#: lazarusidestrconsts:liscodetemplcomment
msgid "Comment:"
msgstr "Komentár:"

#: lazarusidestrconsts:dlgcocompilation
msgid "Compilation"
msgstr "Preklad"

#: lazarusidestrconsts:liscocalloncompile
msgid "Compile"
msgstr "Preložiť"

#: lazarusidestrconsts:liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Preložiť IDE (bez linkovania)"

#: lazarusidestrconsts:lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Preložiť všetko?"

#: lazarusidestrconsts:lispckeditcompilepackage
msgid "Compile package"
msgstr "Preložiť balíček"

#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr ""

#: lazarusidestrconsts:liscompiler
msgid "Compiler"
msgstr "Prekladač"

#: lazarusidestrconsts:dlgcompileroptions
msgid "Compiler Options"
msgstr "Voľby prekladača"

#: lazarusidestrconsts:lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Voľby prekladača ..."

#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Voľby prekladača pre balíček %s"

#: lazarusidestrconsts:liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Voľby prekladača pre Projekt: %s"

#: lazarusidestrconsts:liscompilererror
msgid "Compiler error"
msgstr "Chyba prekladača"

#: lazarusidestrconsts:liscompilerfilename
msgid "Compiler filename"
msgstr "Meno súboru prekladača"

#: lazarusidestrconsts:liskmcompileroptions
msgid "Compiler options"
msgstr "Voľby prekladača"

#: lazarusidestrconsts:dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Cesta prekladača (napr. %s)"

#: lazarusidestrconsts:lismenucompletecode
msgid "Complete Code"
msgstr "Dokončovanie kódu"

#: lazarusidestrconsts:srkmeccompletecode
msgid "Complete code"
msgstr "Dokončovanie kódu"

#: lazarusidestrconsts:dlgcompleteproperties
msgid "Complete properties"
msgstr "Dokončovanie vlastností"

#: lazarusidestrconsts:liscomponent
msgid "Component"
msgstr "Komponent"

#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Trieda komponentu %s%s%s je už definovaná"

#: lazarusidestrconsts:liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Meno komponentu %s%s%s je kľúčové slovo"

#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Názov komponentu %s%s%s nie je platný identifikátor"

#: lazarusidestrconsts:lisfpcomponents
msgid "Components"
msgstr "Komponenty"

#: lazarusidestrconsts:liscondition
msgid "Condition"
msgstr ""

#: lazarusidestrconsts:rsconditionaldefines
msgid "Conditional defines"
msgstr ""

#: lazarusidestrconsts:liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Konfigurovať %sVybudovanie súboru%s"

#: lazarusidestrconsts:dlgconfigfiles
msgid "Config Files:"
msgstr "Konfiguračné súbory"

#: lazarusidestrconsts:lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Konfigurovať %sVybudovanie Lazarus%s"

#: lazarusidestrconsts:lisconfigurebuild
msgid "Configure Build %s"
msgstr "Konfigurovať budovanie %s"

#: lazarusidestrconsts:lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Konfigurovať budovanie + Spustiť súbor ..."

#: lazarusidestrconsts:liskmconfigurehelp
msgid "Configure Help"
msgstr "Konfigurovať pomoc"

#: lazarusidestrconsts:lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Konfigurovať pomoc ..."

#: lazarusidestrconsts:lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Konfigurovať Vybudovanie Lazarus"

#: lazarusidestrconsts:liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Konfigurovať voliteľné komponenty"

#: lazarusidestrconsts:lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Konfigurovať voliteľné komponenty ..."

#: lazarusidestrconsts:lismenusettings
msgid "Configure custom tools ..."
msgstr "Konfigurovať voliteľné nástroje ..."

#: lazarusidestrconsts:liskmconfigureinstalledpackages
msgid "Configure installed packages"
msgstr "Konfigurovať inštalované balíčky"

#: lazarusidestrconsts:lismenueditinstallpkgs
msgid "Configure installed packages ..."
msgstr "Konfigurovať inštalované balíčky ..."

#: lazarusidestrconsts:lislazbuildconfirmbuild
msgid "Confirm before rebuilding Lazarus"
msgstr "Potvrdiť pred prebudovaním Lazarus"

#: lazarusidestrconsts:lisconfirmchanges
msgid "Confirm changes"
msgstr "Potvrdiť zmeny"

#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Potvrďte zmazanie závislosti"

#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Potvrdiť nastavenia nového balíčka pre IDE"

#: lazarusidestrconsts:lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Potvrďte odstránenie súboru"

#: lazarusidestrconsts:liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Potvrdiť nahradenie"

#: lazarusidestrconsts:srkmconflic
msgid "Conflict "
msgstr "Konflikt"

#: lazarusidestrconsts:lispeconflictfound
msgid "Conflict found"
msgstr "Nájdený konflikt"

#: lazarusidestrconsts:lisconsoleapplication
msgid "Console application"
msgstr "Konzolová aplikácia"

#: lazarusidestrconsts:lisceconstants
msgid "Constants"
msgstr "Konštanty"

#: lazarusidestrconsts:dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Meno konštruktora musí byť 'init' (deštruktor musí byť 'done')"

#: lazarusidestrconsts:lismenutemplatecontents
msgid "Contents"
msgstr "Obsah"

#: lazarusidestrconsts:lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Kontextovo závislá pomoc"

#: lazarusidestrconsts:liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Kontextovo závislá pomoc"

#: lazarusidestrconsts:liscontinue
msgid "Continue"
msgstr "Pokračovať"

#: lazarusidestrconsts:liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Pokračovať bez načítania formulára"

#: lazarusidestrconsts:liscontributors
msgid "Contributors"
msgstr "Spolupracovníci"

#: lazarusidestrconsts:srvk_control
msgid "Control"
msgstr "Ovládací prvok"

#: lazarusidestrconsts:liscontrolneedsparent
msgid "Control needs parent"
msgstr "Ovládací prvok musí mať rodiča"

#: lazarusidestrconsts:lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Voľby konverzie"

#: lazarusidestrconsts:lisconversionerror
msgid "Conversion error"
msgstr "Chyba konverzie"

#: lazarusidestrconsts:srvk_convert
msgid "Convert"
msgstr "Konvertovať"

#: lazarusidestrconsts:liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "Konvertovať súbor DFM na LFM"

#: lazarusidestrconsts:lismenuconvertdfmtolfm
msgid "Convert DFM file to LFM ..."
msgstr "Konvertovať súbor DFM na LFM ..."

#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Konvertovať balíček Delhi na Lazarus"

#: lazarusidestrconsts:lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Konvertovať balíček Delphi na Lazarus ..."

#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Konvertovať projekt Delphi na Lazarus"

#: lazarusidestrconsts:lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Konvertovať projekt Delphi na Lazarus ..."

#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Konvertovať jednotku Delphi na Lazarus"

#: lazarusidestrconsts:lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Konvertovať jednotku Deplhi na Lazarus ..."

#: lazarusidestrconsts:liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Konvertovať uzol"

#: lazarusidestrconsts:srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Konvertuj tabulátory na medzery vo výbere"

#: lazarusidestrconsts:lismenucopy
msgid "Copy"
msgstr "Kopírovať"

#: lazarusidestrconsts:liscopyall
msgid "Copy All"
msgstr ""

#: lazarusidestrconsts:liscopyerror
msgid "Copy Error"
msgstr "Chyba kopírovania"

#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
msgid "Copy all and hidden messages to clipboard"
msgstr "Kopírovať všetky skryté správy do schánky"

#: lazarusidestrconsts:liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr "Kopírovať všetky správy do schránky"

#: lazarusidestrconsts:liscopyerror2
msgid "Copy error"
msgstr "Chyba kopírovania"

#: lazarusidestrconsts:uemcopyfilename
msgid "Copy filename"
msgstr "Kopírovať meno súboru"

#: lazarusidestrconsts:lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Kopírovať zo zdedených"

#: lazarusidestrconsts:lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Kopírovať meno metódy do schránky"

#: lazarusidestrconsts:lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Kopírovať výstup do  do schránky"

#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Kopírovať vybraté komponenty do schránky"

#: lazarusidestrconsts:lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kopírovať vybraté komponenty do schránky"

#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Kopírovať vybrané správy do schránky"

#: lazarusidestrconsts:srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Kopírovať výber do schránky"

#: lazarusidestrconsts:lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Kopírovať informácie o verzii do schránky"

#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""

#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Kopírovanie celého formulára nie je implementované"

#: lazarusidestrconsts:rscopyright
msgid "Copyright:"
msgstr "Autorské práva:"

#: lazarusidestrconsts:dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Počítadlo (.pp;1)"

#: lazarusidestrconsts:lisnpcreate
msgid "Create"
msgstr "Vytvoriť"

#: lazarusidestrconsts:lismenucreatepofile
msgid "Create .po files"
msgstr "Vytvoriť .po súbory"

#: lazarusidestrconsts:dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Vytvoriť zväzok aplikácií"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Vytvoriť FPC makrá a cesty pre adresár projektu fpc"

#: lazarusidestrconsts:lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "Vytvoriť súbory FPDoc"

#: lazarusidestrconsts:dlgcocreatemakefile
msgid "Create Makefile"
msgstr "Vytvoriť Makefile"

#: lazarusidestrconsts:lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Vytvoriť podmenu"

#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr "Vytvoriť novú CGI aplikáciu.%sSúbor programuj e spravovaný Lazarom."

#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Vytvoriť novú súbor editora.%sZvoľte typ."

#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Vytvoriť nový prázdny textový súbor."

#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr "vytvára novú grafickú aplikáciu.%sSúbor programu je spravovaný Lazarom."

#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Vytvoriť novú jednotku Pascalu."

#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Vytvoriť nový program."

#: lazarusidestrconsts:lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr "Vyztvoriť nový program.%sSúbor programu je spravovaný Lazarom."

#: lazarusidestrconsts:lisnpcreateanewproject
msgid "Create a new project"
msgstr "Vytvoriť nový projekt"

#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Vytvoriť nový projekt.%sZvoľte typ"

#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Vytvoriť nový štandardný balíček.%sBalíček je kolekcia jednotiek ak omponentov."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Vytvoriť novú jednotku s formulárom LCL."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Vytvoriť novú jednotku s dátovým modulom."

#: lazarusidestrconsts:liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Najprv vytvorte projekt!"

#: lazarusidestrconsts:liscodehelpcreatebutton
msgid "Create help item"
msgstr "Vytvoriť položku pomoci"

#: lazarusidestrconsts:rscreatenewdefine
msgid "Create new define"
msgstr ""

#: lazarusidestrconsts:lisa2pcreatenewfile
msgid "Create new file"
msgstr "Vytvoriť nový súbor"

#: lazarusidestrconsts:liscreatenewproject
msgid "Create new project"
msgstr "Vytvoriť nový projekt"

#: lazarusidestrconsts:dlgruberbandcreationcolor
msgid "Creation"
msgstr "Vytváranie"

#: lazarusidestrconsts:srkm_ctrl
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts:liscurrent
msgid "Current"
msgstr ""

#: lazarusidestrconsts:lisedtdefcurrentproject
msgid "Current Project"
msgstr "Aktuálny projekt"

#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Adresár aktuálneho projektu"

#: lazarusidestrconsts:lismenuinsertdatetime
msgid "Current date and time"
msgstr "Aktuálny dátum a čas"

#: lazarusidestrconsts:lismenuinsertusername
msgid "Current username"
msgstr "Meno aktuálneho používateľa"

#: lazarusidestrconsts:dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Kurzor za EOL"

#: lazarusidestrconsts:liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Stĺpec kurzora v aktuálnom editore"

#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Kurzor nie je v definícii triedy"

#: lazarusidestrconsts:srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Príkazy presunu kurzora"

#: lazarusidestrconsts:liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Riadok kurzora v aktuálnom editore"

#: lazarusidestrconsts:lispckoptscustom
msgid "Custom"
msgstr "Vlastné"

#: lazarusidestrconsts:liscustomprogram
msgid "Custom Program"
msgstr "Vlastný program"

#: lazarusidestrconsts:liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr "Vlastný program%sProgram FreePascal."

#: lazarusidestrconsts:liskeycatcustom
msgid "Custom commands"
msgstr "Vlastné príkazy"

#: lazarusidestrconsts:lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Vlastný identifikátor"

#: lazarusidestrconsts:liscustomoptions2
msgid "Custom options"
msgstr "Vlastné voľby"

#: lazarusidestrconsts:rsiwpcustomposition
msgid "Custom position"
msgstr "Vlastná pozícia"

#: lazarusidestrconsts:srkmeccustomtool
msgid "Custom tool %d"
msgstr "Vlastný nástroj %d"

#: lazarusidestrconsts:lismenucut
msgid "Cut"
msgstr "Vystrihnúť"

#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Vystrihnúť zvolené komponenty do schránky"

#: lazarusidestrconsts:lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Vystrihnúť vybraté komponenty do schránky"

#: lazarusidestrconsts:srkmeccut
msgid "Cut selection to clipboard"
msgstr "Vystrihnúť výber do schránky"

#: lazarusidestrconsts:liswldisableall
msgid "D&isable All"
msgstr "Z&akázať všetko"

#: lazarusidestrconsts:lishlpoptsdatabases
msgid "Databases"
msgstr "Databázy"

#: lazarusidestrconsts:lisdate
msgid "Date"
msgstr "Dátum"

#: lazarusidestrconsts:liswldeleteall
msgid "De&lete All"
msgstr "Zma&zať všetko"

#: lazarusidestrconsts:uemdebugword
msgid "Debug"
msgstr "Ladiť"

#: lazarusidestrconsts:lismenuviewdebugoutput
msgid "Debug output"
msgstr "Výstup ladenia"

#: lazarusidestrconsts:lismenudebugwindows
msgid "Debug windows"
msgstr "Okná ladenia"

#: lazarusidestrconsts:lismendebuggeroptions
msgid "Debugger Options ..."
msgstr "Voľby debugera ..."

#: lazarusidestrconsts:lisdebuggererror
msgid "Debugger error"
msgstr "Chyba debugera"

#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Chyba debugera %sDebuger vstúpil do chybového stavu%sUložte svoju prácu!%sPoužite Stop, a dúfajte v najlepšie, we're pulling the plug."

#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Všeobecné voľby debugera"

#: lazarusidestrconsts:lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Neplatný debuger"

#: lazarusidestrconsts:dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Ďalšie cesty debugera (žiadne):"

#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Špecifické voľby debugera (závisia na type debugera)"

#: lazarusidestrconsts:dlgdebugtype
msgid "Debugger type and path"
msgstr "Typ a cesta debugera"

#: lazarusidestrconsts:dlgcodebugging
msgid "Debugging:"
msgstr "Ladenie:"

#: lazarusidestrconsts:lisdecimal
msgid "Decimal"
msgstr ""

#: lazarusidestrconsts:dlgassemblerdefault
msgid "Default"
msgstr "Predvolené"

#: lazarusidestrconsts:dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Predvolený font editora"

#: lazarusidestrconsts:dlgpasext
msgid "Default pascal extension"
msgstr "Predvolená prípona Pascalu"

#: lazarusidestrconsts:dlgdefvaluecolor
msgid "Default value"
msgstr "Predvolená hodnota"

#: lazarusidestrconsts:liscodetoolsdefsdefine
msgid "Define"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr ""

#: lazarusidestrconsts:lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definovať šablóny"

#: lazarusidestrconsts:dlgeddelay
msgid "Delay"
msgstr "Oneskorenie"

#: lazarusidestrconsts:dlgeddelete
msgid "Delete"
msgstr "Delete"

#: lazarusidestrconsts:lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""

#: lazarusidestrconsts:lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Zmazať zo šablóny ..."

#: lazarusidestrconsts:lismenueditordeleteitem
msgid "Delete Item"
msgstr "Zmazať položku"

#: lazarusidestrconsts:srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Zmazať posledná znak"

#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Zmazať súbor starého balíčka?"

#: lazarusidestrconsts:lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr ""

#: lazarusidestrconsts:lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""

#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""

#: lazarusidestrconsts:lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Zmazať všetky tieto súbory?"

#: lazarusidestrconsts:lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Zmazať nejednoznačný súbor?"

#: lazarusidestrconsts:lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""

#: lazarusidestrconsts:srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Zmazať znak na kurzore"

#: lazarusidestrconsts:srkmecdeleteline
msgid "Delete current line"
msgstr "Zmazať aktuálny riadok"

#: lazarusidestrconsts:lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Zmazať závislosť pre %s?"

#: lazarusidestrconsts:lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Zmazanie zlyhalo"

#: lazarusidestrconsts:lisdeletefilefailed
msgid "Delete file failed"
msgstr "Zmazanie súboru zlyhalo"

#: lazarusidestrconsts:liskmdeletelastchar
msgid "Delete last char"
msgstr "Zmazať posledný znak"

#: lazarusidestrconsts:liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Zmazať odkaz"

#: lazarusidestrconsts:liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Zmazať uzol"

#: lazarusidestrconsts:lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Zmazať starý súbor %s%s%s?"

#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Zmazať starý súbor balíčka %s%s%s?"

#: lazarusidestrconsts:fdmdeleteselection
msgid "Delete selection"
msgstr "Zmazať výber"

#: lazarusidestrconsts:dlgdeltemplate
msgid "Delete template "
msgstr "Zmazať šablónu"

#: lazarusidestrconsts:srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Zmazať po začiatok riadku"

#: lazarusidestrconsts:srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Zmazať do konca riadku"

#: lazarusidestrconsts:srkmecdeleteword
msgid "Delete to end of word"
msgstr "Zmazať do konca slova"

#: lazarusidestrconsts:srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Zmazať po začiatok slova"

#: lazarusidestrconsts:srkmecclearall
msgid "Delete whole text"
msgstr "Zmazať celý text"

#: lazarusidestrconsts:lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Mazanie súboru %s%s%s zlyhalo."

#: lazarusidestrconsts:dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Rozšírenia Delphi 2"

#: lazarusidestrconsts:dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Kompatibilné s Deplhi"

#: lazarusidestrconsts:lisdelphiproject
msgid "Delphi project"
msgstr "Projekt Delphi"

#: lazarusidestrconsts:lisa2pdependency
msgid "Dependency"
msgstr "Závislosť"

#: lazarusidestrconsts:lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Vlastnosti závislosti"

#: lazarusidestrconsts:lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Závislosť už existuje"

#: lazarusidestrconsts:lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Závislosť bez vlastníka: %s"

#: lazarusidestrconsts:lissortseldescending
msgid "Descending"
msgstr "Zostupne"

#: lazarusidestrconsts:listodoldescription
msgid "Description"
msgstr "Popis"

#: lazarusidestrconsts:lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Popis/Zhrnutie"

#: lazarusidestrconsts:liscodetoolsdefsdescription
msgid "Description:"
msgstr "Popis:"

#: lazarusidestrconsts:lisoipdescription
msgid "Description:  "
msgstr "Popis:"

#: lazarusidestrconsts:liskeycatdesigner
msgid "Designer commands"
msgstr "Príkazy návrhára"

#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Doba návrhu i spustenia"

#: lazarusidestrconsts:lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Len doba návrhu"

#: lazarusidestrconsts:dlgdesktop
msgid "Desktop"
msgstr "Plocha"

#: lazarusidestrconsts:dlgdesktopfiles
msgid "Desktop files"
msgstr "Súbory plochy"

#: lazarusidestrconsts:lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Cieľový balíček"

#: lazarusidestrconsts:lisdestinationdirectory
msgid "Destination directory"
msgstr "Cieľový adresár"

#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Cieľový adresár %s%s%s nie je platný.%sProsím zvoľte úplnú cestu."

#: lazarusidestrconsts:lismenudiff
msgid "Diff"
msgstr "Rozdiely"

#: lazarusidestrconsts:liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "Rozdiely súborov editora"

#: lazarusidestrconsts:lisdigits
msgid "Digits:"
msgstr ""

#: lazarusidestrconsts:dlgdirection
msgid "Direction"
msgstr "Smer"

#: lazarusidestrconsts:lisdirectives
msgid "Directives"
msgstr "Direktívy"

#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Adresár"

#: lazarusidestrconsts:dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Adresár neexistuje"

#: lazarusidestrconsts:dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Adresár pre vybudovanie testovacích projektov"

#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Adresár nenájdený"

#: lazarusidestrconsts:lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Voľby adresára"

#: lazarusidestrconsts:lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""

#: lazarusidestrconsts:lisdisablegroup
msgid "Disable Group"
msgstr ""

#: lazarusidestrconsts:lisdisabled
msgid "Disabled"
msgstr ""

#: lazarusidestrconsts:lisdiscardchanges
msgid "Discard changes"
msgstr "Zahodiť zmeny"

#: lazarusidestrconsts:dlgeddisplay
msgid "Display"
msgstr "Zobraziť"

#: lazarusidestrconsts:dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Zobraziť (nie pre Win32, napr. 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts:dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Zobraziť čísla riadkov v behovom výpise chýb"

#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Rozoznávať veľké a malé písmená, napr. C a c"

#: lazarusidestrconsts:dlgcfdividerdrawlevel
msgid "Divider Draw Level"
msgstr ""

#: lazarusidestrconsts:lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Nezatvárať IDE"

#: lazarusidestrconsts:lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Nezatvárať projekt"

#: lazarusidestrconsts:lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Neukladať žiadne informácie o relácii"

#: lazarusidestrconsts:lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Nezobrazovať úvodnú obrazovku"

#: lazarusidestrconsts:lisuedonotsho
msgid "Do not show this message again."
msgstr "Túto správu už nezobrazovať."

#: lazarusidestrconsts:dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Nerozdeľovať riadok pred:"

#: lazarusidestrconsts:dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Nerozdeľovať riadok za:"

#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Naozaj chcete zahodiť všetky zmeny balíčka %s a znova načítať súbor?"

#: lazarusidestrconsts:lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus?"
msgstr "Chcete prebudovať Lazarus?"

#: lazarusidestrconsts:rsiwpdocked
msgid "Docked"
msgstr "Dokované"

#: lazarusidestrconsts:lismvdocking
msgid "Docking"
msgstr "Dokovanie"

#: lazarusidestrconsts:lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Editor dokumentácie"

#: lazarusidestrconsts:liscodehelpnodocumentation
msgid "Documentation entry does not exist"
msgstr "Položka dokumentácie neexistuje"

#: lazarusidestrconsts:lissortseldomain
msgid "Domain"
msgstr "Doména"

#: lazarusidestrconsts:listodoldone
msgid "Done"
msgstr "Hotové"

#: lazarusidestrconsts:dlgdoubleclickline
msgid "Double click line"
msgstr "Dvojklik pre riadok"

#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr "Dvojklik na správy presúva (inak jednoduché kliknutie)"

#: lazarusidestrconsts:dlgdownword
msgid "Down"
msgstr ""

#: lazarusidestrconsts:dlgdragdroped
msgid "Drag Drop editing"
msgstr ""

#: lazarusidestrconsts:dlgdropfiles
msgid "Drop files"
msgstr ""

#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Duplikované meno: Komponent pomenovaný %s%s%s už existuje v zdedených komponentoch %s"

#: lazarusidestrconsts:rslanguagedutch
msgid "Dutch"
msgstr "Holandsky"

#: lazarusidestrconsts:liswlenableall
msgid "E&nable All"
msgstr "Zap&núť všetky"

#: lazarusidestrconsts:lismenuenvironent
msgid "E&nvironment"
msgstr "P&rostredie"

#: lazarusidestrconsts:lisccoerrormsg
msgid "ERROR: "
msgstr "CHYBA:"

#: lazarusidestrconsts:liscodetoolsdefsedit
msgid "Edit"
msgstr "Upraviť"

#: lazarusidestrconsts:liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Upraviť šablóny kódu"

#: lazarusidestrconsts:lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Upraviť Všeobecné voľby"

#: lazarusidestrconsts:srkmeditkeys
msgid "Edit Keys"
msgstr "Upraviť klávesy"

#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Upraviť Voľby preloženia balíčka"

#: lazarusidestrconsts:lisedtexttooledittool
msgid "Edit Tool"
msgstr "Upraviť Nástroj"

#: lazarusidestrconsts:lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Upraviť virtuálnu jednotku"

#: lazarusidestrconsts:liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Upraviť šablónu kódu"

#: lazarusidestrconsts:lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Upraviť kontextovo závislú pomoc"

#: lazarusidestrconsts:liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Upraviť kontextovo závislú pomoc"

#: lazarusidestrconsts:liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr ""

#: lazarusidestrconsts:srkmeditforcmd
msgid "Edit keys for command"
msgstr "Upraviť klávesy pre príkazy"

#: lazarusidestrconsts:lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Upraviť virtuálnu jednotku"

#: lazarusidestrconsts:dlgededit
msgid "Edit..."
msgstr "Upraviť ..."

#: lazarusidestrconsts:dlgedfiles
msgid "Editor files"
msgstr "Súbory editora"

#: lazarusidestrconsts:dlgeditorfont
msgid "Editor font"
msgstr "Font editora"

#: lazarusidestrconsts:dlgeditorfontheight
msgid "Editor font height"
msgstr "Výška fontu editora"

#: lazarusidestrconsts:liskmeditoroptions
msgid "Editor options"
msgstr "Voľby editora"

#: lazarusidestrconsts:lismenueditoroptions
msgid "Editor options ..."
msgstr "Voľby editora ..."

#: lazarusidestrconsts:uemeditorproperties
msgid "Editor properties"
msgstr "Vlastnosti editora"

#: lazarusidestrconsts:dlgedelement
msgid "Element"
msgstr "Prvok"

#: lazarusidestrconsts:liscodetoolsdefselse
msgid "Else"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefselseif
msgid "ElseIf"
msgstr ""

#: lazarusidestrconsts:lisemdemtpymethods
msgid "Emtpy Methods"
msgstr ""

#: lazarusidestrconsts:lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""

#: lazarusidestrconsts:lisenablegroup
msgid "Enable Group"
msgstr ""

#: lazarusidestrconsts:lisenablemacros
msgid "Enable Macros"
msgstr "Zapnúť makrá"

#: lazarusidestrconsts:rsenablei18n
msgid "Enable i18n"
msgstr "Zapnúť i18n"

#: lazarusidestrconsts:lisenabled
msgid "Enabled"
msgstr "Povolené"

#: lazarusidestrconsts:lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Povolené = zahrnúť %s v Ukotveniach"

#: lazarusidestrconsts:lisenclose
msgid "Enclose"
msgstr "Uzavrieť"

#: lazarusidestrconsts:uemencloseselection
msgid "Enclose Selection"
msgstr "Uzavrieť výber"

#: lazarusidestrconsts:liskmencloseselection
msgid "Enclose selection"
msgstr "Uzavrieť výber"

#: lazarusidestrconsts:lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Uzavrieť výber ..."

#: lazarusidestrconsts:srvk_end
msgid "End"
msgstr ""

#: lazarusidestrconsts:rslanguageenglish
msgid "English"
msgstr "Anglicky"

#: lazarusidestrconsts:lismacropromptenterdata
msgid "Enter data"
msgstr "Zadajte dáta"

#: lazarusidestrconsts:lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Zadajte parametre spustenia"

#: lazarusidestrconsts:lisentertransla
msgid "Enter translation language"
msgstr "Zadajte jazyk prekladu"

#: lazarusidestrconsts:dlgrunoenvironment
msgid "Environment"
msgstr "Prostredie"

#: lazarusidestrconsts:srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Príkazy menu Prostredie"

#: lazarusidestrconsts:lismenugeneraloptions
msgid "Environment options ..."
msgstr "Voľby prostredia ..."

#: lazarusidestrconsts:lisccoerrorcaption
msgid "Error"
msgstr "Chyba"

#: lazarusidestrconsts:lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Chyba čítania balíčka"

#: lazarusidestrconsts:lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Chyba zápisu balíčka"

#: lazarusidestrconsts:lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Chyba prístupu k XML"

#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Chyba prístupu k súboru xml %s%s%s:%s%s"

#: lazarusidestrconsts:liserrorcreatingfile
msgid "Error creating file"
msgstr "Chyba vytvárania súboru"

#: lazarusidestrconsts:liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Chyba vytvárania lrs"

#: lazarusidestrconsts:liserrordeletingfile
msgid "Error deleting file"
msgstr "Chyba mazania súboru"

#: lazarusidestrconsts:liserrorin
msgid "Error in %s"
msgstr "Chyba v %s"

#: lazarusidestrconsts:lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Chyba v regulárnom výraze"

#: lazarusidestrconsts:liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Chyba inicializácie programu%s%s%s%s%sChyba: %s"

#: lazarusidestrconsts:liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Chyba načítania %s z%s%s%s%s"

#: lazarusidestrconsts:liserrorloadingfile
msgid "Error loading file"
msgstr "Chyba načítania súboru"

#: lazarusidestrconsts:lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Chyba načítania XML"

#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Chyba načítania súboru XML %s%s%s:%s%s"

#: lazarusidestrconsts:liserrormovingcomponent
msgid "Error moving component"
msgstr "Chyba presúvania komponentu"

#: lazarusidestrconsts:liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Chyba presúvania komponentu %s:%s"

#: lazarusidestrconsts:lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "Nastala chyba pri vytváraní zväzku aplikácií:"

#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Chyba analýzy toku komponentov lfm."

#: lazarusidestrconsts:liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Chyba čítania %s%s%s%s%s"

#: lazarusidestrconsts:lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Chyba čítania súboru"

#: lazarusidestrconsts:lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Chyba čítania súboru: %s"

#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Chyba čítania zoznamu balíčkov zo súboru %s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Chyba čítania informačného súboru projektu %s%s%s%s%s"

#: lazarusidestrconsts:liserrorrenamingfile
msgid "Error renaming file"
msgstr "Chyba premenovania súboru"

#: lazarusidestrconsts:liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Chyba pri ukladaní %s do%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Chyba počas zápisu %s%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Chyb počas zápisu projektu do súboru %s%s%s%s%s"

#: lazarusidestrconsts:lislazbuilderrorwritingfile
msgid "Error writing file"
msgstr "Chyba zapisovania súboru"

#: lazarusidestrconsts:liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Chyba zápisu zoznamu balíčkov do súboru%s%s%s%s"

#: lazarusidestrconsts:liserror
msgid "Error: "
msgstr "Chyba:"

#: lazarusidestrconsts:liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Chyba: neplatný prekladač: %s"

#: lazarusidestrconsts:liserrors
msgid "Errors"
msgstr "Chyby"

#: lazarusidestrconsts:srvk_escape
msgid "Escape"
msgstr ""

#: lazarusidestrconsts:liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Vyskúšať/Upraviť"

#: lazarusidestrconsts:lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Vyskúšať/Upraviť ..."

#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
msgid "Event Log"
msgstr "Záznam udalostí"

#: lazarusidestrconsts:liscodehelpexampletag
msgid "Example"
msgstr "Príklad"

#: lazarusidestrconsts:lisexamples
msgid "Examples"
msgstr "Príklady"

#: lazarusidestrconsts:lisexcludefilter
msgid "Exclude Filter"
msgstr "Vylučovací filter"

#: lazarusidestrconsts:srvk_execute
msgid "Execute"
msgstr "Spustiť"

#: lazarusidestrconsts:liscoexecuteafter
msgid "Execute after"
msgstr "Spustiť po"

#: lazarusidestrconsts:liscoexecutebefore
msgid "Execute before"
msgstr "Spustiť pred"

#: lazarusidestrconsts:lisexecutingcommandafter
msgid "Executing command after"
msgstr "Vykonať príkaz po"

#: lazarusidestrconsts:lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Vykonať príkaz pred"

#: lazarusidestrconsts:lisexecutionpaused
msgid "Execution paused"
msgstr "Vykonávanie prerušené"

#: lazarusidestrconsts:lisexecutionpausedadress
msgid "Execution paused%s  Adress: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Vykonávanie prerušené%s  Adresa: $%s%s  Procedúra: %s%s Súbor: %s%s(Niekedy sa tu môže objaviť okno assemblera:)%s"

#: lazarusidestrconsts:lisexecutionstopped
msgid "Execution stopped"
msgstr "Vykonávanie zastavené"

#: lazarusidestrconsts:lisexecutionstoppedon
msgid "Execution stopped%s"
msgstr "Vykonávanie zastavené%s"

#: lazarusidestrconsts:lispldexists
msgid "Exists"
msgstr "Existuje"

#: lazarusidestrconsts:liscodetoolsdefsexit
msgid "Exit"
msgstr "Skončiť"

#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Skončiť bez uloženia"

#: lazarusidestrconsts:lisexpandallclasses
msgid "Expand all classes"
msgstr "Rozbaliť všetky triedy"

#: lazarusidestrconsts:lisexpandallpackages
msgid "Expand all packages"
msgstr "Rozbaliť všetky balíčky"

#: lazarusidestrconsts:lisexpandallunits
msgid "Expand all units"
msgstr "Rozbaliť všetky jednotky"

#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Úplné meno súboru aktuálneho súboru editora"

#: lazarusidestrconsts:lisexport
msgid "Export ..."
msgstr "Exportovať ..."

#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Exportovaný súbor %s%s%s existuje.%sotvoriť súbor a nahradiť len voľby prekladača?%s(Ostatné nastavenia ostanú zachované.)"

#: lazarusidestrconsts:lisiecoexportfileexists
msgid "Export file exists"
msgstr "Exportovaný súbor existuje"

#: lazarusidestrconsts:lisexportlist
msgid "Export list"
msgstr "Exportovať zoznam"

#: lazarusidestrconsts:liswlexpression
msgid "Expression"
msgstr "Výraz"

#: lazarusidestrconsts:lisexpression
msgid "Expression:"
msgstr ""

#: lazarusidestrconsts:lisextendunitpath
msgid "Extend unit path?"
msgstr "Rozšíriť cestu jednotky?"

#: lazarusidestrconsts:liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Nastavenie externých nástrojov"

#: lazarusidestrconsts:srkmecexttool
msgid "External tool %d"
msgstr "Externý nástroj %d"

#: lazarusidestrconsts:lisexttoolexternaltools
msgid "External tools"
msgstr "Externé nástroje"

#: lazarusidestrconsts:srkmecexttoolsettings
msgid "External tools settings"
msgstr "Nastavenie externých nástrojov"

#: lazarusidestrconsts:dlgextralinespacing
msgid "Extra line spacing"
msgstr "Medzera medzi riadkami"

#: lazarusidestrconsts:lisextract
msgid "Extract"
msgstr "Oddeliť"

#: lazarusidestrconsts:uemextractproc
msgid "Extract Procedure"
msgstr "Oddeliť procedúru"

#: lazarusidestrconsts:srkmecextractproc
msgid "Extract procedure"
msgstr "Oddeliť procedúru"

#: lazarusidestrconsts:lismenuextractproc
msgid "Extract procedure ..."
msgstr "Oddeliť procedúru ..."

#: lazarusidestrconsts:lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Cesta k HTML dokumentácii FPC"

#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "SVN Adresár zdrojových kódov FPC"

#: lazarusidestrconsts:lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Chyba adresára zdrojových kódov FPC"

#: lazarusidestrconsts:dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Adresár zdrojových kódov FPC"

#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Adresár zdrojových kódov FCP \"%s\" nenájdený."

#: lazarusidestrconsts:lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Cesta k jednotkám FPC so zdrojovým kódom"

#: lazarusidestrconsts:lismenufpdoceditor
msgid "FPDoc Editor"
msgstr "Editor FPCDoc"

#: lazarusidestrconsts:lisfpdoceditor
msgid "FPDoc editor"
msgstr "Editor·FPCDoc"

#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
msgid "FPDoc files path"
msgstr "Cesta k súborom FPDoc"

#: lazarusidestrconsts:lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Zlyhalo spustenie nástroja"

#: lazarusidestrconsts:dlgcofast
msgid "Faster Code"
msgstr "Rýchlejší kód"

#: lazarusidestrconsts:lismenutemplatefile
msgid "File"
msgstr "Súbor"

#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Súbor %s%s%s už v projekte existuje."

#: lazarusidestrconsts:lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Súbor %s%s%s bol zmenený. Uložiť?"

#: lazarusidestrconsts:lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Súbor %s%s%s je virtuálny."

#: lazarusidestrconsts:lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Súbor %s%s%s nenájdený."

#: lazarusidestrconsts:lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Súbor %s%s%s nenájdený.%s"

#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Súbor %s%s%s nenájdený.%sChcete ho vytvoriť?%s"

#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Súbor %s%s%s%snevyzerá ako textový súbor.%sOtvoriť ho i tak?"

#: lazarusidestrconsts:lispckeditfileproperties
msgid "File Properties"
msgstr "Vlastnosti súboru"

#: lazarusidestrconsts:lisfilesettings
msgid "File Settings ..."
msgstr "Nastavenia súboru ..."

#: lazarusidestrconsts:lisaf2pfiletype
msgid "File Type"
msgstr "Typ súboru"

#: lazarusidestrconsts:lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Súbor už existuje"

#: lazarusidestrconsts:lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Súbor už je v balíčku"

#: lazarusidestrconsts:dlgfileexts
msgid "File extensions"
msgstr "Prípony súborov"

#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Súbor už v balíčku existuje"

#: lazarusidestrconsts:lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Súbor je v projekte"

#: lazarusidestrconsts:lisfileisnotwritable
msgid "File is not writable"
msgstr "Súbor nie je zapisovateľný"

#: lazarusidestrconsts:uefilerocap
msgid "File is readonly"
msgstr "Súbor je len na čítanie"

#: lazarusidestrconsts:lisfileissymlink
msgid "File is symlink"
msgstr "Súbor je symbolický odkaz"

#: lazarusidestrconsts:lisa2pfileisused
msgid "File is used"
msgstr "Súbor je používaný"

#: lazarusidestrconsts:lisfilelinkerror
msgid "File link error"
msgstr "Chyba linkovania súboru"

#: lazarusidestrconsts:lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Maska súboru (*;*.*;*.bak?)"

#: lazarusidestrconsts:srkmcatfilemenu
msgid "File menu commands"
msgstr "Príkazy menu Súbor"

#: lazarusidestrconsts:lisa2pfilename
msgid "File name:"
msgstr "Meno súboru:"

#: lazarusidestrconsts:lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Súbor nie je spustiteľný"

#: lazarusidestrconsts:lisfilenotfound
msgid "File not found"
msgstr "Súbor nenájdený"

#: lazarusidestrconsts:lisfilenotlowercase
msgid "File not lowercase"
msgstr "Súbor nie je malými znakmi"

#: lazarusidestrconsts:lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Súbor neuložený"

#: lazarusidestrconsts:lisfilenottext
msgid "File not text"
msgstr "Súbor nie je textový"

#: lazarusidestrconsts:lisa2pfilenotunit
msgid "File not unit"
msgstr "Súbor nie je jednotka"

#: lazarusidestrconsts:lisa2pfilename2
msgid "Filename"
msgstr "Meno súboru"

#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Meno súboru je iné ako z mena balíčka"

#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Meno súboru je použité iným balíčkom"

#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Meno súboru je použité projektom"

#: lazarusidestrconsts:lisfilenameaddress
msgid "Filename/Address"
msgstr ""

#: lazarusidestrconsts:lispefilename
msgid "Filename:"
msgstr "Meno súboru:"

#: lazarusidestrconsts:lisoipfilename
msgid "Filename:  %s"
msgstr "Meno súboru:  %s"

#: lazarusidestrconsts:dlgenvfiles
msgid "Files"
msgstr "Súbory"

#: lazarusidestrconsts:lisfilter
msgid "Filter"
msgstr "Filter"

#: lazarusidestrconsts:lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrovanie s porovnávaním akejkoľvek časti metódy"

#: lazarusidestrconsts:lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrovanie s porovnávaním začiatku metódy"

#: lazarusidestrconsts:srvk_final
msgid "Final"
msgstr ""

#: lazarusidestrconsts:lismenufind
msgid "Find"
msgstr "Nájsť"

#: lazarusidestrconsts:lismenufindnext
msgid "Find &Next"
msgstr "Ná&jsť ďalší"

#: lazarusidestrconsts:lismenufindprevious
msgid "Find &Previous"
msgstr "Nájsť &predchádzajúci"

#: lazarusidestrconsts:lismenufindinfiles
msgid "Find &in files ..."
msgstr "Nájsť v &súboroch ..."

#: lazarusidestrconsts:lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Nájsť deklaráciu na kurzore"

#: lazarusidestrconsts:uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Nájsť odkazy na identifikátor"

#: lazarusidestrconsts:lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Nájsť odkazy na identifikátor ..."

#: lazarusidestrconsts:lismenutemplatefindnext
msgid "Find Next"
msgstr "Nájsť ďalší"

#: lazarusidestrconsts:lisfrifindreferences
msgid "Find References"
msgstr "Nájsť odkazy"

#: lazarusidestrconsts:srkmecfindblockotherend
msgid "Find block other end"
msgstr "Nájsť druhý koniec bloku"

#: lazarusidestrconsts:srkmecfindblockstart
msgid "Find block start"
msgstr "Nájsť začiatok bloku"

#: lazarusidestrconsts:lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Nájsť začiatok bloku kódu"

#: lazarusidestrconsts:liscomppalfindcomponent
msgid "Find component"
msgstr "Nájsť komponent"

#: lazarusidestrconsts:srkmecfinddeclaration
msgid "Find declaration"
msgstr "Nájsť deklaráciu"

#: lazarusidestrconsts:srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Nájsť odkazy na identifikátor"

#: lazarusidestrconsts:srkmecfindinfiles
msgid "Find in files"
msgstr "Nájsť v súboroch"

#: lazarusidestrconsts:liskmfindincremental
msgid "Find incremental"
msgstr "Nájsť narastajúco"

#: lazarusidestrconsts:srkmecfindnext
msgid "Find next"
msgstr "Nájsť ďalšie"

#: lazarusidestrconsts:srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Nájsť ďalší výskyt slova"

#: lazarusidestrconsts:lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Nájsť alebo premenovať identifikátor"

#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Nájsť druhý koniec bloku kódu"

#: lazarusidestrconsts:lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Nájsť komponent palety"

#: lazarusidestrconsts:srkmecfindprevious
msgid "Find previous"
msgstr "Nájsť predchádzajúci"

#: lazarusidestrconsts:srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Nájsť predchádzajúci výskyt slova"

#: lazarusidestrconsts:srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Nájsť definíciu procedúry"

#: lazarusidestrconsts:srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Nájsť metódu procedúry"

#: lazarusidestrconsts:srkmecfind
msgid "Find text"
msgstr "Nájsť text"

#: lazarusidestrconsts:dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Nájsť text na kurzore"

#: lazarusidestrconsts:rslanguagefinnish
msgid "Finnish"
msgstr "Finsky"

#: lazarusidestrconsts:lispefixfilescase
msgid "Fix Files Case"
msgstr "Opraviť veľkosť písmen"

#: lazarusidestrconsts:lisfixlfmfile
msgid "Fix LFM file"
msgstr "Opraviť súbor LFM"

#: lazarusidestrconsts:lisfloatingpoin
msgid "Floating Point"
msgstr ""

#: lazarusidestrconsts:srkmecjumptoeditor
msgid "Focus to source editor"
msgstr "Prepnúť do editora zdrojových kódov"

#: lazarusidestrconsts:liscefollowcursor
msgid "Follow cursor"
msgstr "Nasledovať kurzor"

#: lazarusidestrconsts:lisuefontwith
msgid "Font without UTF-8"
msgstr "Font bez UTF-8"

#: lazarusidestrconsts:lisforcerenaming
msgid "Force renaming"
msgstr "Vynútiť premenovanie"

#: lazarusidestrconsts:dlgforecolor
msgid "Foreground color"
msgstr "Farba popredia"

#: lazarusidestrconsts:dlgfrmeditor
msgid "Form Editor"
msgstr "Editor formulára"

#: lazarusidestrconsts:rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Dátový súbor formulára  (*.dfm)|*.dfm"

#: lazarusidestrconsts:lisformloaderror
msgid "Form load error"
msgstr "Chyba načítania formulára"

#: lazarusidestrconsts:lisformaterror
msgid "Format error"
msgstr "Chyba formátu"

#: lazarusidestrconsts:dlgpofroms
msgid "Forms"
msgstr "Formuláre"

#: lazarusidestrconsts:lismenuviewforms
msgid "Forms..."
msgstr "Formuláre ..."

#: lazarusidestrconsts:lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Hľa&dať dopredu"

#: lazarusidestrconsts:lisvsrforwardsearch
msgid "Forward Search"
msgstr "Hľadať dopredu"

#: lazarusidestrconsts:fdmorderforwardone
msgid "Forward one"
msgstr "Dopredu o jedno"

#: lazarusidestrconsts:lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr ""

#: lazarusidestrconsts:lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Nenájdený prekladač Free Pascal"

#: lazarusidestrconsts:lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Nenájdené zdrojové kódy FreePascalu"

#: lazarusidestrconsts:lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "Súbor zdrojového kódu FreePascalu"

#: lazarusidestrconsts:lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Adresár zdrojov FreePascal"

#: lazarusidestrconsts:rslanguagefrench
msgid "French"
msgstr "Francúzsky"

#: lazarusidestrconsts:lisfunction
msgid "Function"
msgstr ""

#: lazarusidestrconsts:listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funkcia: pripojiť oddeľovač cesty"

#: lazarusidestrconsts:listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr ""

#: lazarusidestrconsts:listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funkcia: vybrať príponu súboru"

#: lazarusidestrconsts:listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funkcia: vybrať len meno súboru"

#: lazarusidestrconsts:listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funkcia: vybrať meno súboru + príponu"

#: lazarusidestrconsts:listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funkcia: vybrať cestu súboru"

#: lazarusidestrconsts:dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "GPC (GNU Pascal Compiler) kompatibilné"

#: lazarusidestrconsts:lismenuinsertgplnotice
msgid "GPL notice"
msgstr "GPL vyhlásenie"

#: lazarusidestrconsts:lismenuinsertgeneral
msgid "General"
msgstr "Všeobecné"

#: lazarusidestrconsts:lispckeditgeneraloptions
msgid "General Options"
msgstr "Všeobecné voľby"

#: lazarusidestrconsts:srkmecenvironmentoptions
msgid "General environment options"
msgstr "Všeobecné voľby prostredia"

#: lazarusidestrconsts:dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Generovať ladiace informácie pre DBX (pomalší preklad)"

#: lazarusidestrconsts:dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Generovať ladiace informácie pre GDB (Pomalší preklad)"

#: lazarusidestrconsts:dlggprof
msgid "Generate code for gprof"
msgstr "Generovať kód pre gprof"

#: lazarusidestrconsts:dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Generovať kód pre valgrind"

#: lazarusidestrconsts:dlgcogenerate
msgid "Generate:"
msgstr "Generovať:"

#: lazarusidestrconsts:rslanguagegerman
msgid "German"
msgstr "Nemecky"

#: lazarusidestrconsts:dlggetposition
msgid "Get position"
msgstr "Získať pozíciu"

#: lazarusidestrconsts:lispldglobal
msgid "Global"
msgstr "Globálne"

#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr ""

#: lazarusidestrconsts:srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Choď na značku %d"

#: lazarusidestrconsts:srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Choď na editor %d "

#: lazarusidestrconsts:srkmecgotolinenumber
msgid "Go to line number"
msgstr "Choď na riadok číslo"

#: lazarusidestrconsts:liskmgotomarker0
msgid "Go to marker 0"
msgstr "Choď na značku 0"

#: lazarusidestrconsts:liskmgotomarker1
msgid "Go to marker 1"
msgstr "Choď na značku 1"

#: lazarusidestrconsts:liskmgotomarker2
msgid "Go to marker 2"
msgstr "Choď na značku 2"

#: lazarusidestrconsts:liskmgotomarker3
msgid "Go to marker 3"
msgstr "Choď na značku 3"

#: lazarusidestrconsts:liskmgotomarker4
msgid "Go to marker 4"
msgstr "Choď na značku 4"

#: lazarusidestrconsts:liskmgotomarker5
msgid "Go to marker 5"
msgstr "Choď na značku 5"

#: lazarusidestrconsts:liskmgotomarker6
msgid "Go to marker 6"
msgstr "Choď na značku 6"

#: lazarusidestrconsts:liskmgotomarker7
msgid "Go to marker 7"
msgstr "Choď na značku 7"

#: lazarusidestrconsts:liskmgotomarker8
msgid "Go to marker 8"
msgstr "Choď na značku 8"

#: lazarusidestrconsts:liskmgotomarker9
msgid "Go to marker 9"
msgstr "Choď na značku 9"

#: lazarusidestrconsts:srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Choď na vyhovujúcu zátvorku"

#: lazarusidestrconsts:srkmecnexteditor
msgid "Go to next editor"
msgstr "Choď na nasledujúci editor"

#: lazarusidestrconsts:srkmecpreveditor
msgid "Go to prior editor"
msgstr "Choď na predchádzajúci editor"

#: lazarusidestrconsts:liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Choď na editor zdrojových kódov 1"

#: lazarusidestrconsts:liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Choď na editor zdrojových kódov 10"

#: lazarusidestrconsts:liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Choď na editor zdrojových kódov 2"

#: lazarusidestrconsts:liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Choď na editor zdrojových kódov 3"

#: lazarusidestrconsts:liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Choď na editor zdrojových kódov 4"

#: lazarusidestrconsts:liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Choď na editor zdrojových kódov 5"

#: lazarusidestrconsts:liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Choď na editor zdrojových kódov 6"

#: lazarusidestrconsts:liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Choď na editor zdrojových kódov 7"

#: lazarusidestrconsts:liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Choď na editor zdrojových kódov 8"

#: lazarusidestrconsts:liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Choď na editor zdrojových kódov 9"

#: lazarusidestrconsts:srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Choď na direktívu include aktuálneho include súboru"

#: lazarusidestrconsts:listodogoto
msgid "Goto"
msgstr "Chod na"

#: lazarusidestrconsts:srkmecgotoxy
msgid "Goto XY"
msgstr "Choď na XY"

#: lazarusidestrconsts:lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Choď na direktívu include"

#: lazarusidestrconsts:lismenugotoline
msgid "Goto line ..."
msgstr "Choď na riadok ..."

#: lazarusidestrconsts:lisuegotoline
msgid "Goto line :"
msgstr "Choď na riadok:"

#: lazarusidestrconsts:uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Choď na ďalšiu záložku"

#: lazarusidestrconsts:uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Choď na predchádzajúcu záložku"

#: lazarusidestrconsts:listodolistgotoline
msgid "Goto selected source line"
msgstr "Choď na zvolený riadok zdrojového kódu"

#: lazarusidestrconsts:srkmgrabkey
msgid "Grab key"
msgstr "Zachytiť klávesu"

#: lazarusidestrconsts:srkmgrabsecondkey
msgid "Grab second key"
msgstr "Zachytiť druhú klávesu"

#: lazarusidestrconsts:dlggrabbercolor
msgid "Grabber color"
msgstr "Farba zachytávača"

#: lazarusidestrconsts:dlgenvgrid
msgid "Grid"
msgstr "Mriežka"

#: lazarusidestrconsts:dlggridcolor
msgid "Grid color"
msgstr "Farba mriežky"

#: lazarusidestrconsts:dlggridx
msgid "Grid size X"
msgstr "Veľkosť mriežky X"

#: lazarusidestrconsts:dlggridy
msgid "Grid size Y"
msgstr "Veľkosť mriežky Y"

#: lazarusidestrconsts:lisgroup
msgid "Group"
msgstr ""

#: lazarusidestrconsts:dlggroupundo
msgid "Group Undo"
msgstr "Skupinové späť"

#: lazarusidestrconsts:lisgrowtolarges
msgid "Grow to Largest"
msgstr ""

#: lazarusidestrconsts:srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Odhadni zle umiestnený $IFDEF"

#: lazarusidestrconsts:lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Odhadni zle umiestnený IFDEF/ENDIF"

#: lazarusidestrconsts:lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Odhadni neuzavretý blok"

#: lazarusidestrconsts:dlgenvlguidelines
msgid "Guide lines"
msgstr "Pomocné čiary"

#: lazarusidestrconsts:dlgguttercolor
msgid "Gutter color"
msgstr "Farba guttera"

#: lazarusidestrconsts:dlggutterwidth
msgid "Gutter width"
msgstr "Šírka guttera"

#: lazarusidestrconsts:lisccohintmsg
msgid "HINT: "
msgstr "RADA:"

#: lazarusidestrconsts:dlghalfpagescroll
msgid "Half page scroll"
msgstr "Polovičný posun stránky"

#: lazarusidestrconsts:lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Obslúžiť udalosť OnClick"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Obslúžené"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Obslúžené debugerom"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Obslúžené programom"

#: lazarusidestrconsts:srvk_hanja
msgid "Hanja"
msgstr "Hanja"

#: lazarusidestrconsts:lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Má procedúru Register"

#: lazarusidestrconsts:lisheadercommentforclass
msgid "Header comment for class"
msgstr "Hlavičkový komentár pre triedu"

#: lazarusidestrconsts:dlgheapsize
msgid "Heap Size"
msgstr "Veľkosť haldy"

#: lazarusidestrconsts:rslanguagehebrew
msgid "Hebrew"
msgstr "Hebrejsky"

#: lazarusidestrconsts:dlgheightpos
msgid "Height:"
msgstr "Výška:"

#: lazarusidestrconsts:srvk_help
msgid "Help"
msgstr "Pomoc"

#: lazarusidestrconsts:lishlpoptshelpoptions
msgid "Help Options"
msgstr "Voľby pomoci"

#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "Pomoc pre správu FreePascal Compiler"

#: lazarusidestrconsts:srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Príkazu menu Help"

#: lazarusidestrconsts:lishelpselectordialog
msgid "Help selector"
msgstr "Výber pomoci"

#: lazarusidestrconsts:lishexadecimal
msgid "Hexadecimal"
msgstr ""

#: lazarusidestrconsts:dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Pri spustení skryť okno IDE"

#: lazarusidestrconsts:uemhighlighter
msgid "Highlighter"
msgstr "Zvýrazňovač"

#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Rada: Skontrolujte, či dva balíčky neobsahujú jednotku s rovnakým menom."

#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Rada: Funkcia \"Vytvoriť Resourcestring\" očakáva reťazcovú konštantu.%sProsím vyberte len reťazcový výraz a skúste znova."

#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Rada: Funkcia \"Vytvoriť ResourceString\" očakáva reťazcovú konštantu.%sProsím vyberte výraz a skúste znova."

#: lazarusidestrconsts:dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr "Rada: kliknite na príkaz, ktorý chcete upraviť"

#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Rada: cestu prekladača môžete nastaviť v Prostredie->Voľby prostredia->Súbory->Cesta prekaldača"

#: lazarusidestrconsts:dlgpalhints
msgid "Hints for component palette"
msgstr "Rady pre paletu komponentov"

#: lazarusidestrconsts:dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Rady pre základné tlačítka (Otvoriť, Uložiť, ...)"

#: lazarusidestrconsts:srvk_home
msgid "Home"
msgstr ""

#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home posúva na najbližší začiatok"

#: lazarusidestrconsts:lishorizontal
msgid "Horizontal"
msgstr "Vodorovne"

#: lazarusidestrconsts:dlggridxhint
msgid "Horizontal grid step size"
msgstr "Vodorovná veľkosť kroku mriežky"

#: lazarusidestrconsts:dlghostapplication
msgid "Host application"
msgstr "Hosťovská aplikácia"

#: lazarusidestrconsts:uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Vravel som. Zatiaľ neimplementované"

#: lazarusidestrconsts:lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts:liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts:lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrácia IDE"

#: lazarusidestrconsts:lisideintf
msgid "IDE Interface"
msgstr "Rozhranie IDE"

#: lazarusidestrconsts:lisideoptions
msgid "IDE Options:"
msgstr "Voľby IDE:"

#: lazarusidestrconsts:lismenuideinternals
msgid "IDE internals"
msgstr "IDE interné"

#: lazarusidestrconsts:lissamideisbusy
msgid "IDE is busy"
msgstr "IDE pracuje"

#: lazarusidestrconsts:uepins
msgid "INS"
msgstr ""

#: lazarusidestrconsts:liscodetoolsoptsidentifier
msgid "Identifier"
msgstr "Identifikátor"

#: lazarusidestrconsts:lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Identifikátor začína s ..."

#: lazarusidestrconsts:dlgedidcomlet
msgid "Identifier completion"
msgstr "Dokončovanie identifikátora"

#: lazarusidestrconsts:lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Identifikátor obsahuje ..."

#: lazarusidestrconsts:lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Dĺžka identifikátora:"

#: lazarusidestrconsts:dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Pravidlá identifikátora"

#: lazarusidestrconsts:lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Predpona identifikátora:"

#: lazarusidestrconsts:lisfriidentifier
msgid "Identifier: %s"
msgstr "Identifikátor: %s"

#: lazarusidestrconsts:liscodetoolsdefsif
msgid "If"
msgstr ""

#: lazarusidestrconsts:uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Ak nám chcete pomôcť implementovať túto vlastnosť, pošlite email na lazarus@miraclec.com"

#: lazarusidestrconsts:liscodetoolsdefsifdef
msgid "IfDef"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsifndef
msgid "IfNDef"
msgstr ""

#: lazarusidestrconsts:dlgignoreverb
msgid "Ignore"
msgstr "Ignorovať"

#: lazarusidestrconsts:lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorovať medzery"

#: lazarusidestrconsts:lisignoreall
msgid "Ignore all"
msgstr "Ignorovať všetko"

#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorovať niekoľko znakov medzery"

#: lazarusidestrconsts:lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignorovať a pokračovať"

#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Ignorovať a uložiť balíček teraz"

#: lazarusidestrconsts:lisignorebinaries
msgid "Ignore binaries"
msgstr "Ignorovať binárky"

#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorovať rozdiely koncov riadkov (e.g. #10 = #13#10)"

#: lazarusidestrconsts:lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignorovať zmeny disku"

#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorovať prázdne riadky pri pridávaní a odstraňovaní"

#: lazarusidestrconsts:lisignoremissingfile
msgid "Ignore missing file"
msgstr "Ignorovať chýbajúci súbor"

#: lazarusidestrconsts:lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorovať medzery (mimo znakov nového riadku)"

#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorovať medzery na konci riadku"

#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorovať medzery na začiatku riadku"

#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorovať tieto výnimky"

#: lazarusidestrconsts:lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Ignorovať použitie TForm ako predka"

#: lazarusidestrconsts:srkmecimestr
msgid "Ime Str"
msgstr ""

#: lazarusidestrconsts:lisimportlist
msgid "Import list"
msgstr ""

#: lazarusidestrconsts:dlginfrontofmethods
msgid "In front of methods"
msgstr "Pred metódy"

#: lazarusidestrconsts:lispckoptsinclude
msgid "Include"
msgstr ""

#: lazarusidestrconsts:dlgassertcode
msgid "Include Assertion Code"
msgstr "Zahrnúť kód asertion"

#: lazarusidestrconsts:dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Súbory include (-Fi)"

#: lazarusidestrconsts:lisincludefilter
msgid "Include Filter"
msgstr "Zahŕňací filter"

#: lazarusidestrconsts:rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr "Do preloženého programu zahrnúť informácie o verzii"

#: lazarusidestrconsts:lispkgfiletypeinclude
msgid "Include file"
msgstr "Súbor include"

#: lazarusidestrconsts:lisincludepaths
msgid "Include paths"
msgstr "Cesty Include"

#: lazarusidestrconsts:lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Vrátane podadresárov"

#: lazarusidestrconsts:dlgincludesystemvariables
msgid "Include system variables"
msgstr "Vrátane systémových premenných"

#: lazarusidestrconsts:lisuidincludedby
msgid "Included by:"
msgstr "Vložil:"

#: lazarusidestrconsts:lismenuincrementalfind
msgid "Incremental Find"
msgstr "Narastajúce hľadanie"

#: lazarusidestrconsts:srkmecblockindent
msgid "Indent block"
msgstr "Zväčšiť odsadenie bloku"

#: lazarusidestrconsts:dlgindentcodeto
msgid "Indent code to"
msgstr "Odsadiť kód na"

#: lazarusidestrconsts:lismenuindentselection
msgid "Indent selection"
msgstr "Zväčšiť odsadenie"

#: lazarusidestrconsts:lisindex
msgid "Index"
msgstr ""

#: lazarusidestrconsts:rslanguageindonesian
msgid "Indonesian"
msgstr "Indonézsky"

#: lazarusidestrconsts:lisinformationaboutunit
msgid "Information about %s"
msgstr "Informácie o %s"

#: lazarusidestrconsts:liscmplstinheritance
msgid "Inheritance"
msgstr "Dedičnosť"

#: lazarusidestrconsts:dlgcoinherited
msgid "Inherited"
msgstr "Zdedené"

#: lazarusidestrconsts:srvk_insert
msgid "Insert"
msgstr ""

#: lazarusidestrconsts:liskminsertifdef
msgid "Insert $IFDEF"
msgstr "Vložiť $IFDEF"

#: lazarusidestrconsts:lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Vložiť $IFDEF..."

#: lazarusidestrconsts:srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Vložiť kľúčové slovo CVS Author"

#: lazarusidestrconsts:srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Vložiť kľúčové slovo CVS  Date"

#: lazarusidestrconsts:srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Vložiť kľúčové slovo CVS Header"

#: lazarusidestrconsts:srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Vložiť kľúčové slovo CVS ID"

#: lazarusidestrconsts:srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Vložiť kľúčové slovo CVS Log"

#: lazarusidestrconsts:srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Vložiť kľúčové slovo CVS Name"

#: lazarusidestrconsts:srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Vložiť kľúčové slovo CVS Revision"

#: lazarusidestrconsts:srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Vložiť kľúčové slovo CVS Source"

#: lazarusidestrconsts:srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Vložiť položku ChangeLog"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr ""

#: lazarusidestrconsts:lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Vložiť zo šablóny ..."

#: lazarusidestrconsts:srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Vložiť vyhlásenie GPL"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr ""

#: lazarusidestrconsts:srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Vložiť vyhlásenie LGPL"

#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr ""

#: lazarusidestrconsts:lisctinsertmacro
msgid "Insert Macro"
msgstr "Vložiť makro"

#: lazarusidestrconsts:srkmecinsertmode
msgid "Insert Mode"
msgstr "Režim vkladania"

#: lazarusidestrconsts:lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Vložiť novú položku (za)"

#: lazarusidestrconsts:lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Vložiť novú položku (pred)"

#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Vložiť šablónu"

#: lazarusidestrconsts:listddinserttodo
msgid "Insert ToDo"
msgstr "Vložiť úlohu"

#: lazarusidestrconsts:ueminserttodo
msgid "Insert Todo"
msgstr "Vložiť &ToDo"

#: lazarusidestrconsts:srkmecinsertguid
msgid "Insert a GUID"
msgstr "Vložiť GUID"

#: lazarusidestrconsts:liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Vložiť odkaz ..."

#: lazarusidestrconsts:lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Vložiť podľa abecedy"

#: lazarusidestrconsts:liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Vložiť formátovaciu značku pre tučné"

#: lazarusidestrconsts:liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Vložiť formátovaciu značku pre kód"

#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Vložiť v závislosti na kontexte"

#: lazarusidestrconsts:srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Vložiť aktuálny dátum a čas"

#: lazarusidestrconsts:srkmecinsertusername
msgid "Insert current username"
msgstr "Vložiť aktuálne používateľské meno"

#: lazarusidestrconsts:liskminsertdateandtime
msgid "Insert date and time"
msgstr "Vložiť dátum a čas"

#: lazarusidestrconsts:lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Vložiť z mapy znakov"

#: lazarusidestrconsts:srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Vložiť z mapy znakov"

#: lazarusidestrconsts:liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Vložiť formátovaciu značku pre kurzívu"

#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Vložiť upravené GPL vyhlásenie"

#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Vložiť podriadený uzol"

#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Vložiť uzol pod"

#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Vložiť značku formátovania odseku"

#: lazarusidestrconsts:liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Vložiť formátovaciu značku poznámky"

#: lazarusidestrconsts:dlginsspaceafter
msgid "Insert space after"
msgstr "Vložiť medzeru za"

#: lazarusidestrconsts:dlginsspacefront
msgid "Insert space in front of"
msgstr "Vložiť medzeru pred"

#: lazarusidestrconsts:lismenuinserttext
msgid "Insert text"
msgstr "Vložiť text"

#: lazarusidestrconsts:liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Vložiť formátovaciu značku pre podčiarknuté"

#: lazarusidestrconsts:liskminsertusername
msgid "Insert username"
msgstr "Vložiť meno používateľa"

#: lazarusidestrconsts:liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Vložiť formátovaciu značku var"

#: lazarusidestrconsts:liskminspect
msgid "Inspect"
msgstr "Skontrolovať"

#: lazarusidestrconsts:lismenuinspect
msgid "Inspect ..."
msgstr "Skontrolovať ..."

#: lazarusidestrconsts:lispckeditinstall
msgid "Install"
msgstr "Inštalovať"

#: lazarusidestrconsts:lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Inštalovať pri ďalšom štarte"

#: lazarusidestrconsts:lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Inštalovať balíček do IDE"

#: lazarusidestrconsts:lisinstallselection
msgid "Install selection"
msgstr "Nainštalovať výber"

#: lazarusidestrconsts:lisinstallationfailed
msgid "Installation failed"
msgstr "Inštalácia zlyhala"

#: lazarusidestrconsts:lispckexplinstalled
msgid "Installed"
msgstr "Nainštalované"

#: lazarusidestrconsts:lisinstalledpackages
msgid "Installed Packages"
msgstr "Nainštalované balíčky"

#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Inštalácia balíčka %s automaticky nainštaluje balíček:"

#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Inštalácia balíčka %s automaticky nainštaluje balíčky:"

#: lazarusidestrconsts:lisdebugoptionsfrminterface
msgid "Interface"
msgstr "Rozhranie"

#: lazarusidestrconsts:listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Interná chyba prekladača! (%d)"

#: lazarusidestrconsts:dlgintvinsec
msgid "Interval in secs"
msgstr "Interval v sekundách"

#: lazarusidestrconsts:lisinvalidoff
msgid "Invalid (Off)"
msgstr ""

#: lazarusidestrconsts:lisinvalidon
msgid "Invalid (On)"
msgstr ""

#: lazarusidestrconsts:lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Neplatný typ predka"

#: lazarusidestrconsts:lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Neplatný kruh"

#: lazarusidestrconsts:lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Neplatné meno triedy"

#: lazarusidestrconsts:lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Neplatné meno súboru prekladača"

#: lazarusidestrconsts:lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Neplatný vylučovací filter"

#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Neplatný adresár zdrojových kódov FreePascal"

#: lazarusidestrconsts:lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Neplatný identifikátor"

#: lazarusidestrconsts:lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Neplatný zahrňovací filter"

#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Neplatná Min-Max verzia"

#: lazarusidestrconsts:lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Neplatný balíček"

#: lazarusidestrconsts:lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Neplatné meno balíčka"

#: lazarusidestrconsts:lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Neplatný identifikátor Pascalu"

#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Neplatný výber ResourceString"

#: lazarusidestrconsts:lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Neplatný testovací adresár"

#: lazarusidestrconsts:lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Neplatné meno jednotky"

#: lazarusidestrconsts:lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Neplatné meno jednotky: %s"

#: lazarusidestrconsts:lisinvalidcommand
msgid "Invalid command"
msgstr "Neplatný príkaz"

#: lazarusidestrconsts:lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Neplatný prekladač"

#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Neplatné meno prekladača"

#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Neplatná trieda komponentu"

#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Neplatné meno debugera"

#: lazarusidestrconsts:lisinvaliddelete
msgid "Invalid delete"
msgstr "Neplatné mazanie"

#: lazarusidestrconsts:lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Neplatný cieľový adresár"

#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Neplatný výraz.%sRada: Funkcia \"Vytvoriť Resourcestring\" očakáva reťazcovú konštantu v jednom súbore. Prosím vyberte výraz a skúste znova."

#: lazarusidestrconsts:lisa2pinvalidfile
msgid "Invalid file"
msgstr "Neplatný súbor"

#: lazarusidestrconsts:lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Neplatná prípona súboru"

#: lazarusidestrconsts:lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Neplatné meno súboru"

#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Neplatné meno súboru make"

#: lazarusidestrconsts:lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Neplatná maximálna verzia"

#: lazarusidestrconsts:lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Neplatná minimálna verzia"

#: lazarusidestrconsts:lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Neplatný viacnásobný výber"

#: lazarusidestrconsts:liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Neplatná voľba na pozícii %d: \"%s\""

#: lazarusidestrconsts:lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Neplatný ID balíčka: %s%s%s"

#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Neplatná prípona súboru balíčka"

#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Neplatné meno súboru balíčka"

#: lazarusidestrconsts:lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Neplatné meno balíčka"

#: lazarusidestrconsts:lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Neplatný typ balíčka"

#: lazarusidestrconsts:lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Neplatné meno balíčka"

#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Neplatný rodič"

#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Neplatný rodičovský uzol"

#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Neplatné meno jednotky pascal"

#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Neplatný predchádzajúci uzol"

#: lazarusidestrconsts:lisinvalidprocname
msgid "Invalid proc name"
msgstr "Neplatné meno procedúry"

#: lazarusidestrconsts:lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Neplatné meno súboru projektu"

#: lazarusidestrconsts:lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Neplatná cesta hľadania"

#: lazarusidestrconsts:lisinvalidselection
msgid "Invalid selection"
msgstr "Neplatný výber"

#: lazarusidestrconsts:lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Neplatné meno jednotky"

#: lazarusidestrconsts:lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Neplatné meno jednotky"

#: lazarusidestrconsts:lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Neplatné meno premennej"

#: lazarusidestrconsts:lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Neplatná verzia"

#: lazarusidestrconsts:ueminvertassignment
msgid "Invert Assignment"
msgstr "Otočiť priradenie"

#: lazarusidestrconsts:srkmecinvertassignment
msgid "Invert assignment"
msgstr "Otočiť priradenie"

#: lazarusidestrconsts:srvk_irregular
msgid "Irregular "
msgstr "Neplatné"

#: lazarusidestrconsts:lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""

#: lazarusidestrconsts:rslanguageitalian
msgid "Italian"
msgstr "Taliansky"

#: lazarusidestrconsts:dlgedital
msgid "Italic"
msgstr "Šikmé"

#: lazarusidestrconsts:dlgoiitemheight
msgid "Item height"
msgstr "Výška položky"

#: lazarusidestrconsts:lisjitform
msgid "JIT Form"
msgstr "JIT Formulár"

#: lazarusidestrconsts:rslanguagejapanese
msgid "Japanese"
msgstr "Japonsky"

#: lazarusidestrconsts:lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Skoč na výber"

#: lazarusidestrconsts:lismenujumpback
msgid "Jump back"
msgstr "Skočiť späť"

#: lazarusidestrconsts:lismenujumpforward
msgid "Jump forward"
msgstr "Skočiť dopredu"

#: lazarusidestrconsts:lismenujumpto
msgid "Jump to"
msgstr "Skoč na"

#: lazarusidestrconsts:lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Skoč na ďalšiu záložku"

#: lazarusidestrconsts:lismenujumptonexterror
msgid "Jump to next error"
msgstr "Skoč na ďalšiu chybu"

#: lazarusidestrconsts:lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Skoč na predchádzajúcu záložku"

#: lazarusidestrconsts:lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Skoč na predchádzajúcu chybu"

#: lazarusidestrconsts:dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Skákanie (tj. Skákanie na metódy)"

#: lazarusidestrconsts:srvk_junja
msgid "Junja"
msgstr "Junja"

#: lazarusidestrconsts:srvk_kana
msgid "Kana"
msgstr "Kana"

#: lazarusidestrconsts:liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Ponechať všetky textové súbory"

#: lazarusidestrconsts:dlgkeepcaretx
msgid "Keep caret X position"
msgstr ""

#: lazarusidestrconsts:dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Ponechať niektoré premenné v registroch"

#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Ponechať všetky súbory vyhovujúce filtru"

#: lazarusidestrconsts:liskeepname
msgid "Keep name"
msgstr "Zachovať meno"

#: lazarusidestrconsts:dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Zachovať poradie procedúr"

#: lazarusidestrconsts:liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Ponechať a pokračovať"

#: lazarusidestrconsts:lisedtexttoolkey
msgid "Key"
msgstr "Kláves"

#: lazarusidestrconsts:srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Kláves (alebo kombinácia dvoch)"

#: lazarusidestrconsts:dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Schéma mapovania klávesnice"

#: lazarusidestrconsts:dlgkeymapping
msgid "Key Mappings"
msgstr "Mapovanie kláves"

#: lazarusidestrconsts:dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Chyba mapovania kláves"

#: lazarusidestrconsts:liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Schéma rozloženia klávesnice"

#: lazarusidestrconsts:liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Kľúčové slovo"

#: lazarusidestrconsts:dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Pravidlá kľúčových slov"

#: lazarusidestrconsts:lislcl
msgid "LCL"
msgstr "LCL"

#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Špecifické voľby rozhrania LCL:"

#: lazarusidestrconsts:lislclwidgettype
msgid "LCL Widget Type"
msgstr "Typ LCL Widgetu"

#: lazarusidestrconsts:lislazbuildlclinterface
msgid "LCL interface"
msgstr "Rozhranie LCL"

#: lazarusidestrconsts:lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Chýba cesta k jednotkám LCL"

#: lazarusidestrconsts:lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - textový formulár Lazarus"

#: lazarusidestrconsts:lislfmfile
msgid "LFM file"
msgstr "LFM súbor"

#: lazarusidestrconsts:lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "LFM súbor poškodený"

#: lazarusidestrconsts:lislfmfilenotfound
msgid "LFM file not found"
msgstr "LFM súbor nenájdený"

#: lazarusidestrconsts:lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "LGPL vyhlásenie"

#: lazarusidestrconsts:lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus resource"

#: lazarusidestrconsts:dlgenvlanguage
msgid "Language"
msgstr "Jazyk"

#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Výnimky jazyka"

#: lazarusidestrconsts:rslanguageoptions
msgid "Language options"
msgstr "Voľby jazyka"

#: lazarusidestrconsts:rslanguageselection
msgid "Language selection:"
msgstr "Výber jazyka:"

#: lazarusidestrconsts:dlgcdtlast
msgid "Last"
msgstr "Posledný"

#: lazarusidestrconsts:dlglast
msgid "Last (i.e. at end of source)"
msgstr "Posledný (tj. na konci kódu)"

#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Spúšťanie aplikácie"

#: lazarusidestrconsts:lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Neplatné spúšťanie aplikácie"

#: lazarusidestrconsts:lislaunchingcmdline
msgid "Launching target command line"
msgstr "Spustenie cieľového príkazového riadku"

#: lazarusidestrconsts:lispkgmanglazarus
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts:lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Nastavenia plochy Lazarus"

#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Adresár Lazarus"

#: lazarusidestrconsts:lislazarusfile
msgid "Lazarus File"
msgstr "Súbor Lazarus"

#: lazarusidestrconsts:lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"

#: lazarusidestrconsts:lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"

#: lazarusidestrconsts:lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Informačný súbor projektu Lazarus"

#: lazarusidestrconsts:lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Konfiguračný adresár Lazarus"

#: lazarusidestrconsts:lislazarusdirectory
msgid "Lazarus directory"
msgstr "Adresár Lazarus"

#: lazarusidestrconsts:dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Adresár Lazarus (predvolený pre všetky projekty)"

#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Adresár Lazarus \"%s\" nenájdený."

#: lazarusidestrconsts:lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Adresár Lazarus nenájdený"

#: lazarusidestrconsts:lislazarusform
msgid "Lazarus form"
msgstr "Formulár Lazarus"

#: lazarusidestrconsts:lislazarusinclude
msgid "Lazarus include file"
msgstr "Include súbor Lazarus"

#: lazarusidestrconsts:lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Identifikátor jazyka Lazarus (napr. en, de, sk)"

#: lazarusidestrconsts:lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Meno jazyka Lazarus (napr. english, slovak)"

#: lazarusidestrconsts:lislazaruspackage
msgid "Lazarus package"
msgstr "Balíček Lazarus"

#: lazarusidestrconsts:lislazarusproject
msgid "Lazarus project"
msgstr "Projekt Lazarus"

#: lazarusidestrconsts:lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Zdrojový kód Lazarus"

#: lazarusidestrconsts:lislazarusunit
msgid "Lazarus unit"
msgstr "Jednotka Lazarus"

#: lazarusidestrconsts:lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Nechajte prázdne pre predvolený .po súbor"

#: lazarusidestrconsts:srvk_left
msgid "Left"
msgstr ""

#: lazarusidestrconsts:lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ľavé ukotvenie"

#: lazarusidestrconsts:lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Ľavý·okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·vľavo od prvku."

#: lazarusidestrconsts:lisleftsides
msgid "Left sides"
msgstr "Ľavé strany"

#: lazarusidestrconsts:lisleftspaceequally
msgid "Left space equally"
msgstr ""

#: lazarusidestrconsts:dlgleftpos
msgid "Left:"
msgstr "Vľavo:"

#: lazarusidestrconsts:dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Úroveň 0 (bez zvláštnych optimalizácií)"

#: lazarusidestrconsts:dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Úroveň 1 (rýchle a priateľské debugeru)"

#: lazarusidestrconsts:dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr "Úroveň 2 (Úroveň 1 + rýchle optimalizácie)"

#: lazarusidestrconsts:dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Úroveň 3 (Úroveň 2 + pomalé optimalizácie)"

#: lazarusidestrconsts:lislevels
msgid "Levels"
msgstr "Úrovne"

#: lazarusidestrconsts:dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Knižnice (-Fl):"

#: lazarusidestrconsts:lispckoptslibrary
msgid "Library"
msgstr "Knižnica"

#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgstr "Knižnica%sKnižnica Free Pascal (.dll vo Windows, .so v Linuxe, .dylib v MacOS X). Súbor zdrojového kódu knižnice je automaticky spravovaný Lazarom."

#: lazarusidestrconsts:lispckoptslicense
msgid "License:"
msgstr "Licencia:"

#: lazarusidestrconsts:lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr ""

#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Obmedziť počet riadkov na"

#: lazarusidestrconsts:listodolline
msgid "Line"
msgstr "Riadok"

#: lazarusidestrconsts:dlglinesplitting
msgid "Line Splitting"
msgstr "Rozdeľovanie riadkov"

#: lazarusidestrconsts:srkmeclineselect
msgid "Line selection mode"
msgstr "Riadkový režim výberu"

#: lazarusidestrconsts:lislinelength
msgid "Line/Length"
msgstr ""

#: lazarusidestrconsts:lissortsellines
msgid "Lines"
msgstr "Riadky"

#: lazarusidestrconsts:lisuidlines
msgid "Lines:"
msgstr "Riadky:"

#: lazarusidestrconsts:dlglinksmart
msgid "Link Smart"
msgstr ""

#: lazarusidestrconsts:dlglinklibraries
msgid "Link Style:"
msgstr ""

#: lazarusidestrconsts:lispckoptslinker
msgid "Linker"
msgstr "Linkovač"

#: lazarusidestrconsts:dlgcolinking
msgid "Linking"
msgstr "Linkovanie"

#: lazarusidestrconsts:liscmplstlist
msgid "List"
msgstr "Zoznam"

#: lazarusidestrconsts:rslanguagelithuanian
msgid "Lithuanian"
msgstr "Litovsky"

#: lazarusidestrconsts:dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Načítať nastavenia plochy zo súboru"

#: lazarusidestrconsts:lisiecoloadfromfile
msgid "Load from file"
msgstr "Načítať zo súboru"

#: lazarusidestrconsts:dlgcoloadsave
msgid "Load/Save"
msgstr "Otvoriť/Uložiť"

#: lazarusidestrconsts:lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Načítané balíčky:"

#: lazarusidestrconsts:lisloadingfailed
msgid "Loading %s failed."
msgstr "načítanie %s zlyhalo."

#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Načítanie balíčka %s nahradí balíček %s%szo súboru %s.%sStarý balíček je upravený.%s%sUložiť starý balíček %s?"

#: lazarusidestrconsts:dlgrunolocal
msgid "Local"
msgstr "Lokálne"

#: lazarusidestrconsts:lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Lokálne premenné"

#: lazarusidestrconsts:lislocals
msgid "Locals"
msgstr ""

#: lazarusidestrconsts:lislogo
msgid "Logo"
msgstr "Logo"

#: lazarusidestrconsts:lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Výber na malé písmená"

#: lazarusidestrconsts:dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Malé písmená, prvé veľké"

#: lazarusidestrconsts:liskmmacosx
msgid "Mac OS X"
msgstr "Mac OS X"

#: lazarusidestrconsts:lisedtexttoolmacros
msgid "Macros"
msgstr "Makrá"

#: lazarusidestrconsts:dlgmainmenu
msgid "Main Menu"
msgstr "Hlavné menu"

#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Základná jednotka obsahuje Application.CreateForm"

#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Základná jednotka obsahuje Application.Title"

#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Základná jednotka má v sekcii uses všetky jednotky projektu"

#: lazarusidestrconsts:lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "Základná jednotka je zdrojový kód Pascalu"

#: lazarusidestrconsts:lispckoptsmajor
msgid "Major"
msgstr "Hlavná"

#: lazarusidestrconsts:rsmajorrevision
msgid "Major revision:"
msgstr "Hlavná rev.:"

#: lazarusidestrconsts:lismakeexe
msgid "Make Executable"
msgstr "Urobiť spustiteľné"

#: lazarusidestrconsts:lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Vytvoriť ResourceString ..."

#: lazarusidestrconsts:lismakeresourcestring
msgid "Make ResourceString"
msgstr "Vytvoriť ResourceString"

#: lazarusidestrconsts:lismakenotfound
msgid "Make not found"
msgstr "Make nenájdený"

#: lazarusidestrconsts:dlgmakepath
msgid "Make path"
msgstr "Cesta make"

#: lazarusidestrconsts:srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Vytvoriť ResourceString"

#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Manuálny preklad (nikdy automaticky)"

#: lazarusidestrconsts:dlgmargingutter
msgid "Margin and gutter"
msgstr "Okraj a gutter"

#: lazarusidestrconsts:dlgmarkercolor
msgid "Marker color"
msgstr "Farba markera"

#: lazarusidestrconsts:lissmatches
msgid "Matches"
msgstr "Vhovujúce"

#: lazarusidestrconsts:lismaxs
msgid "Max %d"
msgstr ""

#: lazarusidestrconsts:dlgmaxlinelength
msgid "Max line length:"
msgstr "Maximálna dĺžka riadku:"

#: lazarusidestrconsts:dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maximum posledných súborov"

#: lazarusidestrconsts:dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maximum posledných projektov"

#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Disahnuté maximum nástrojov"

#: lazarusidestrconsts:lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maximálna Verzia (voliteľné):"

#: lazarusidestrconsts:lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maximálna verzia"

#: lazarusidestrconsts:dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximum počítadla"

#: lazarusidestrconsts:lismemorydump
msgid "Memory Dump"
msgstr ""

#: lazarusidestrconsts:srvk_menu
msgid "Menu"
msgstr "Menu"

#: lazarusidestrconsts:lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor menu"

#: lazarusidestrconsts:lismenuviewmessages
msgid "Messages"
msgstr "Správy"

#: lazarusidestrconsts:dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Pravidlá vkladania metód"

#: lazarusidestrconsts:dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr "Minimalizovať všetko alebo minimalizovať hlavné okno"

#: lazarusidestrconsts:lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimálna verzia (voliteľné)"

#: lazarusidestrconsts:lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimálna verzia:"

#: lazarusidestrconsts:lispckoptsminor
msgid "Minor"
msgstr "Nižšia"

#: lazarusidestrconsts:rsminorrevision
msgid "Minor revision:"
msgstr "Nižšia rev."

#: lazarusidestrconsts:fdmmirrorhorizontal
msgid "Mirror horizontal"
msgstr "Preklopiť vodorovne"

#: lazarusidestrconsts:fdmmirrorvertical
msgid "Mirror vertical"
msgstr "Preklopiť zvislo"

#: lazarusidestrconsts:dlgenvmisc
msgid "Miscellaneous"
msgstr "Rôzne"

#: lazarusidestrconsts:lismissingevents
msgid "Missing Events"
msgstr "Chýbajúce udalosti"

#: lazarusidestrconsts:lismissingpackages
msgid "Missing Packages"
msgstr "Chýbajúce balíčky"

#: lazarusidestrconsts:lismissingidentifiers
msgid "Missing identifiers"
msgstr "Chýbajúce identifikátory"

#: lazarusidestrconsts:lisccomissingunit
msgid "Missing unit"
msgstr "Chýbajúca jednotka"

#: lazarusidestrconsts:dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Zmiešané metódy a vlastnosti"

#: lazarusidestrconsts:srvk_modechange
msgid "Mode Change"
msgstr "Zmena módu"

#: lazarusidestrconsts:uemodified
msgid "Modified"
msgstr "Zmenené"

#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr "Modifikované LGPL vyhlásenie"

#: lazarusidestrconsts:lispckeditmodified
msgid "Modified: %s"
msgstr "Zmenené: %s"

#: lazarusidestrconsts:listodolfile
msgid "Module"
msgstr "Modul"

#: lazarusidestrconsts:lismore
msgid "More"
msgstr ""

#: lazarusidestrconsts:lispckeditmore
msgid "More ..."
msgstr "Viac ..."

#: lazarusidestrconsts:srvk_lbutton
msgid "Mouse Button Left"
msgstr "Ľavé tlačítko myši"

#: lazarusidestrconsts:srvk_mbutton
msgid "Mouse Button Middle"
msgstr "Stredné tlačítko myši"

#: lazarusidestrconsts:srvk_rbutton
msgid "Mouse Button Right"
msgstr "Pravé tlačítko myši"

#: lazarusidestrconsts:dlgmouselinks
msgid "Mouse links"
msgstr "Odkazy myšou"

#: lazarusidestrconsts:lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Posunúť dole (alebo vpravo)"

#: lazarusidestrconsts:uemmoveeditorleft
msgid "Move Editor Left"
msgstr "Okno editora vľavo"

#: lazarusidestrconsts:uemmoveeditorleftmost
msgid "Move Editor Leftmost"
msgstr "Okno editora úplne vľavo"

#: lazarusidestrconsts:uemmoveeditorright
msgid "Move Editor Right"
msgstr "Okno editora vpravo"

#: lazarusidestrconsts:uemmoveeditorrightmost
msgid "Move Editor Rightmost"
msgstr "Okno editora úplne vpravo"

#: lazarusidestrconsts:lismovepage
msgid "Move Page ..."
msgstr "Presunúť stranu ..."

#: lazarusidestrconsts:lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Posunúť hore (alebo vľavo)"

#: lazarusidestrconsts:lisdsgorderbackone
msgid "Move component one back"
msgstr "Presunúť komponent o jeden vzad"

#: lazarusidestrconsts:lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Presunúť komponent o jeden vpred"

#: lazarusidestrconsts:lisdsgordermovetoback
msgid "Move component to back"
msgstr "Presunúť komponent dozadu"

#: lazarusidestrconsts:lisdsgordermovetofront
msgid "Move component to front"
msgstr "Presunúť komponent dopredu"

#: lazarusidestrconsts:srkmecpagedown
msgid "Move cursor down one page"
msgstr "Posunúť kurzor o stranu dole"

#: lazarusidestrconsts:srkmecpageleft
msgid "Move cursor left one page"
msgstr "Posunúť kurzor o stranu vľavo"

#: lazarusidestrconsts:srkmecpageright
msgid "Move cursor right one page"
msgstr "Posunúť kurzor o stranu vpravo"

#: lazarusidestrconsts:srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Posunúť kurzor o na úplný začiatok"

#: lazarusidestrconsts:srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Posunúť kurzor na úplný koniec"

#: lazarusidestrconsts:srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Posunúť kurzor na spodok strany"

#: lazarusidestrconsts:srkmeclineend
msgid "Move cursor to line end"
msgstr "Posunúť kurzor na koniec riadku"

#: lazarusidestrconsts:srkmeclinestart
msgid "Move cursor to line start"
msgstr "Posunúť kurzor na začiatok riadku"

#: lazarusidestrconsts:srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Posunúť kurzor na začiatok strany"

#: lazarusidestrconsts:srkmecpageup
msgid "Move cursor up one page"
msgstr "Posunúť kurzor o jednu stranu hore"

#: lazarusidestrconsts:srkmecwordleft
msgid "Move cursor word left"
msgstr "Posunúť kurzor o slovo vľavo"

#: lazarusidestrconsts:srkmecwordright
msgid "Move cursor word right"
msgstr "Posunúť kurzor o slovo vpravo"

#: lazarusidestrconsts:lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Posunúť závislosť dole"

#: lazarusidestrconsts:lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Posunúť závislosť hore"

#: lazarusidestrconsts:srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Okno editora vľavo"

#: lazarusidestrconsts:srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Posunúť editor úplne vľavo"

#: lazarusidestrconsts:srkmecmoveeditorright
msgid "Move editor right"
msgstr "Okno editora vpravo"

#: lazarusidestrconsts:srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Posunúť editor úplne vpraco"

#: lazarusidestrconsts:lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Presunúť položky do zdedených"

#: lazarusidestrconsts:lispemovefiledown
msgid "Move file down"
msgstr "Posunúť súbor dole"

#: lazarusidestrconsts:lispemovefileup
msgid "Move file up"
msgstr "Posunúť súbor hore"

#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Posunúť uzol nižšie"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Posunúť uzol o úroveň nižšie"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Posunúť uzol o úroveň vyššie"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Posunúť uzol vyššie"

#: lazarusidestrconsts:lispatheditmovepathdown
msgid "Move path down"
msgstr "Posunúť cestu dole"

#: lazarusidestrconsts:lispatheditmovepathup
msgid "Move path up"
msgstr "Posunúť cestu hore"

#: lazarusidestrconsts:fdmordermovetoback
msgid "Move to back"
msgstr "Posunúť na koniec"

#: lazarusidestrconsts:fdmordermovetofront
msgid "Move to front"
msgstr "Posunúť na začiatok"

#: lazarusidestrconsts:dlgmultiselect
msgid "Multi Select"
msgstr "Viacnásobný výber"

#: lazarusidestrconsts:fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Viacnásobný výber komponentov musí byť na jednom formulári."

#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr ""

#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr ""

#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr ""

#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Poznámka: načítanie starého súboru volieb CodeTools"

#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "Poznámka: teraz sú podporované len absolútne cesty"

#: lazarusidestrconsts:lisdebugoptionsfrmname
msgid "Name"
msgstr "Meno"

#: lazarusidestrconsts:lisnameconflict
msgid "Name conflict"
msgstr ""

#: lazarusidestrconsts:lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Meno novej procedúry"

#: lazarusidestrconsts:liscodetoolsdefsname
msgid "Name:"
msgstr "Meno:"

#: lazarusidestrconsts:dlgnaming
msgid "Naming"
msgstr "Pomenovanie"

#: lazarusidestrconsts:lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nikdy, len manuálne"

#: lazarusidestrconsts:lismenutemplatenew
msgid "New"
msgstr "Nový"

#: lazarusidestrconsts:lismenunewother
msgid "New ..."
msgstr "Nový ..."

#: lazarusidestrconsts:lisnewancestors
msgid "New Ancestors"
msgstr "Nový predok"

#: lazarusidestrconsts:lisnewclass
msgid "New Class"
msgstr "Nová trieda"

#: lazarusidestrconsts:lisa2pnewcomponent
msgid "New Component"
msgstr "Nový komponent"

#: lazarusidestrconsts:lisa2pnewfile
msgid "New File"
msgstr "Nový súbor"

#: lazarusidestrconsts:lismenunewform
msgid "New Form"
msgstr "Nový formulár"

#: lazarusidestrconsts:lismenunewproject
msgid "New Project ..."
msgstr "Nový projekt ..."

#: lazarusidestrconsts:lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Nový projekt zo súboru ..."

#: lazarusidestrconsts:lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nový vyžadovaný"

#: lazarusidestrconsts:lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Popis novej šablóny ..."

#: lazarusidestrconsts:lismenunewunit
msgid "New Unit"
msgstr "Nová jednotka"

#: lazarusidestrconsts:lisa2pnewclassname
msgid "New class name:"
msgstr "Meno novej triedy:"

#: lazarusidestrconsts:liskmnewpackage
msgid "New package"
msgstr ""

#: lazarusidestrconsts:lismenunewpackage
msgid "New package ..."
msgstr ""

#: lazarusidestrconsts:liskmnewproject
msgid "New project"
msgstr "Nový projekt"

#: lazarusidestrconsts:liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nový projekt zo súboru"

#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nová jednotka nie je v ceste jednotiek"

#: lazarusidestrconsts:liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nový uzol"

#: lazarusidestrconsts:lispkgmangnewpackage
msgid "NewPackage"
msgstr "Nový balíček"

#: lazarusidestrconsts:liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nový riadok"

#: lazarusidestrconsts:srvk_next
msgid "Next"
msgstr ""

#: lazarusidestrconsts:srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Nasledujúca záložka"

#: lazarusidestrconsts:lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nenájdená sekcia ResourceString"

#: lazarusidestrconsts:lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Abstraktné metódy nenájdené"

#: lazarusidestrconsts:lisnobackupfiles
msgid "No backup files"
msgstr "Bez záložných súborov"

#: lazarusidestrconsts:lisnochange
msgid "No change"
msgstr "Bez zmeny"

#: lazarusidestrconsts:lisnocodeselected
msgid "No code selected"
msgstr "Nie je vybratý kód"

#: lazarusidestrconsts:lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Žiadne zdedené voľby prekladača"

#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nie je zadaný debuger"

#: lazarusidestrconsts:dlgednoerr
msgid "No errors in key mapping found."
msgstr "Žiadne chyby mapovania kláves"

#: lazarusidestrconsts:lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nezvolená položka"

#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Nenájdený balíček pre závislosť %s%s%s.%sProsím zvoľte existujúci balíček."

#: lazarusidestrconsts:lisoipnopackageselected
msgid "No package selected"
msgstr "Nie je vybraný balíček"

#: lazarusidestrconsts:lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Nenájdený súbor programu %s%s%s."

#: lazarusidestrconsts:lisnostringconstantfound
msgid "No string constant found"
msgstr "Nenájdená reťazcová premenná"

#: lazarusidestrconsts:lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr "Neplatná cesta LazDoc"

#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Uzol a jeho položky sú platné len pre tento projekt"

#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Uzol je len na čítanie"

#: lazarusidestrconsts:srvk_nonconvert
msgid "Nonconvert"
msgstr "Nekonvertovať"

#: lazarusidestrconsts:dlgenvnone
msgid "None"
msgstr "Nič"

#: lazarusidestrconsts:dlgconormal
msgid "Normal Code"
msgstr "Normálny kód"

#: lazarusidestrconsts:srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normálny režim výberu"

#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr ""

#: lazarusidestrconsts:lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Nie je projekt Delphi"

#: lazarusidestrconsts:lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Nie je jednotka Delphi"

#: lazarusidestrconsts:lisuenotfound
msgid "Not found"
msgstr "Nenájdené"

#: lazarusidestrconsts:lisnotimplemented
msgid "Not implemented"
msgstr "Neimplementované"

#: lazarusidestrconsts:uenotimplcap
msgid "Not implemented yet"
msgstr "Zatiaľ neimplementované"

#: lazarusidestrconsts:lisnotimplementedyet2
msgid "Not implemented yet."
msgstr ""

#: lazarusidestrconsts:lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Zatiaľ neimplementované:%s%s"

#: lazarusidestrconsts:lisnotnow
msgid "Not now"
msgstr "Nie teraz"

#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
msgid "Note: All keys will be set to the values of the choosen scheme."
msgstr "Poznámka: Všetky klávesy budú nastavené na hodnoty zvolenej schémy."

#: lazarusidestrconsts:dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Poznámka: Projektové súbory sú všetky súbory v adresáre projektu"

#: lazarusidestrconsts:liscodetoolsoptsnumber
msgid "Number"
msgstr "Číslo"

#: lazarusidestrconsts:srvk_numlock
msgid "Numlock"
msgstr "Numlock"

#: lazarusidestrconsts:srvk_numpad
msgid "Numpad %d"
msgstr "Numerická klávesa %d"

#: lazarusidestrconsts:lisifdok
msgid "OK"
msgstr "OK"

#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Výnimky OS"

#: lazarusidestrconsts:uepovr
msgid "OVR"
msgstr ""

#: lazarusidestrconsts:lispckoptsobject
msgid "Object"
msgstr "Objekt"

#: lazarusidestrconsts:lismenuviewobjectinspector
msgid "Object Inspector"
msgstr "Inšpektor objektov"

#: lazarusidestrconsts:liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Príkazy Inšpektora objektov"

#: lazarusidestrconsts:lisokbtn
msgid "Ok"
msgstr "OK"

#: lazarusidestrconsts:lisoldancestors
msgid "Old Ancestors"
msgstr "Starý predok"

#: lazarusidestrconsts:lisoldclass
msgid "Old Class"
msgstr "Stará trieda"

#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Na vybudovanie projektu spusťte príkaz Vybudovať súbor"

#: lazarusidestrconsts:lisceoonidle
msgid "On idle"
msgstr "Pri nečinnosti"

#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Na spustenie projektu spusťte príkaz Spustiť súbor"

#: lazarusidestrconsts:lismenuonlinehelp
msgid "Online Help"
msgstr "Online pomoc"

#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Online pomoc zatiaľ nie je implementovaná"

#: lazarusidestrconsts:lispldonlyexistingfiles
msgid "Only existing files"
msgstr "Len existujúce súbory"

#: lazarusidestrconsts:lisemdonlypublished
msgid "Only published"
msgstr ""

#: lazarusidestrconsts:lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Hľadať len celé slová"

#: lazarusidestrconsts:lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Len výber"

#: lazarusidestrconsts:lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Upraviť šablóny kódu"

#: lazarusidestrconsts:lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Použiteľné len v režime kategórie"

#: lazarusidestrconsts:lishintopen
msgid "Open"
msgstr "Otvoriť"

#: lazarusidestrconsts:lisopenlfm
msgid "Open %s"
msgstr "Otvoriť %s"

#: lazarusidestrconsts:lismenuopen
msgid "Open ..."
msgstr "Otvoriť ..."

#: lazarusidestrconsts:lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Otvoriť rozdiel v editore"

#: lazarusidestrconsts:lisopenfile2
msgid "Open File ..."
msgstr "Otvoriť súbor ..."

#: lazarusidestrconsts:liscpopenpackage
msgid "Open Package %s"
msgstr "Otvoriť balíček %s"

#: lazarusidestrconsts:lisopenpackagefile
msgid "Open Package File"
msgstr "Otvoriť súbor balíčka"

#: lazarusidestrconsts:lisopenpackage
msgid "Open Package?"
msgstr "Otvoriť balíček?"

#: lazarusidestrconsts:lisctdefsopenpreview
msgid "Open Preview"
msgstr "Otvoriť ukážku"

#: lazarusidestrconsts:lismenuopenproject
msgid "Open Project ..."
msgstr "Otvoriť projekt ..."

#: lazarusidestrconsts:lisopenprojectfile
msgid "Open Project File"
msgstr "Otvoriť súbor projektu"

#: lazarusidestrconsts:lisopenproject
msgid "Open Project?"
msgstr "Otvoriť projekt?"

#: lazarusidestrconsts:lismenutemplateopenrecent
msgid "Open Recent"
msgstr "Otvoriť nedávne"

#: lazarusidestrconsts:lismenuopenrecent
msgid "Open Recent ..."
msgstr "Otvoriť posledné ..."

#: lazarusidestrconsts:lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Otvoriť nedávny projekt ..."

#: lazarusidestrconsts:liscpopenunit
msgid "Open Unit %s"
msgstr "Otvoriť jednotku  %s"

#: lazarusidestrconsts:lisopenasxmlfile
msgid "Open as XML file"
msgstr "Otvoriť ako súbor XML"

#: lazarusidestrconsts:lisopenexistingfile
msgid "Open existing file"
msgstr "Otvoriť existujúci súbor"

#: lazarusidestrconsts:lisopenfile
msgid "Open file"
msgstr "Otvoriť súbor"

#: lazarusidestrconsts:srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Otvoriť súbor na kurzore"

#: lazarusidestrconsts:lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Otvoriť súbor na kurzore"

#: lazarusidestrconsts:dlgqopenlastprj
msgid "Open last project at start"
msgstr "Pri spustení otvoriť posledný projekt"

#: lazarusidestrconsts:lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Otvoriť načítaný balíček"

#: lazarusidestrconsts:lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Otvoriť načítaný balíček ..."

#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Otvoriť alebo načítať voľby prekladača"

#: lazarusidestrconsts:liscomppalopenpackage
msgid "Open package"
msgstr "Otvoriť balíček"

#: lazarusidestrconsts:lisopenpackage2
msgid "Open package %s"
msgstr "Otvoriť balíček %s"

#: lazarusidestrconsts:liskmopenpackagefile
msgid "Open package file"
msgstr "Otvoriť súbor balíčka"

#: lazarusidestrconsts:lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Otvoriť súbor balíčka (.lpk) ..."

#: lazarusidestrconsts:lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Otvoriť balíček aktuálnej jednotky"

#: lazarusidestrconsts:lisopenproject2
msgid "Open project"
msgstr "Otvoriť projekt"

#: lazarusidestrconsts:lisopenprojectagain
msgid "Open project again"
msgstr "Znova otvoriť projekt"

#: lazarusidestrconsts:lisiecoopenrecent
msgid "Open recent"
msgstr "Otvoriť nedávne"

#: lazarusidestrconsts:lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Otvoriť nedávny balíček ..."

#: lazarusidestrconsts:lisopensymlink
msgid "Open symlink"
msgstr "Otvoriť symbolický odkaz"

#: lazarusidestrconsts:lisopentarget
msgid "Open target"
msgstr "Otvoriť cieľ"

#: lazarusidestrconsts:lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Otvoriť súbor ako bežný zdrojový kód"

#: lazarusidestrconsts:lisopenthepackage
msgid "Open the package %s?"
msgstr "Otvoriť balíček %s?"

#: lazarusidestrconsts:lisopentheproject
msgid "Open the project %s?"
msgstr "Otvoriť projekt %s?"

#: lazarusidestrconsts:liscomppalopenunit
msgid "Open unit"
msgstr "Otvoriť jednotku"

#: lazarusidestrconsts:dlgoptimiz
msgid "Optimizations:"
msgstr "Optimalizácie:"

#: lazarusidestrconsts:liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Voľba na pozícii %d nedovoľuje argument: %s"

#: lazarusidestrconsts:liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Voľba na pozícii %d vyžaduje argument: %s"

#: lazarusidestrconsts:fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Voľba: Prichytiť k mriežke"

#: lazarusidestrconsts:fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Voľba: Prichytiť k pomocným čiaram"

#: lazarusidestrconsts:dlgfropts
msgid "Options"
msgstr "Voľby"

#: lazarusidestrconsts:lislazbuildoptions
msgid "Options:"
msgstr "Voľby:"

#: lazarusidestrconsts:dlgcoopts
msgid "Options: "
msgstr "Voľby:"

#: lazarusidestrconsts:fdmorder
msgid "Order"
msgstr "Poradie"

#: lazarusidestrconsts:dlgsrorigin
msgid "Origin"
msgstr ""

#: lazarusidestrconsts:dlgcoother
msgid "Other"
msgstr "Ostatné"

#: lazarusidestrconsts:dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Ostatné zdrojové kódy (súbory .pp/.pas, použité len IDE, nie prekladačom)"

#: lazarusidestrconsts:dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Ostatné súbory jednotiek (-Fu) (oddelené bodkočiarkou):"

#: lazarusidestrconsts:dlgenvotherfiles
msgid "Other files"
msgstr "Ostatné súbory"

#: lazarusidestrconsts:rsotherinfo
msgid "Other info"
msgstr "Ostatné informácie"

#: lazarusidestrconsts:lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Výstup"

#: lazarusidestrconsts:dlgpooutputsettings
msgid "Output Settings"
msgstr "Nastavenia výstupu"

#: lazarusidestrconsts:lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Výstupný adresár"

#: lazarusidestrconsts:dlgcooverflow
msgid "Overflow"
msgstr "Pretečenie"

#: lazarusidestrconsts:lissamoverrideallselected
msgid "Override all selected"
msgstr "Nahradiť všetky vybraté"

#: lazarusidestrconsts:lissamoverridefirstselected
msgid "Override first selected"
msgstr "Nahradiť prvý vybratý"

#: lazarusidestrconsts:lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Prepísať jazyk. Napríklad --language=de. Pre možné hodnoty pozrite súbory v adresári languages."

#: lazarusidestrconsts:lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Prepísať systémovú premennú"

#: lazarusidestrconsts:srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Režim prepisovania"

#: lazarusidestrconsts:lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Prepísať súbor na disku"

#: lazarusidestrconsts:lisoverwritefile
msgid "Overwrite file?"
msgstr "Prepísať súbor?"

#: lazarusidestrconsts:listodolowner
msgid "Owner"
msgstr "Vlastník"

#: lazarusidestrconsts:rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Výstupný adresár pre .po:"

#: lazarusidestrconsts:lispackage
msgid "Package"
msgstr "Balíček"

#: lazarusidestrconsts:lispckeditpackage
msgid "Package %s"
msgstr "Balíček %s"

#: lazarusidestrconsts:lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Balíček %s nenájdený"

#: lazarusidestrconsts:lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Balíček %s%s%s zmenený. Uložiť?"

#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Balíček %s%s%s bol zmenený.%sUložiť balíček?"

#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Balíček %s%s%s má neplatný výstupný adresár:%s%s%s%s"

#: lazarusidestrconsts:lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Balíček %s%s%s nenájdený."

#: lazarusidestrconsts:lismenupackagegraph
msgid "Package Graph ..."
msgstr "Graf balíčkov ..."

#: lazarusidestrconsts:lispackageinfo
msgid "Package Info"
msgstr "Informácie o balíčku"

#: lazarusidestrconsts:lispldpackagelinks
msgid "Package Links"
msgstr "Odkazy balíčkov"

#: lazarusidestrconsts:lisoippackagename
msgid "Package Name"
msgstr "Meno balíčka"

#: lazarusidestrconsts:lisprojaddpackagename
msgid "Package Name:"
msgstr "Meno balíčka:"

#: lazarusidestrconsts:lispckoptspackageoptions
msgid "Package Options"
msgstr "Voľby balíčka"

#: lazarusidestrconsts:lispkgreg
msgid "Package Registration"
msgstr "Registrácia balíčka"

#: lazarusidestrconsts:lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr ""

#: lazarusidestrconsts:lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Konflikty balíčka"

#: lazarusidestrconsts:lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Chýba súbor balíčka"

#: lazarusidestrconsts:lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Súbor balíčka nenájdený"

#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr "Súbor balíčka neuložený"

#: lazarusidestrconsts:liskmpackagegraph
msgid "Package graph"
msgstr "Graf balíčkov"

#: lazarusidestrconsts:dlgpldpackagegroup
msgid "Package group"
msgstr ""

#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Balíček nie je pre dobu návrhu"

#: lazarusidestrconsts:lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Balíček je len na čítanie"

#: lazarusidestrconsts:lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Balíček je vyžadovaný"

#: lazarusidestrconsts:lismenupackagelinks
msgid "Package links ..."
msgstr "Odkazy balíčkov ..."

#: lazarusidestrconsts:srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Príkazy menu Balíček"

#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Meno balíčka už existuje"

#: lazarusidestrconsts:lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Meno balíčka začína s ..."

#: lazarusidestrconsts:lispackagenamecontains
msgid "Package name contains ..."
msgstr "Meno balíčka obsahuje ..."

#: lazarusidestrconsts:lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Balíček potrebuje inštaláciu"

#: lazarusidestrconsts:lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Balíček nenájdený"

#: lazarusidestrconsts:lispkgmangpackage
msgid "Package: %s"
msgstr "Balíček: %s"

#: lazarusidestrconsts:lispckoptspackagetype
msgid "PackageType"
msgstr "Typ balíčka"

#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Balíčky musia mať príponu .lpk"

#: lazarusidestrconsts:lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Balíčky pre nainštalovanie do IDE"

#: lazarusidestrconsts:lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Meno balíčka veľmi dlhé"

#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Kresliť položky návrhára len pri nečinnosti (redukuje zaťaženie per slabšie počítače)"

#: lazarusidestrconsts:liscmplstpalette
msgid "Palette"
msgstr "Paleta"

#: lazarusidestrconsts:lisa2ppalettepage
msgid "Palette Page:"
msgstr "Stránky palety:"

#: lazarusidestrconsts:lissortselparagraphs
msgid "Paragraphs"
msgstr "Odseky"

#: lazarusidestrconsts:liscmparameter
msgid "Parameter"
msgstr "Parameter"

#: lazarusidestrconsts:lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametre:"

#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Rodičovský uzol nemôže obsahovať podriadené uzly"

#: lazarusidestrconsts:dlgcoparsing
msgid "Parsing"
msgstr "Analýza"

#: lazarusidestrconsts:lislazbuildabopart
msgid "Part"
msgstr "Časť"

#: lazarusidestrconsts:lispascalsourcefile
msgid "Pascal source file"
msgstr "Súbor zdrojového kódu Pascalu"

#: lazarusidestrconsts:lispascalunit
msgid "Pascal unit"
msgstr "Jednotka pascalu"

#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Jednotka pascalu musí mať príponu .pp alebo .pas"

#: lazarusidestrconsts:lispasscount
msgid "Pass Count"
msgstr ""

#: lazarusidestrconsts:dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Poslať voľby linkovaču (oddeľovač je medzera)"

#: lazarusidestrconsts:lismenupaste
msgid "Paste"
msgstr "Vložiť"

#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Vložiť komponenty zo schránky"

#: lazarusidestrconsts:srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Vložiť zo schránky na aktuálnu pozíciu"

#: lazarusidestrconsts:lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Vložiť vybraté komponenty zo schránky"

#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Editor ciest"

#: lazarusidestrconsts:lispatheditpathtemplates
msgid "Path templates"
msgstr "Cesty šablón"

#: lazarusidestrconsts:listofpcpath
msgid "Path:"
msgstr "Cesty:"

#: lazarusidestrconsts:dlgsearchpaths
msgid "Paths"
msgstr "Cesty"

#: lazarusidestrconsts:lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Cesty (len na čítanie)"

#: lazarusidestrconsts:lismenupause
msgid "Pause"
msgstr "Prerušiť"

#: lazarusidestrconsts:srvk_pause
msgid "Pause key"
msgstr ""

#: lazarusidestrconsts:liskmpauseprogram
msgid "Pause program"
msgstr "Prerušiť program"

#: lazarusidestrconsts:dlgpersistentcaret
msgid "Persistent caret"
msgstr ""

#: lazarusidestrconsts:lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr "Prosím skontrolujte testovací adresár v %sProstredie -> Voľby prostredia -> Súbory -> Adresár pre budovanie testovacích projektov"

#: lazarusidestrconsts:lispleasecheckthecompilername
msgid "Please check the compiler name"
msgstr "Prosím skontrolujte meno prekladača"

#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr "Prosím, skontrolujte adresár zdrojových kódov FreePascal"

#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Prosím zvoľte sekciu resourcestring zo zoznamu."

#: lazarusidestrconsts:lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Prosím pred spustením otvorte jednotku."

#: lazarusidestrconsts:srkmpresskey
msgid "Please press a key ..."
msgstr "Prosím stlačte klávesu ..."

#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Prosím, uložte súbor pred jeho pridaním do balíčka."

#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Prosím najprv uložte balíček."

#: lazarusidestrconsts:lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Prosím, vyberte balíček"

#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Prosím vyberte balíček pre otvorenie"

#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Prosím, najprv vyberte položku."

#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Prosím vyberte kód pre oddelenie procedúry/metódy"

#: lazarusidestrconsts:liscodetoolsoptspoint
msgid "Point"
msgstr ""

#: lazarusidestrconsts:lispointer
msgid "Pointer"
msgstr ""

#: lazarusidestrconsts:rslanguagepolish
msgid "Polish"
msgstr "Poľsky"

#: lazarusidestrconsts:rslanguagepolishwin
msgid "Polish(CP1250)"
msgstr "Poľsky(CP1250)"

#: lazarusidestrconsts:rslanguagepolishiso
msgid "Polish(ISO 8859-2)"
msgstr "Poľsky(ISO 8859-2)"

#: lazarusidestrconsts:rslanguageportugues
msgid "Portuguese"
msgstr "Portugalsky"

#: lazarusidestrconsts:lisceomode
msgid "Preferred Exhibition Mode"
msgstr ""

#: lazarusidestrconsts:dlgwrdpreview
msgid "Preview"
msgstr "Ukážka"

#: lazarusidestrconsts:dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr ""

#: lazarusidestrconsts:srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Predchádzajúca záložka"

#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Predchádzajúci uzol nemôže obsahovať vnorené uzly."

#: lazarusidestrconsts:srvk_print
msgid "Print"
msgstr "Tlačiť"

#: lazarusidestrconsts:listodolistprintlist
msgid "Print todo items"
msgstr "Tlačiť položky ToDo"

#: lazarusidestrconsts:srvk_prior
msgid "Prior"
msgstr "Pred"

#: lazarusidestrconsts:listodolpriority
msgid "Priority"
msgstr "Priorita"

#: lazarusidestrconsts:lisprivate
msgid "Private"
msgstr "Súkromné (private)"

#: lazarusidestrconsts:lisprivatemethod
msgid "Private Method"
msgstr "Súkromná metóda"

#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr ""

#: lazarusidestrconsts:lisprocedure
msgid "Procedure"
msgstr "Procedúra"

#: lazarusidestrconsts:uemprocedurejump
msgid "Procedure Jump"
msgstr "Prejsť na procedúru"

#: lazarusidestrconsts:srkmecprocedurelist
msgid "Procedure List ..."
msgstr "Zoznam procedúr ..."

#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Pravidlá vkladania procedúr"

#: lazarusidestrconsts:lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedúra s rozhraním"

#: lazarusidestrconsts:lisceprocedures
msgid "Procedures"
msgstr "Procedúry"

#: lazarusidestrconsts:lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proces"

#: lazarusidestrconsts:lisprogram
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts:lisprogramdetected
msgid "Program detected"
msgstr "Program zistený"

#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Zdrojový kód programu musí mať príponu Pascalu ako .pas, .pp or .lpr"

#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr "Program%sFreePascal program. Súbor programu je automaticky spravovaný Lazarom."

#: lazarusidestrconsts:lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Meno súboru programu:"

#: lazarusidestrconsts:lisexeprograms
msgid "Programs"
msgstr "Programy"

#: lazarusidestrconsts:lispdprogress
msgid "Progress"
msgstr "Postup"

#: lazarusidestrconsts:dlgenvproject
msgid "Project"
msgstr "Projekt"

#: lazarusidestrconsts:lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built. :)"
msgstr "Projekt %s%s%s úspešne vybudovaný. :)"

#: lazarusidestrconsts:lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Cesta k include projektu"

#: lazarusidestrconsts:lisprojectincpath
msgid "Project Include Path"
msgstr "Cesta k include projektu"

#: lazarusidestrconsts:lisprojectinformation
msgid "Project Information"
msgstr "Informácie o projekte"

#: lazarusidestrconsts:lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inšpektor projektu"

#: lazarusidestrconsts:lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inšpektor projektu - %s"

#: lazarusidestrconsts:dlgprojectoptions
msgid "Project Options"
msgstr "Voľby projektu"

#: lazarusidestrconsts:lismenuprojectoptions
msgid "Project Options ..."
msgstr "Voľby projektu ..."

#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr ""

#: lazarusidestrconsts:lisprojectsrcpath
msgid "Project Src Path"
msgstr "Cesta k zdrojovým kódom projektu"

#: lazarusidestrconsts:lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Cesta k zdrojovým kódom projektu"

#: lazarusidestrconsts:lisprojectunitpath
msgid "Project Unit Path"
msgstr "Cesta k jednotkám projektu"

#: lazarusidestrconsts:lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Cesta k jednotkám projektu"

#: lazarusidestrconsts:lisprojectchanged
msgid "Project changed"
msgstr "Projekt zmenený"

#: lazarusidestrconsts:lisprojectclosed
msgid "Project closed"
msgstr "Projekt zatvorený"

#: lazarusidestrconsts:lisprojectdirectory
msgid "Project directory"
msgstr "Adresár projektu"

#: lazarusidestrconsts:lisprojectfilename
msgid "Project filename"
msgstr "Meno súboru projektu"

#: lazarusidestrconsts:dlgprojfiles
msgid "Project files"
msgstr "Súbory projektu"

#: lazarusidestrconsts:lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Informačný súbor projektu zistený"

#: lazarusidestrconsts:lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projekt je spustiteľný"

#: lazarusidestrconsts:lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Vlastnosti Makier projektu"

#: lazarusidestrconsts:srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Príkazy menu Projekt"

#: lazarusidestrconsts:lispkgmangproject
msgid "Project: %s"
msgstr "Projekt: %s"

#: lazarusidestrconsts:lispromptforvalue
msgid "Prompt for value"
msgstr "Opýtať sa na hodnotu"

#: lazarusidestrconsts:lisceproperties
msgid "Properties"
msgstr "Vlastnosti"

#: lazarusidestrconsts:lishlpoptsproperties
msgid "Properties:"
msgstr "Vlastnosti:"

#: lazarusidestrconsts:dlgpropertycompletion
msgid "Property completion"
msgstr "Dokončovanie vlastností"

#: lazarusidestrconsts:dlgpropnamecolor
msgid "Property name"
msgstr "Meno vlastnosti"

#: lazarusidestrconsts:lisprotected
msgid "Protected"
msgstr "Chránené (protected)"

#: lazarusidestrconsts:lisprotectedmethod
msgid "Protected Method"
msgstr "Chránená metóda"

#: lazarusidestrconsts:lispckoptsprovides
msgid "Provides"
msgstr "Poskytuje"

#: lazarusidestrconsts:lisemdpublic
msgid "Public"
msgstr ""

#: lazarusidestrconsts:lispublicmethod
msgid "Public Method"
msgstr "Verejná metóda"

#: lazarusidestrconsts:lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publikovať balíček"

#: lazarusidestrconsts:lismenupublishproject
msgid "Publish Project ..."
msgstr "Publikovať projekt ..."

#: lazarusidestrconsts:liskmpublishproject
msgid "Publish project"
msgstr "Publikovať projekt"

#: lazarusidestrconsts:lispublishprojdir
msgid "Publish project directory"
msgstr "Publikovať adresár projektu"

#: lazarusidestrconsts:lisemdpublished
msgid "Published"
msgstr ""

#: lazarusidestrconsts:lispublishedmethod
msgid "Published Method"
msgstr "Zverejnená metóda"

#: lazarusidestrconsts:lislazbuildquickbuildoptions
msgid "Quick Build Options"
msgstr "Voľby rýchleho budovania"

#: lazarusidestrconsts:lismenuquickcompile
msgid "Quick compile"
msgstr "Rýchly preklad"

#: lazarusidestrconsts:liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Rýchly preklad, nelinkovať"

#: lazarusidestrconsts:lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Rýchla kontrola syntaxe"

#: lazarusidestrconsts:lismenuquit
msgid "Quit"
msgstr "Skončiť"

#: lazarusidestrconsts:lisquitlazarus
msgid "Quit Lazarus"
msgstr "Skončiť Lazarus"

#: lazarusidestrconsts:dlgcorange
msgid "Range"
msgstr "Rozsah"

#: lazarusidestrconsts:lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Znova pridať závislosť"

#: lazarusidestrconsts:lispckeditreaddfile
msgid "Re-Add file"
msgstr "Znova pridať súbor"

#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Znova preložiť tento a všetky vyžadované balíčky?"

#: lazarusidestrconsts:lisreaderror
msgid "Read Error"
msgstr "Chyba čítania"

#: lazarusidestrconsts:uemreadonly
msgid "Read Only"
msgstr "Len na čítanie"

#: lazarusidestrconsts:lispckeditreadonly
msgid "Read Only: %s"
msgstr "Len na čítanie: %s"

#: lazarusidestrconsts:liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Chyba čítania"

#: lazarusidestrconsts:dlgcdtreadprefix
msgid "Read prefix"
msgstr ""

#: lazarusidestrconsts:uepreadonly
msgid "Readonly"
msgstr "Len na čítanie"

#: lazarusidestrconsts:lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Prebudovať Lazarus?"

#: lazarusidestrconsts:lisiecorecentfiles
msgid "Recent files"
msgstr "Nedávne súbory"

#: lazarusidestrconsts:lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Znova preložiť všetky vyžadované"

#: lazarusidestrconsts:lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Vyčistiť a znova preložiť"

#: lazarusidestrconsts:lisrecordstruct
msgid "Record/Structure"
msgstr ""

#: lazarusidestrconsts:lismenuredo
msgid "Redo"
msgstr "Znova"

#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Redukovať kreslenie návrhára"

#: lazarusidestrconsts:uemrefactor
msgid "Refactoring"
msgstr ""

#: lazarusidestrconsts:dlgreferencecolor
msgid "Reference"
msgstr "Odkazy"

#: lazarusidestrconsts:dlgunitdeprefresh
msgid "Refresh"
msgstr "Obnoviť"

#: lazarusidestrconsts:lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Obnoviť automaticky"

#: lazarusidestrconsts:listodolistrefresh
msgid "Refresh todo items"
msgstr "Obnoviť položky ToDo"

#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Procedúra Register je prázdna"

#: lazarusidestrconsts:lispckeditregisterunit
msgid "Register unit"
msgstr "Registrovať jednotku"

#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Bolo volané RegisterUnit, ale neregistruje sa žiadny balíček."

#: lazarusidestrconsts:lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Registrované pluginy"

#: lazarusidestrconsts:lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Chyba registrácie"

#: lazarusidestrconsts:lisrelativepaths
msgid "Relative paths"
msgstr "Relatívne cesty"

#: lazarusidestrconsts:lispckoptsrelease
msgid "Release"
msgstr "Vydanie"

#: lazarusidestrconsts:lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Znova načítať z disku"

#: lazarusidestrconsts:lisexttoolremove
msgid "Remove"
msgstr "Odstrániť"

#: lazarusidestrconsts:lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Odstrániť závislosť?"

#: lazarusidestrconsts:liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Odstrániť aktívnu jednotku z projektu"

#: lazarusidestrconsts:lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Odstrániť všetky neplatné vlastnosti"

#: lazarusidestrconsts:liskmremovebreakpoint
msgid "Remove break point"
msgstr "Odstrániť bod prerušenia"

#: lazarusidestrconsts:lispckeditremovedependency
msgid "Remove dependency"
msgstr "Odstrániť závislosť"

#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Odstrániť závislosť %s%s%s%sz balíčka %s%s%s?"

#: lazarusidestrconsts:srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr ""

#: lazarusidestrconsts:lispckeditremovefile
msgid "Remove file"
msgstr "Odstrániť súbor"

#: lazarusidestrconsts:lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Odstrániť súbor %s z projektu?"

#: lazarusidestrconsts:lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Odstrániť súbor %s%s%s%sz balíčka %s%s%s?"

#: lazarusidestrconsts:lispckeditremovefile2
msgid "Remove file?"
msgstr "Odstrániť súbor?"

#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Odstrániť súbory vyhovujúce filtru"

#: lazarusidestrconsts:lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Odstrániť z projektu ..."

#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Odstrániť z obľúbených vlastností"

#: lazarusidestrconsts:lisremovefromproject
msgid "Remove from project"
msgstr "Odstrániť z projektu"

#: lazarusidestrconsts:lisemdremovemethods
msgid "Remove methods"
msgstr ""

#: lazarusidestrconsts:liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Odstrániť cestu"

#: lazarusidestrconsts:lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Odstrániť zvolenú položku"

#: lazarusidestrconsts:lisremovethem
msgid "Remove them"
msgstr "Odstrániť ich"

#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Odstránené súbory (tieto položky nie sú uložené v súbore lpk)"

#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Odstránené vyžadované balíčky"

#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Odstránené vyžadované balíčky (tieto položky nie sú uložené v v súbore lpk)"

#: lazarusidestrconsts:lisfrirename
msgid "Rename"
msgstr "Premenovať"

#: lazarusidestrconsts:lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Premenovať malými písmenami?"

#: lazarusidestrconsts:uemrenameidentifier
msgid "Rename Identifier"
msgstr "Premenovať identifikátor"

#: lazarusidestrconsts:lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Premenovať identifikátor ..."

#: lazarusidestrconsts:lisfrirenameallreferences
msgid "Rename all References"
msgstr "Premenovať všetky referencie"

#: lazarusidestrconsts:lisrenamefilefailed
msgid "Rename file failed"
msgstr "Premenovanie súboru zlyhalo"

#: lazarusidestrconsts:lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Premenovať súbor v balíčku?"

#: lazarusidestrconsts:lisrenamefile
msgid "Rename file?"
msgstr "Premenovať súbor?"

#: lazarusidestrconsts:srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Premenovať identifikátor"

#: lazarusidestrconsts:lisfrirenameto
msgid "Rename to"
msgstr "Premenovať na"

#: lazarusidestrconsts:lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Premenovať na malé písmená"

#: lazarusidestrconsts:lisrepeatcount
msgid "Repeat Count:"
msgstr ""

#: lazarusidestrconsts:lismenureplace
msgid "Replace"
msgstr "Nahradiť"

#: lazarusidestrconsts:dlgreplaceall
msgid "Replace &All"
msgstr "N&ahradiť všetko"

#: lazarusidestrconsts:lispkgmangreplacefile
msgid "Replace File"
msgstr "Nahradiť súbor"

#: lazarusidestrconsts:lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Nahradiť existujúci súbor %s%s%s?"

#: lazarusidestrconsts:srkmecreplace
msgid "Replace text"
msgstr "Nahradiť text"

#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Nahradiť tento výskyt %s%s%s%s týmto %s%s%s?"

#: lazarusidestrconsts:lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Nahradenie výberu zlyhalo."

#: lazarusidestrconsts:dlgreport
msgid "Report"
msgstr "Hlásenie"

#: lazarusidestrconsts:lismenureportingbug
msgid "Reporting a bug..."
msgstr "Hlásenie chyby ..."

#: lazarusidestrconsts:lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Vyžadované balíčky"

#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Znova prezrieť zdrojové kódy FPC"

#: lazarusidestrconsts:lisvsrresetresultlist
msgid "Reset Result List"
msgstr "Vymazať zoznam výsledkov"

#: lazarusidestrconsts:lismenuresetdebugger
msgid "Reset debugger"
msgstr "Reštartovať debuger"

#: lazarusidestrconsts:lisresourceloaderror
msgid "Resource load error"
msgstr "Chyba načítania resource"

#: lazarusidestrconsts:lisresourcesaveerror
msgid "Resource save error"
msgstr "Chyba uloženia resource"

#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "ResourceString už existuje"

#: lazarusidestrconsts:lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Výber ResourceString:"

#: lazarusidestrconsts:lismenurestart
msgid "Restart"
msgstr "Reštartovať"

#: lazarusidestrconsts:lislazbuildrestartafterbuild
msgid "Restart after successful Build"
msgstr "Po úspešnom vybudovaní reštartovať"

#: lazarusidestrconsts:rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Obnoviť geometriu okien"

#: lazarusidestrconsts:rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Obnoviť veľkosť okna"

#: lazarusidestrconsts:lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Prehliadač obmedzení"

#: lazarusidestrconsts:dlgccoresults
msgid "Results"
msgstr "Výsledky"

#: lazarusidestrconsts:lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Pokračovať"

#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Pokračovať obslúžené"

#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Pokračovať neobslúžené"

#: lazarusidestrconsts:srvk_return
msgid "Return"
msgstr ""

#: lazarusidestrconsts:lismenurevert
msgid "Revert"
msgstr "Obnoviť"

#: lazarusidestrconsts:lisrevertfailed
msgid "Revert failed"
msgstr "Obnovenie zlyhalo"

#: lazarusidestrconsts:lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Obnoviť balíček?"

#: lazarusidestrconsts:srvk_right
msgid "Right"
msgstr ""

#: lazarusidestrconsts:dlgrightclickselects
msgid "Right Click selects"
msgstr "Kliknutie pravým vyberá"

#: lazarusidestrconsts:lisrightanchoring
msgid "Right anchoring"
msgstr "Pravé ukotvenie"

#: lazarusidestrconsts:lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Pravý okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·vprav od prvku."

#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Kliknutie pravým tlačítkom na strom položiek, sprístupní všetky dostupné funkcie balíčka."

#: lazarusidestrconsts:dlgrightmargin
msgid "Right margin"
msgstr "Pravý okraj"

#: lazarusidestrconsts:dlgrightmargincolor
msgid "Right margin color"
msgstr "Farba pravého okraja"

#: lazarusidestrconsts:dlgrightmousemovescursor
msgid "Right mouse moves caret"
msgstr ""

#: lazarusidestrconsts:lisrightsides
msgid "Right sides"
msgstr "Pravé strany"

#: lazarusidestrconsts:lisrightspaceequally
msgid "Right space equally"
msgstr ""

#: lazarusidestrconsts:dlgrubberbandgroup
msgid "Rubber band"
msgstr ""

#: lazarusidestrconsts:lismenuprojectrun
msgid "Run"
msgstr "Spustiť"

#: lazarusidestrconsts:lisbfruncommand
msgid "Run Command"
msgstr "Príkaz spustiť"

#: lazarusidestrconsts:lismenurunfile
msgid "Run File"
msgstr "Spustiť súbor"

#: lazarusidestrconsts:lismenurunparameters
msgid "Run Parameters ..."
msgstr "Parametre spustenia ..."

#: lazarusidestrconsts:srkmcatrunmenu
msgid "Run menu commands"
msgstr "Príkazy menu Spustiť"

#: lazarusidestrconsts:dlgrunparameters
msgid "Run parameters"
msgstr "Parametre spustenia"

#: lazarusidestrconsts:liskmrunprogram
msgid "Run program"
msgstr "Spustiť program"

#: lazarusidestrconsts:lismenuruntocursor
msgid "Run to cursor"
msgstr "Spustiť po kurzor"

#: lazarusidestrconsts:lisruntofailed
msgid "Run-to failed"
msgstr "Spustiť po zlyhané"

#: lazarusidestrconsts:lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Len pre dobu spustenia"

#: lazarusidestrconsts:rslanguagerussian
msgid "Russian"
msgstr "Ruský"

#: lazarusidestrconsts:lissvnrevision
msgid "SVN Revision: "
msgstr "Revízia SVN: "

#: lazarusidestrconsts:dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Rovnaké meno (v podadresári)"

#: lazarusidestrconsts:lismenusave
msgid "Save"
msgstr "Uložiť"

#: lazarusidestrconsts:lissavespace
msgid "Save "
msgstr "Uložiť"

#: lazarusidestrconsts:lissave
msgid "Save ..."
msgstr "Uložiť ..."

#: lazarusidestrconsts:lismenusaveall
msgid "Save All"
msgstr "Uložiť všetko"

#: lazarusidestrconsts:lismenutemplatesaveas
msgid "Save As"
msgstr "Uložiť ako"

#: lazarusidestrconsts:dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Uložiť ako - automaticky na malé písmená"

#: lazarusidestrconsts:lismenusaveas
msgid "Save As ..."
msgstr "Uložiť ako ..."

#: lazarusidestrconsts:lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Uložiť ako šablónu ..."

#: lazarusidestrconsts:lispckeditsavechanges
msgid "Save Changes?"
msgstr "Uložiť zmeny?"

#: lazarusidestrconsts:lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Uložiť balíček %s (*.lpk)"

#: lazarusidestrconsts:lispkgmangsavepackage
msgid "Save Package?"
msgstr "Uložiť balíček?"

#: lazarusidestrconsts:lismenusaveproject
msgid "Save Project"
msgstr "Uložiť projekt"

#: lazarusidestrconsts:lissaveprojectlpi
msgid "Save Project %s (*.lpi)"
msgstr "Uložiť projekt %s (*.lpi)"

#: lazarusidestrconsts:lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Uložiť projekt ako ..."

#: lazarusidestrconsts:lissavesettings
msgid "Save Settings"
msgstr "Uložiť nastavenia"

#: lazarusidestrconsts:lishintsaveall
msgid "Save all"
msgstr "Uložiť všetko"

#: lazarusidestrconsts:lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Uložiť všetky správy do súboru"

#: lazarusidestrconsts:liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Uložiť a skončiť"

#: lazarusidestrconsts:lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Uložiť a skončiť dialóg"

#: lazarusidestrconsts:lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Uložiť a prebudovať IDE"

#: lazarusidestrconsts:lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Uložiť zmeny do projektu %s?"

#: lazarusidestrconsts:lissavechanges
msgid "Save changes?"
msgstr "Uložiť zmeny?"

#: lazarusidestrconsts:dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Uložiť nastavenie plochy do súboru"

#: lazarusidestrconsts:dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Uložiť informácie editora pre zatvorené súbory"

#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Uložiť informácie editora o súboroch, ktoré nepatria do projektu"

#: lazarusidestrconsts:dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Uložiť informácie editora len pre súbory projektu"

#: lazarusidestrconsts:lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Uložiť súbor %s%s%s%spred zatvorením formulára %s%s%s?"

#: lazarusidestrconsts:lissavefileas
msgid "Save file as"
msgstr "Uložiť súbor ako"

#: lazarusidestrconsts:lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Dialóg uloženia súboru"

#: lazarusidestrconsts:fdmsaveformasxml
msgid "Save form as xml"
msgstr "Uložiť formulár ako XML"

#: lazarusidestrconsts:lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Uložiť do súboru .lps"

#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Uložiť do súboru .lps v adresári projektu"

#: lazarusidestrconsts:lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Uložiť v konfiguračnom adresári IDE"

#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Uložiť informácie o zatvorených súboroch editora"

#: lazarusidestrconsts:lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Uložiť správy do súboru (*.txt)"

#: lazarusidestrconsts:lispckeditsavepackage
msgid "Save package"
msgstr "Uložiť balíček"

#: lazarusidestrconsts:lispkgmangsavepackage2
msgid "Save package?"
msgstr "Uložiť balíček?"

#: lazarusidestrconsts:liskmsaveproject
msgid "Save project"
msgstr "Uložiť projekt"

#: lazarusidestrconsts:liskmsaveprojectas
msgid "Save project as"
msgstr "Uložiť projekt ako"

#: lazarusidestrconsts:lisposavesessioninformationin
msgid "Save session information in"
msgstr "Informácie o relácii uložiť v"

#: lazarusidestrconsts:lislazbuildsavesettings
msgid "Save settings"
msgstr "Uložiť nastavenia"

#: lazarusidestrconsts:lisiecosavetofile
msgid "Save to file"
msgstr "Uložiť do súboru"

#: lazarusidestrconsts:lisiecosavetorecent
msgid "Save to recent"
msgstr "Uložiť k nedávnym"

#: lazarusidestrconsts:liskmsaveall
msgid "SaveAll"
msgstr "Uložiť všetky"

#: lazarusidestrconsts:liskmsaveas
msgid "SaveAs"
msgstr "Uložiť ako"

#: lazarusidestrconsts:fdmscaleword
msgid "Scale"
msgstr "Mierka"

#: lazarusidestrconsts:lisscalingfactor
msgid "Scaling factor:"
msgstr "Mierka:"

#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Prehľadať jednotku a zistiť meno jednotky a procedúru Register"

#: lazarusidestrconsts:liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Hľadať správy FPC"

#: lazarusidestrconsts:liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Hľadať správy Make"

#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Vo výstupe hľadať správy FPC"

#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Vo výstupe hľadať správy make"

#: lazarusidestrconsts:dlgscope
msgid "Scope"
msgstr "Rozsah"

#: lazarusidestrconsts:srvk_scroll
msgid "Scroll"
msgstr "Rolovať"

#: lazarusidestrconsts:dlgscrollbyoneless
msgid "Scroll by one less"
msgstr ""

#: lazarusidestrconsts:srkmecscrolldown
msgid "Scroll down one line"
msgstr "Rolovať o riadok dole"

#: lazarusidestrconsts:srkmecscrollleft
msgid "Scroll left one char"
msgstr "Rolovať o znak vľavo"

#: lazarusidestrconsts:dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Rolovať za koiec súboru"

#: lazarusidestrconsts:dlgscrollpastendline
msgid "Scroll past end of line"
msgstr "Rolovať za koniec riadku"

#: lazarusidestrconsts:srkmecscrollright
msgid "Scroll right one char"
msgstr "Rolovať o znak vpravo"

#: lazarusidestrconsts:srkmecscrollup
msgid "Scroll up one line"
msgstr "Rolovať  o riadok hore"

#: lazarusidestrconsts:lissearchfor
msgid "Search For "
msgstr "Hľadať"

#: lazarusidestrconsts:lismenuviewsearchresults
msgid "Search Results"
msgstr "Výsledky hľadania"

#: lazarusidestrconsts:lissearchagain
msgid "Search again"
msgstr "Hľadať ďalej"

#: lazarusidestrconsts:lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Hľadať aj v komentároch"

#: lazarusidestrconsts:lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr ""

#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
msgid "Search or Filter Phrases In List"
msgstr ""

#: lazarusidestrconsts:lispatheditsearchpaths
msgid "Search paths:"
msgstr "Prehľadávať cesty:"

#: lazarusidestrconsts:lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Hľadaný reťazec '%s' nenájdený!"

#: lazarusidestrconsts:dlgsearchabort
msgid "Search terminated by user."
msgstr "Hľadanie prerušené používateľom."

#: lazarusidestrconsts:lisssearchtext
msgid "Search text"
msgstr "Hľadaný text"

#: lazarusidestrconsts:lisfrisearchwhere
msgid "Search where"
msgstr "Kde hľadať"

#: lazarusidestrconsts:lisssearching
msgid "Searching"
msgstr "Hľadanie"

#: lazarusidestrconsts:dlgsearchcaption
msgid "Searching..."
msgstr "Hľadanie ..."

#: lazarusidestrconsts:lisuesearching
msgid "Searching: %s"
msgstr "Hľadanie: %s"

#: lazarusidestrconsts:liscodehelpseealsotag
msgid "See also"
msgstr "Pozri aj"

#: lazarusidestrconsts:lisseemessages
msgid "See messages."
msgstr "Pozri správy."

#: lazarusidestrconsts:srkmecselleft
msgid "SelLeft"
msgstr ""

#: lazarusidestrconsts:srkmecselright
msgid "SelRight"
msgstr ""

#: lazarusidestrconsts:lismenuselect
msgid "Select"
msgstr "Vybrať"

#: lazarusidestrconsts:srkmecselectall
msgid "Select All"
msgstr "Vybrať všetky"

#: lazarusidestrconsts:lisctselectcodemacro
msgid "Select Code Macro"
msgstr ""

#: lazarusidestrconsts:lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Zvoľte súbory formulárov Delphi (*.dfm)"

#: lazarusidestrconsts:srkmecseldown
msgid "Select Down"
msgstr ""

#: lazarusidestrconsts:srkmecselgotoxy
msgid "Select Goto XY"
msgstr ""

#: lazarusidestrconsts:srkmecsellineend
msgid "Select Line End"
msgstr ""

#: lazarusidestrconsts:srkmecsellinestart
msgid "Select Line Start"
msgstr ""

#: lazarusidestrconsts:lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Zvoliť menu:"

#: lazarusidestrconsts:srkmecselpagebottom
msgid "Select Page Bottom"
msgstr ""

#: lazarusidestrconsts:srkmecselpagedown
msgid "Select Page Down"
msgstr ""

#: lazarusidestrconsts:srkmecselpageleft
msgid "Select Page Left"
msgstr ""

#: lazarusidestrconsts:srkmecselpageright
msgid "Select Page Right"
msgstr ""

#: lazarusidestrconsts:srkmecselpagetop
msgid "Select Page Top"
msgstr ""

#: lazarusidestrconsts:srkmecselpageup
msgid "Select Page Up"
msgstr ""

#: lazarusidestrconsts:lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Zvoliť šablónu:"

#: lazarusidestrconsts:srkmecselup
msgid "Select Up"
msgstr ""

#: lazarusidestrconsts:srkmecselwordleft
msgid "Select Word Left"
msgstr ""

#: lazarusidestrconsts:srkmecselwordright
msgid "Select Word Right"
msgstr ""

#: lazarusidestrconsts:lisselectahelpitem
msgid "Select a help item:"
msgstr "Vyberte položku pomoci:"

#: lazarusidestrconsts:lisselectanode
msgid "Select a node"
msgstr "Zvoľte uzol"

#: lazarusidestrconsts:lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Zvoľte typ rpojektu"

#: lazarusidestrconsts:lismenuselectall
msgid "Select all"
msgstr "Vybrať všetko"

#: lazarusidestrconsts:lismenuselectcodeblock
msgid "Select code block"
msgstr "Vybrať blok kódu"

#: lazarusidestrconsts:lispatheditselectdirectory
msgid "Select directory"
msgstr "Vyberte adresár"

#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
msgid "Select grand childs"
msgstr ""

#: lazarusidestrconsts:lismenuselectline
msgid "Select line"
msgstr "Vybrať riadok"

#: lazarusidestrconsts:liskmselectlineend
msgid "Select line end"
msgstr "Vybrať koniec riadku"

#: lazarusidestrconsts:liskmselectlinestart
msgid "Select line start"
msgstr "Vybrať začiatok riadku"

#: lazarusidestrconsts:lissamselectnone
msgid "Select none"
msgstr "Nič vybraté"

#: lazarusidestrconsts:liskmselectpagebottom
msgid "Select page bottom"
msgstr "Vybrať spodok stránky"

#: lazarusidestrconsts:liskmselectpagetop
msgid "Select page top"
msgstr "Vybrať vrchol stránky"

#: lazarusidestrconsts:lismenuselectparagraph
msgid "Select paragraph"
msgstr "Vybrať odsek"

#: lazarusidestrconsts:lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Vybrať rodičovský komponent"

#: lazarusidestrconsts:lisselectfile
msgid "Select the file"
msgstr "Vybrať súbor"

#: lazarusidestrconsts:srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Vybrať po úplný začiatok"

#: lazarusidestrconsts:srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Vybrať po úplný koniec"

#: lazarusidestrconsts:lismenuselecttobrace
msgid "Select to brace"
msgstr "Vybrať po zátvorku"

#: lazarusidestrconsts:lismenuselectword
msgid "Select word"
msgstr "Vybrať slovo"

#: lazarusidestrconsts:liskmselectwordleft
msgid "Select word left"
msgstr "Vybrať slovo naľavo"

#: lazarusidestrconsts:liskmselectwordright
msgid "Select word right"
msgstr "Vybrať slovo napravo"

#: lazarusidestrconsts:liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Zvolený uzol:"

#: lazarusidestrconsts:lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Zvolené balíčky sú vyžadované:"

#: lazarusidestrconsts:dlgruberbandselectioncolor
msgid "Selection"
msgstr "Výber"

#: lazarusidestrconsts:lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Výber presahuje reťazcovú konštantu"

#: lazarusidestrconsts:lisselectiontool
msgid "Selection tool"
msgstr "Nástroj výberu"

#: lazarusidestrconsts:liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Bodkočiarka"

#: lazarusidestrconsts:dlgposavesession
msgid "Session"
msgstr "Relácia"

#: lazarusidestrconsts:srkmecsetmarker
msgid "Set Marker %d"
msgstr "Nastav značku %d"

#: lazarusidestrconsts:uemsetfreebookmark
msgid "Set a free Bookmark"
msgstr "Nastaviť voľnú záložku"

#: lazarusidestrconsts:lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Nastav voľnú záložku"

#: lazarusidestrconsts:dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Nastaviť všetky prvky na predvolené"

#: lazarusidestrconsts:dlgsetelementdefault
msgid "Set element to default"
msgstr "Nastaviť prvok na predvolené"

#: lazarusidestrconsts:liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Nastaviť voľnú záložku"

#: lazarusidestrconsts:liskmsetmarker0
msgid "Set marker 0"
msgstr "Nastaviť značku 0"

#: lazarusidestrconsts:liskmsetmarker1
msgid "Set marker 1"
msgstr "Nastaviť značku 1"

#: lazarusidestrconsts:liskmsetmarker2
msgid "Set marker 2"
msgstr "Nastaviť značku 2"

#: lazarusidestrconsts:liskmsetmarker3
msgid "Set marker 3"
msgstr "Nastaviť značku 3"

#: lazarusidestrconsts:liskmsetmarker4
msgid "Set marker 4"
msgstr "Nastaviť značku 4"

#: lazarusidestrconsts:liskmsetmarker5
msgid "Set marker 5"
msgstr "Nastaviť značku 5"

#: lazarusidestrconsts:liskmsetmarker6
msgid "Set marker 6"
msgstr "Nastaviť značku 6"

#: lazarusidestrconsts:liskmsetmarker7
msgid "Set marker 7"
msgstr "Nastaviť značku 7"

#: lazarusidestrconsts:liskmsetmarker8
msgid "Set marker 8"
msgstr "Nastaviť značku 8"

#: lazarusidestrconsts:liskmsetmarker9
msgid "Set marker 9"
msgstr "Nastaviť značku 9"

#: lazarusidestrconsts:dlgsetpropertyvariable
msgid "Set property Variable"
msgstr ""

#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr ""

#: lazarusidestrconsts:srvk_shift
msgid "Shift"
msgstr ""

#: lazarusidestrconsts:srkmecshifttab
msgid "Shift Tab"
msgstr ""

#: lazarusidestrconsts:liscodehelpshorttag
msgid "Short"
msgstr ""

#: lazarusidestrconsts:liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Krátky popis"

#: lazarusidestrconsts:lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Skrátené alebo úplné meno súboru"

#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Má byyť súbor premenovaný malými písmenami na %s%s%s%s?"

#: lazarusidestrconsts:lisshow
msgid "Show"
msgstr ""

#: lazarusidestrconsts:lisaf2pshowall
msgid "Show All"
msgstr "Zobraziť všetko"

#: lazarusidestrconsts:liscemodeshowcategories
msgid "Show Categories"
msgstr "Zobraziť kategórie"

#: lazarusidestrconsts:lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Zobraziť hodnoty CodeTools"

#: lazarusidestrconsts:dlgcoshowerr
msgid "Show Errors"
msgstr "Zobraziť chyby"

#: lazarusidestrconsts:dlgguidelines
msgid "Show Guide Lines"
msgstr "Zobraziť pomocné čiary"

#: lazarusidestrconsts:dlgshowhint
msgid "Show Hints"
msgstr "Zobraziť rady"

#: lazarusidestrconsts:dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Zobraziť rady pre nepoužitý parameter \"Sender\""

#: lazarusidestrconsts:dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Zobraziť rady pre nepoužité jednotky v základnom zdrojovom súbore"

#: lazarusidestrconsts:uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Zobraziť čísla riadkov"

#: lazarusidestrconsts:dlgshownotes
msgid "Show Notes"
msgstr "Zobraziť poznámky"

#: lazarusidestrconsts:dlgcoshowoptions
msgid "Show Options"
msgstr "Zobraziť voľby"

#: lazarusidestrconsts:fdmshowoptions
msgid "Show Options for form editing"
msgstr "Zobraziť voľby pre úpravu formulára"

#: lazarusidestrconsts:liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Zobraziť uzly zdrojového kódu"

#: lazarusidestrconsts:dlgshowwarnings
msgid "Show Warnings"
msgstr "Zobraziť upozornenia"

#: lazarusidestrconsts:srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr "Zobraziť abstraktné metódy"

#: lazarusidestrconsts:lisa2pshowall
msgid "Show all"
msgstr "Zobraziť všetko"

#: lazarusidestrconsts:liscoshowallmessages
msgid "Show all messages"
msgstr "Zobraziť všetky správy"

#: lazarusidestrconsts:dlgshowprocserror
msgid "Show all procs on error"
msgstr "Zobraziť pri chyb všetky procedúry"

#: lazarusidestrconsts:dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Zobraziť border spacing"

#: lazarusidestrconsts:dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Zobraziť zatváracie tlačítka v poznámkovom bloku"

#: lazarusidestrconsts:srkmecshowcodecontext
msgid "Show code context"
msgstr "Zobraziť kontext kódu"

#: lazarusidestrconsts:dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Zobraziť preložené procedúry"

#: lazarusidestrconsts:dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Zobraziť voľby prekladača"

#: lazarusidestrconsts:dlgshowcaps
msgid "Show component captions"
msgstr "Zobraziť popisky komponentov"

#: lazarusidestrconsts:dlgshowconditionals
msgid "Show conditionals"
msgstr "Zobraziť podmienky"

#: lazarusidestrconsts:dlgshowdebuginfo
msgid "Show debug info"
msgstr "Zobraziť ladiace informácie"

#: lazarusidestrconsts:dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Zobraziť definované makrá"

#: lazarusidestrconsts:dlgshowedrhints
msgid "Show editor hints"
msgstr "Zobraziť rady editora"

#: lazarusidestrconsts:liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr ""

#: lazarusidestrconsts:dlgshoweverything
msgid "Show everything"
msgstr "Zobraziť všetko"

#: lazarusidestrconsts:dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Zobraziť informácie o spustiteľnom súbore (len Win32)"

#: lazarusidestrconsts:dlgshowgeneralinfo
msgid "Show general info"
msgstr "Zobraziť všeobecné informácie"

#: lazarusidestrconsts:lispldshowgloballinks
msgid "Show global links"
msgstr "Zobraziť globálne odkazy"

#: lazarusidestrconsts:dlgqshowgrid
msgid "Show grid"
msgstr "Zobraziť mriežku"

#: lazarusidestrconsts:dlgshowgutterhints
msgid "Show gutter hints"
msgstr ""

#: lazarusidestrconsts:lisshowhintsinobjectinspector
msgid "Show hints in Object Inspector"
msgstr "Zobraziť rady v Inšpektore objektov"

#: lazarusidestrconsts:lisshowidentifiers
msgid "Show identifiers"
msgstr "Zobraziť identifikátory"

#: lazarusidestrconsts:dlgshowlinenumbers
msgid "Show line numbers"
msgstr "Zobraziť čísla riadkov"

#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Zobraziť Správy pri zadstavení"

#: lazarusidestrconsts:dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Nezobrazovať nič (len chyby)"

#: lazarusidestrconsts:lisshowoldtaborder
msgid "Show old tab order"
msgstr "Zobraziť staré poradie záložiek"

#: lazarusidestrconsts:lisshowpackages
msgid "Show packages"
msgstr "Zobraziť balíčky"

#: lazarusidestrconsts:dlgshowscrollhint
msgid "Show scroll hint"
msgstr "Zobraziť rady posunu"

#: lazarusidestrconsts:dlgshowsummary
msgid "Show summary"
msgstr "Zobraziť súhrn"

#: lazarusidestrconsts:dlgshowtriedfiles
msgid "Show tried files"
msgstr "Zobraziť spracovávané súbory"

#: lazarusidestrconsts:lisshowunits
msgid "Show units"
msgstr "Zobraziť jednotky"

#: lazarusidestrconsts:dlgshowusedfiles
msgid "Show used files"
msgstr "Zobraziť použité jednotky"

#: lazarusidestrconsts:lispldshowuserlinks
msgid "Show user links"
msgstr "Zobraziť používateľské odkazy"

#: lazarusidestrconsts:lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""

#: lazarusidestrconsts:lissibling
msgid "Sibling"
msgstr "Súrodenec"

#: lazarusidestrconsts:lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signály"

#: lazarusidestrconsts:lissimplesyntax
msgid "Simple Syntax"
msgstr "Jednoduchá syntax"

#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Jednoduchá syntax (napr. * namiesto .*)"

#: lazarusidestrconsts:fdmsizeword
msgid "Size"
msgstr "Veľkosť"

#: lazarusidestrconsts:lisuidsize
msgid "Size:"
msgstr "Veľkosť:"

#: lazarusidestrconsts:lisccoskip
msgid "Skip"
msgstr "Preskočiť"

#: lazarusidestrconsts:liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Preskočiť volanie prekladača"

#: lazarusidestrconsts:lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Preskočiť súbor a pokračovať v načítaní"

#: lazarusidestrconsts:lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Preskočiť otváranie posledného projektu"

#: lazarusidestrconsts:lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Preskočiť tento balíček"

#: lazarusidestrconsts:rslanguageslovak
msgid "Slovak"
msgstr "Slovensky"

#: lazarusidestrconsts:dlgcosmaller
msgid "Smaller Code"
msgstr "Menší kód"

#: lazarusidestrconsts:dlgcosmartlinkable
msgid "Smart Linkable"
msgstr ""

#: lazarusidestrconsts:dlgsmarttabs
msgid "Smart tabs"
msgstr ""

#: lazarusidestrconsts:dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Prichytiť k pomocným čiaram"

#: lazarusidestrconsts:dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Prichytiť k mriežke"

#: lazarusidestrconsts:srvk_snapshot
msgid "Snapshot"
msgstr "Snímok"

#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Niektoré súbory boli na disku zmenené:"

#: lazarusidestrconsts:lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Prepáčte, zatiaľ neimplementované"

#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Prepáčte, tento typ zatiaľ nie je implementovaný"

#: lazarusidestrconsts:lispesortfiles
msgid "Sort files"
msgstr "Zoradiť súbory"

#: lazarusidestrconsts:lissortselsortselection
msgid "Sort selection"
msgstr "Zoradiť výber"

#: lazarusidestrconsts:lismenusortselection
msgid "Sort selection ..."
msgstr "Zoradiť výber ..."

#: lazarusidestrconsts:lisceomodesource
msgid "Source"
msgstr "Zdrojový kód"

#: lazarusidestrconsts:lismenuviewsourceeditor
msgid "Source Editor"
msgstr "Editor zdrojového kódu"

#: lazarusidestrconsts:srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Príkazy zdrojových poznámok"

#: lazarusidestrconsts:lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Zdroj a cieľ sú rovnaké: %s%s"

#: lazarusidestrconsts:lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Bod prerušenia zdrojového kódu"

#: lazarusidestrconsts:lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Adresár zdrojových kódov %s%s%s neexistuje."

#: lazarusidestrconsts:lissourcemodified
msgid "Source modified"
msgstr "Zdrojový kód zmenený"

#: lazarusidestrconsts:lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Zdrojový kód stránky %s%s%s bol zmenený. Uložiť?"

#: lazarusidestrconsts:lissourcepaths
msgid "Source paths"
msgstr "Cesty zdrojových kódov"

#: lazarusidestrconsts:lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Ukážka zdrojového kódu"

#: lazarusidestrconsts:dlgspacenotcosmos
msgid "Space"
msgstr "Medzera"

#: lazarusidestrconsts:lisspaceequally
msgid "Space equally"
msgstr ""

#: lazarusidestrconsts:srvk_space
msgid "Space key"
msgstr "Medzerník"

#: lazarusidestrconsts:rslanguagespanish
msgid "Spanish"
msgstr "Španielsky"

#: lazarusidestrconsts:lisuidsrc
msgid "Src"
msgstr ""

#: lazarusidestrconsts:dlgcostack
msgid "Stack"
msgstr "Zásobník"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Štandardné menu Upraviť"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Štandardné menu Súbor"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Štandardné menu Pomoc"

#: lazarusidestrconsts:lisstartwithanewproject
msgid "Start with a new project"
msgstr "Začať nový projekt"

#: lazarusidestrconsts:lisstarter
msgid "Starter"
msgstr "Štartér"

#: lazarusidestrconsts:lisoipstate
msgid "State"
msgstr "Stav"

#: lazarusidestrconsts:dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "V objektoch kľúčové slovo Static"

#: lazarusidestrconsts:lishintstepinto
msgid "Step Into"
msgstr "Krok dnu"

#: lazarusidestrconsts:lishintstepover
msgid "Step Over"
msgstr "Krok cez"

#: lazarusidestrconsts:lismenustepinto
msgid "Step into"
msgstr "Krok dnu"

#: lazarusidestrconsts:lismenustepover
msgid "Step over"
msgstr "Krok cez"

#: lazarusidestrconsts:lismenustop
msgid "Stop"
msgstr "Zastaviť"

#: lazarusidestrconsts:lisstopdebugging
msgid "Stop Debugging?"
msgstr "Zastaviť ladenie?"

#: lazarusidestrconsts:dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Zastaviť po počte chýb:"

#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Zastaviť aktuálne ladenie a prebudovať projekt?"

#: lazarusidestrconsts:lisstopdebugging2
msgid "Stop debugging?"
msgstr "Zastaviť ladenie?"

#: lazarusidestrconsts:liskmstopprogram
msgid "Stop program"
msgstr "Zastaviť program"

#: lazarusidestrconsts:lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Zastaviť ladenie?"

#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
msgid "Store dependency filename"
msgstr "Uchovať meno súboru závislosti"

#: lazarusidestrconsts:dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr ""

#: lazarusidestrconsts:lisstreamerror
msgid "Stream Error"
msgstr "Chyba streamu"

#: lazarusidestrconsts:lisstreamingerror
msgid "Streaming error"
msgstr "Chyba streamovania"

#: lazarusidestrconsts:lisstring
msgid "String"
msgstr ""

#: lazarusidestrconsts:liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Reťazcová konštanta"

#: lazarusidestrconsts:lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Reťazcová knštanta v zdrojovom kóde"

#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Reťazce s rovnakou hodnotou:"

#: lazarusidestrconsts:dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Odstrániť symboly zo spustiteľného súboru"

#: lazarusidestrconsts:lisstyle
msgid "Style"
msgstr ""

#: lazarusidestrconsts:lissubprocedure
msgid "Sub Procedure"
msgstr "Podprocedúra"

#: lazarusidestrconsts:lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Podprocedúra na rovnakej úrovni"

#: lazarusidestrconsts:dlgedbsubdir
msgid "Sub directory"
msgstr "Podadresár"

#: lazarusidestrconsts:dlgsubpropkcolor
msgid "Subpropertes"
msgstr "Podvlastnosti"

#: lazarusidestrconsts:lissuccess
msgid "Success"
msgstr "Úspešné"

#: lazarusidestrconsts:lisa2pswitchpaths
msgid "Switch Paths"
msgstr ""

#: lazarusidestrconsts:srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Prepnúť medzi formulárom a jednotkou"

#: lazarusidestrconsts:liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbol"

#: lazarusidestrconsts:dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbol za (.pp~)"

#: lazarusidestrconsts:dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbol pred (.~pp)"

#: lazarusidestrconsts:lissynedit
msgid "SynEdit"
msgstr "SynEdit"

#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - komponent editora použitý Lazarom. http://sourceforge.net/projects/synedit/"

#: lazarusidestrconsts:srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Kontrola syntaxe"

#: lazarusidestrconsts:dlgsyntaxoptions
msgid "Syntax options"
msgstr "Voľby syntaxe"

#: lazarusidestrconsts:dlgrunosystemvariables
msgid "System variables"
msgstr "Systémové premenné"

#: lazarusidestrconsts:dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Kompatibilné TP/BP 7.0"

#: lazarusidestrconsts:srvk_tab
msgid "Tab"
msgstr "Tabulátor"

#: lazarusidestrconsts:listaborderof
msgid "Tab Order of"
msgstr "Poradie pre tabulátor"

#: lazarusidestrconsts:dlgtabindent
msgid "Tab indents blocks"
msgstr "Tabulátor odsadzuje blok"

#: lazarusidestrconsts:fdmtaborder
msgid "Tab order..."
msgstr "Poradie pre tabulátor ..."

#: lazarusidestrconsts:liseotabwidths
msgid "Tab widths"
msgstr "Šírka tabulátora"

#: lazarusidestrconsts:dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulátory na medzery"

#: lazarusidestrconsts:lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Tabulátory výberu na medzery"

#: lazarusidestrconsts:lislazbuildqboapplcltarget
msgid "Target"
msgstr "Cieľ"

#: lazarusidestrconsts:listargetcpu
msgid "Target CPU"
msgstr "Cieľový CPU"

#: lazarusidestrconsts:lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Cieľový CPU:"

#: lazarusidestrconsts:listargetos
msgid "Target OS"
msgstr "Cieľový OS"

#: lazarusidestrconsts:liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Špecifické voľby cieľového OS"

#: lazarusidestrconsts:lislazbuildtargetos
msgid "Target OS:"
msgstr "Cieľový OS:"

#: lazarusidestrconsts:dlgtargetplatform
msgid "Target Platform:"
msgstr "Cieľová platforma:"

#: lazarusidestrconsts:lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Cieľový adresár:"

#: lazarusidestrconsts:dlgpotargetfilename
msgid "Target file name:"
msgstr "Meno cieľového súboru:"

#: lazarusidestrconsts:listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Meno cieľového súboru + parametre"

#: lazarusidestrconsts:listargetfilenameofproject
msgid "Target filename of project"
msgstr "Meno súboru cieľového projektu"

#: lazarusidestrconsts:dlgtargetproc
msgid "Target i386"
msgstr "Cieľ i386"

#: lazarusidestrconsts:lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Ukážka šablóny"

#: lazarusidestrconsts:dlgtplfname
msgid "Template file name"
msgstr "Meno súboru šablóny"

#: lazarusidestrconsts:lisctdtemplates
msgid "Templates"
msgstr "Šablóny"

#: lazarusidestrconsts:dlgccotest
msgid "Test"
msgstr "Test"

#: lazarusidestrconsts:listestdirectory
msgid "Test directory"
msgstr "Testovací adresár"

#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Testovací adresár \"%s\" nenájdený."

#: lazarusidestrconsts:dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Kontrola prekladača ..."

#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: Kontrola nastavenia prekladača ..."

#: lazarusidestrconsts:dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test: Kontrola dát prekladača ..."

#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "Test: Kontrola nastavení fpc"

#: lazarusidestrconsts:dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Test: Kontrola chýbajúcich ppu fpc"

#: lazarusidestrconsts:dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: Kontrola zdrojových kódov v ceste fpc ppu"

#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: Preklad prázdneho súboru"

#: lazarusidestrconsts:dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test: Preklad prázdneho súboru ..."

#: lazarusidestrconsts:lispkgfiletypetext
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts:dlgtextattributes
msgid "Text attributes"
msgstr "Atribúty textu"

#: lazarusidestrconsts:srkmcatediting
msgid "Text editing commands"
msgstr "Príkazy úpravy textu"

#: lazarusidestrconsts:srkmcatmarker
msgid "Text marker commands"
msgstr "Príkazy značkovania textu"

#: lazarusidestrconsts:srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Príkazy hľadania a nahradzovania textu"

#: lazarusidestrconsts:srkmcatselection
msgid "Text selection commands"
msgstr "Príkazy výberu textu"

#: lazarusidestrconsts:lisfindfiletexttofind
msgid "Text to find:"
msgstr "Hľadaný text:"

#: lazarusidestrconsts:lisdiffdlgtext1
msgid "Text1"
msgstr "Text1"

#: lazarusidestrconsts:lisdiffdlgtext2
msgid "Text2"
msgstr "Text2"

#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Adresár projektu %s, ktorý obsahuje súbory .dpr, dpk."

#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr ""

#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "FCL - FreePascal Component Library poskytuje základné triedy pre Object Pascal."

#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgstr "Adresár zdrojových kódov FPC \"%s\" vyzerá byť zlý. Bežne obsahuje adresáre ako rtl, packages, compiler, ... ."

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Zdrojový adresár Free Pascal SVN."

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Zdrojový adresár Free Pascal SVN. nevyžadované, ale zlepšuje hľadanie deklarácií a ladenie."

#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Prekladač FreePascal (meno súboru: %s) nebol nájdený.%sDoporučujeme nainštalovať fpc."

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Adresár projektu Free Pascal."

#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "Adresár·zdrojových kódov Free Pascal nebol nájdený.%sNiektoré funkcie kódu nebudú pracovať.%sDoporučujeme ich nainštalovať a nastaviť cestu v %sProstredie->Voľby prostredia->Súbory"

#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL - Lazarus Component Library obsahuje všetky základné komponenty pre úpravu formulárov."

#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Súbor LFM (formulár Lazarus) obsahuje neplatné vlastnosti. To znamená, napríklad, že obsahuje nejaké vlastnosti/triedy, ktoré neexistujú v aktuálnom LCL. Štandardná oprava je odstrániť tieto vlastnosti z lfm a ručne opraviť kód Pascalu."

#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "Adresár Lazara enbol nájdený.%sNebudete môcť vytvárať LCL aplikácie.%sProsím skontrolujte Prostredie->Voľby prostredia->Súbory"

#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Základný adresár Lazarus."

#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Maximálna verzia %s%s%s je neplatná.%sProsím použite formát hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad: 1.0.20.10"

#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximálna verzia je nižšia ako Minimálna."

#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Minimálna·verzia·%s%s%s·je·neplatná.%sProsím·použite·formát·hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad:·1.0.20.10"

#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "RTL - Run-Time Library je základ všetkých programov Free Pascal."

#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Nemožno nájsť testovací adresár:%s%s%s%s%s(viz voľby prostredia)"

#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Typ predka %s%s%s má rovnaké meno ako %sjednotka  %s%s%s."

#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Typ predka %s%s%s nie je platný identifikátor Pascalu."

#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Trieda %s%s%s je TControl a môže byť vložená len do ovládacieho prvku.%sNemožno vložiť."

#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Meno triedy %s%s%s a typ predka %s%s%s sú rovnaké."

#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Meno triedy %s%s%s už existuje v %sBalíčku %s%sSúbor: %s%s%s"

#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Meno triedy %s%s%s má rovnaké meno triedy ako %sjednotka %s%s%s."

#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Meno triedy %s%s%s nie je platný identifikátor Pascalu."

#: lazarusidestrconsts:listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "CodeTools našiel chybu:%s%s%s"

#: lazarusidestrconsts:listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Príkaz za %s%s%s nie je spustiteľný."

#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Príkaz pred publikovaním je neplatný:%s%s%s%s"

#: lazarusidestrconsts:lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "Preložená jednotka FPC %s.ppu nebola nájdená.%sToto zvyčajne znamená, že Váš fpc.cfg obsahuje chybu alebo je Vaša inštalácia FPC poškodená."

#: lazarusidestrconsts:lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Prekladač \"%s\" nie je spustiteľný súbor.%sDetaily: %s"

#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Súbor prekladača \"%s\" nie je spustiteľný."

#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Súbor prekladača pre balíček %s nie je platný spustiteľný súbor:%S%S"

#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "Editor komponentu triedy %s%s%s vytvoril chybu:%s%s%s%s"

#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Editor komponentu triedy %s%s%s%svyvolaný príkazom #%s %s%s%s%svytvoril chybu:%s%s%s%s"

#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Aktuálny adresár zdrojových kódov Free Pascal %s%s%s%snevyzerá správne.%sSkontrolujte Prostredie->Voľby prostredia->Súbory"

#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Aktuálny adresár zdrojových kódov Free %s%s%s%snevyzerá správne.%sZvoľte OK pre nastavenie predvoleného %s%s%s.%sInak skontrolujte Prostredie->Voľby prostredia->Súbory"

#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Aktuálny adresár Lazara %s%s%s%snevyzerá správne.%sBez neho nebudete môcť vytvárať LCL aplikácie.%sSkontrolujte Prostredie->Voľby·prostredia->Súbory"

#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Aktuálny adresár Lazara %s%s%s%snevyzerá správne.%sBez neho nebudete môcť vytvárať LCL aplikácie.%sZvoľte OK pre nastavenie predvoleného %s%s%s.%sInak skontrolujte Prostredie->Voľby·prostredia->Súbory"

#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Aktuálne meno súboru prekladača %s%s%s%snie je platný spustiteľný súbor.%sZvoľte OK nastavenie predvoleného %s%s%s.%sInak skontrolujte Prostredie->Voľby·prostredia->Súbory"

#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "Aktuálne menu súboru prekladača %s%s%s%snie je platný spustiteľný súbor.%sProsím, skontrolujte Prostredie -> Voľby prostredia -> Súbory"

#: lazarusidestrconsts:lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Aktuálny font editora nepodporuje UTF-8, ale systém vyzerá, že ho používa.%sTo znamená, že ne ASCII znaky môžu byť zobrazené nesprávne.%sMôžete si vybrať iný font vo voľbách editora."

#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Aktuálna cesta jednotiek pre súbor %s%s%s%s je%s%s%s%s.%s%sCesta k jednotkám LCL %s%s%s chýba.%s%sRada pre neskúsených:%sVytvorte aplikáciu Lazarus a vložte súbor do adresára projektu."

#: lazarusidestrconsts:lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Dátumy .ppu·súborov FPC sú rozdielne o viac ako hodinu.%sTo môže znamenať, že sú z rôznych inštalácií.%sSúbor1: %s%sSúbor2: %s"

#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "Debuger %s%s%s%sneexistuje, alebo nie je spustiteľný.%s%sPozrite Prostredie -> Voľby debugera"

#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Súbor debugera \"%s\" nie je spustiteľný."

#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Závislosť %s%s%s nebola nájdená.%sProsím zvoľte existujúci balíček."

#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Cieľový adresár  %s%s%s%s neexistuje."

#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Adresár %s%s%s nie je viac potrebný v ceste jednotiek.%sOdstrániť ho?"

#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Adresár %s%s%s zatiaľ nie je v ceste jednotiek.%sPridať ho?"

#: lazarusidestrconsts:dlgthedirectory
msgid "The directory \""
msgstr "Adresár \""

#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Súbor %s vyzerá byť programovým súborom existujúceho projektu Lazarus."

#: lazarusidestrconsts:listhefile
msgid "The file %s%s%s"
msgstr "Súbor %s%s%s"

#: lazarusidestrconsts:listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Súbor %s%s%s je symbolický odkaz. %s%sOtvoriť %s%s%s namiesto neho?"

#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Súbor %s%s%s už je v balíčku."

#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "Súbor %s%s%s nie je Delphi projekt (.dpr)"

#: lazarusidestrconsts:listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "Súbor %s%s%s nie je jednotka Delphi."

#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Súbor %s%s%s nie je balíček Lazarus."

#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Súbor %s%s%s je časťou aktuálneho projektu.%sNie je dobrý nápad zdieľať súbory medzi projektmi a balíčkami."

#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Súbor %s%s%s%suž je v balíčku %s."

#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Súbor %s%s%s%smomentálne nie je v ceste jednotiek balíčka.%s%sPridať %s%s%s do cesty jednotiek?"

#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Súbor %s%s%s%sbalíčka %s chýba."

#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Súbor %s%s%s%sbalíčka %s treba najprv uložiť."

#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Súbor %s%s%s%svyzerá byť programom. Zatvoriť aktuálny projekt a vytvoriť nový projekt Lazarus z tohoto programu?%s\"Nie\" načíta súbor ako bežný zdrojový kód."

#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Súbor %s%s%s%sbol nájdený v jednom zo zdrojových adresárov balíčka  %s a vyzerá ako preložená jednotka. Preložené jednotky majú byť vo výstupnom adresári balíčka, inak môžu·mať ostatné balíčky problém s jeho použitím.%s%sZmazať súbor?"

#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Súbor %s%s%s%snebol nájdený.%sChcete ho nájsť sám?%s"

#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Súbor %s%s%s%snebol nájdený.%sZvoľte Ignorovať pre pokračovanie v načítaní projektu,%sZvoľte Zrušiť pre zastavenie načítania."

#: lazarusidestrconsts:uefilerotext1
msgid "The file \""
msgstr "Súbor \""

#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Meno súboru %s%s%s je časťou aktuálneho projektu.%sProjekty a balíčky nemôžu zdieľať súbory."

#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Meno súboru %s%s%s je použité %sbalíčka %s%s%s%sv súbore %s%s%s."

#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr ""

#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr ""

#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr ""

#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Zlyhalo načítanie týchto balíčkov:"

#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Zlyhalo načítanie týchto balíčkov:"

#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
msgstr ""

#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Hostiteľská aplikácia %s%s%s nie je spustiteľná."

#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr ""

#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Adresár Lazarus \"%s\" nevyzerá správne. Štandardne obsahuje adresáre ako lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Súbor make \"%s\" nie je spustiteľný."

#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Maximálna verzia %s%s%s nie je platná verzia balíčka.%s(platný príklad 1.2.3.4)"

#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Minimálna verzia %s%s%s nie je platná verzia balíčka.%s(platný príklad 1.2.3.4)"

#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Meno %s%s%s nie je platný identifikátor Pascalu."

#: lazarusidestrconsts:lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Meno \"%s\" nie je platný identifikátor Pascalu."

#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Nová jednotka zatiaľ nie je v ceste hľadaní jednotiek.%sPridať adresár %s?"

#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Balíček %s je balíčkom len pre dobu behu. %sBalíčky len pre dobu behu nemožno inštalovať do IDE."

#: lazarusidestrconsts:lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Balíček %s je len na čítanie."

#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Balíček %s je vyžadovaný balíčkom %s, ktorý je označený pre inštaláciu.%sViz graf balíčkov."

#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Balíček %s vlastní súbor %s%s%s%s.%sMá byť súbor premenovaný aj v balíčku?"

#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Balíček %s%s%s pri inštalácii zlyhal.%sOdstrániť ho z inštalačného zoznamu?"

#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr ""

#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr ""

#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr ""

#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Balíček %s%s%s bol označený na inštaláciu.%sMomentálne Lazarus podporuje len staticky pripojené balíčky, preto inštalácia vyžaduje prebudovanie a reštart Lazarus.%s%sChcete teraz prebudovať Lazarus?"

#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Balíček %s%s%s bol označený na odinštaláciu.%sMomentálne Lazarus podporuje builen staticky pripojené balíčky, preto odinštalácia vyžaduje prebudovanie a reštart Lazarus.%s%sChcete teraz prebudovať Lazarus?"

#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""

#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Meno súboru balíčka %s%s%s v%s%s%s%s nie je platné meno balíčka Lazarus."

#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Balíček už má závislosť na balíčku %s%s%s."

#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr ""

#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr ""

#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr ""

#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr ""

#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr ""

#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Program %smake%s nebol nájdený.%sTento nástroj je potrebný na prebudovanie Lazarus.%s"

#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr ""

#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr ""

#: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin
msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically."
msgstr ""

#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr ""

#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Projekt vyžaduje balíček %s%s%s.%sAle tento nebol nájdený. Pozrite Projekt -> Inšpektor projektu."

#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr ""

#: lazarusidestrconsts:lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr ""

#: lazarusidestrconsts:listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr ""

#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Jednotka %s existuje dvakrát v ceste jednotiek %s:"

#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""

#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr ""

#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
msgstr ""

#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr ""

#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr ""

#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr ""

#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr ""

#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr ""

#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Meno jednotky %s%s%s%sa meno súboru %s%s%s sú rôzne."

#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Meno jednotky %s%s%s už existuje v balíčku:%s%s"

#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Meno jednotky %s%s%s už v tomto balíčku existuje."

#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
msgid "The unitname is not a valid pascal identifier."
msgstr "Meno jednotky nie je platný identifikátor Pascalu"

#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Meno jednotky je použité, keď IDE pridáva do klauzulí uses."

#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""

#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Ďalšie funkcie sú vo vyskakujúcom menu"

#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""

#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr ""

#: lazarusidestrconsts:lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""

#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr ""

#: lazarusidestrconsts:lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""

#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr ""

#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr ""

#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr ""

#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr ""

#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Jednotka s menom %s%s%s už v projekte existuje.%s"

#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr ""

#: lazarusidestrconsts:listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr ""

#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr ""

#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr ""

#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Už existuje jednotka s týmto menom.%sSúbor: %s"

#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr ""

#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr ""

#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr ""

#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Nie je definovaný debuger.%sNastavenie bodu prerušenia nemá význam, dokiaľ nenastavíte debuger v dialógu Voľby debugera v menu."

#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr ""

#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr ""

#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr ""

#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr ""

#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr ""

#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr ""

#: lazarusidestrconsts:lisresourcefilecomment
msgid "This is an automatically generated lazarus resource file"
msgstr "Toto je automaticky generovaný súbor zdrojov Lazarus"

#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr ""

#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Toto je súrodenec prvku, ku ktorého spodnej strane je ukotvený. Ponechajte prázdne pre rodiča."

#: lazarusidestrconsts:lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·ľavej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"

#: lazarusidestrconsts:lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·pravej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"

#: lazarusidestrconsts:listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·hornej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"

#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Vyzerá to ako pascalovský súbor.%sOdporúčame v·mene použiť malé písmená, aby ste predišli problémom na niektorých súborových systémoch a rôznych prekladačoch.%sPremenovať malými písmenami?"

#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Táto metóda nemôže byť prepísaná, pretože je definovaná v aktuálnej triede"

#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Tento balíček je nainštalovaný, ale súbor lpk nebol nájdený. Všetky jeho komponenty sú deaktivované. Prosím opravte to."

#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Tento balíček poskytuje to isté ako balíčky:"

#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr "Tento zdrojový kód je použitý len na preloženie a nainštalovanie tohoto balíčka."

#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Tento príkaz nemôže byť vytiahnutý.%sProsím vyberte nejaký kód pre vytiahnutie procedúry/metódy."

#: lazarusidestrconsts:listhiswillhappencontinue
msgid "This will happen:%s%s%sContinue?"
msgstr "Toto nastane:%s%s%sPokračovať?"

#: lazarusidestrconsts:lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Vlákno"

#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titulok a meno súboru sú vyžadované"

#: lazarusidestrconsts:dlgpotitle
msgid "Title:"
msgstr "Titulok:"

#: lazarusidestrconsts:lismenuviewtodolist
msgid "ToDo List"
msgstr "Zoznam ToDo"

#: lazarusidestrconsts:listodolistoptions
msgid "ToDo options..."
msgstr "Voľby ToDo ..."

#: lazarusidestrconsts:lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Prepnúť formulár/jednotka"

#: lazarusidestrconsts:srkmectogglemode
msgid "Toggle Mode"
msgstr "Režim prepínania"

#: lazarusidestrconsts:liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Prepnúť medzi Jednotkou a formulárom"

#: lazarusidestrconsts:lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Prepnúť formulár/jednotka"

#: lazarusidestrconsts:liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Prepnúť zobrazenie Body prerušenia"

#: lazarusidestrconsts:liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Prepnúť zobrazenie Zásobník volaní"

#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Prepnúť zobrazenie Prieskumník kódu"

#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Prepnúť zobrazenie Výstup debugera"

#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Prepnúť zobrazenie Editor dokumentácie"

#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Prepnúť zobrazenie tlačítiek IDE"

#: lazarusidestrconsts:liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "prepnúť zobrazenie Lokálne premenné"

#: lazarusidestrconsts:liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Prepnúť zobrazenie Správy"

#: lazarusidestrconsts:liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Prepnúť zobrazenie Inšpektor obejktov"

#: lazarusidestrconsts:liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Prepnúť zobrazenie Výsledky hľadania"

#: lazarusidestrconsts:liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Prepnúť zobrazenie Editora zdrojových kódov"

#: lazarusidestrconsts:liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Prepnúť zobrazenie Pozorovaní"

#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Prepnúť zobrazenie Palety komponentov"

#: lazarusidestrconsts:liscodetempltoken
msgid "Token:"
msgstr "Token:"

#: lazarusidestrconsts:lisctdefstools
msgid "Tools"
msgstr "Nástroje"

#: lazarusidestrconsts:srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Príkazy menu Nástroje"

#: lazarusidestrconsts:dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr ""

#: lazarusidestrconsts:dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr ""

#: lazarusidestrconsts:listop
msgid "Top"
msgstr ""

#: lazarusidestrconsts:listopanchoring
msgid "Top anchoring"
msgstr "Horné zarovnanie"

#: lazarusidestrconsts:listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Horný·okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·nad·prvkom."

#: lazarusidestrconsts:listopspaceequally
msgid "Top space equally"
msgstr ""

#: lazarusidestrconsts:dlgtoppos
msgid "Top:"
msgstr "Hore:"

#: lazarusidestrconsts:listops
msgid "Tops"
msgstr "Horné okraje"

#: lazarusidestrconsts:dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Odstrániť zvyšné medzery"

#: lazarusidestrconsts:lismenutemplatetutorial
msgid "Tutorial"
msgstr "Príručka"

#: lazarusidestrconsts:dlgenvtype
msgid "Type"
msgstr "Typ"

#: lazarusidestrconsts:lisuidtype
msgid "Type:"
msgstr "Typ:"

#: lazarusidestrconsts:liscetypes
msgid "Types"
msgstr "Typy"

#: lazarusidestrconsts:dlgcdtuppercase
msgid "UPPERCASE"
msgstr "VEĽKÉ PÍSMENÁ"

#: lazarusidestrconsts:rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukrajinsky"

#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Nemožno konvertovať binárny strom na text"

#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Nemožno kopírovať komponenty do schránky"

#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Do projektu nemožno pridať %s, pretože projekt už obsahuje jednotku s rovnakým menom."

#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nemožno pridať resource T%s:FORMDATA do súboru resource %s%s%s%s.%sPravdepodobne syntaktická chyba."

#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nemožno pridať komentár hlavičky resource do súboru resource %s%s%s%s.%sPravdepodobne syntaktická chyba."

#: lazarusidestrconsts:lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Nemožno zálohovať súbor %s%s%s na %s%s%s!"

#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Nemožno zmeniť zoznam automaticky vytváraných formulárov v zdrojovom kóde programu.%sNajprv opravte chyby."

#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Nemožno vyčistiť %s%s%s.%sProsím skontrolujte prístupové práva."

#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Nemožno vyčistiť cieľový adresár"

#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Nemožno konvertovať text komponentu do binárneho formátu:%s%s"

#: lazarusidestrconsts:lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Nemožno konvertovať súbor %s%s%s%sChyba: %s"

#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Nemožno konvertovať lfm na lrs a zapísať súbor lrs"

#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Nemožno konvertovať textové dáta formulára súboru %s%s%s%s%sdo binárneho streamu. (%s)"

#: lazarusidestrconsts:lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Nemožno kopírovať súbor"

#: lazarusidestrconsts:lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Nemožno prekopírovať súbor %s%s%s%sdo %s%s%s"

#: lazarusidestrconsts:lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Nemožno prekopírovať súbor %s%s%s%sdo %s%s%s."

#: lazarusidestrconsts:lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "textového vytvoriť testovací súbor"

#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "textového vytvoriť testovací pascalovský súbor \"%s\"."

#: lazarusidestrconsts:lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Nemožno vytvoriť záložný adresár %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Nemožno vytvoriť adresár"

#: lazarusidestrconsts:lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Nemožno vytvoriť adresár %s%s%s"

#: lazarusidestrconsts:lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Nemožno vytvoriť adresár %s%s%s."

#: lazarusidestrconsts:lisunabletocreatefile
msgid "Unable to create file"
msgstr "Nemožno vytvoriť súbor"

#: lazarusidestrconsts:lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Nemožno vytvoriť súbor %s%s%s"

#: lazarusidestrconsts:lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Nemožno vytvoriť súbor %s%s%s."

#: lazarusidestrconsts:lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Nemožno vytvoriť súbor %s%s%s%s"

#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Nemožno vytvoriť novú metódu, prosím opravte chyby zobrazené v okne správ."

#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Nemožno vytvoriť výstupný adresár %s%s%s%sbalíčka %s."

#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Nemožno vytvoriť zdrojový adresár %s%s%s%spre balíček %s."

#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Nemožno vytvoriť cieľový adresár pre Lazarus:%s%s%s%s.%sTento adresár je potebný pre nové, zmenené Lazarus IDE s vašimi balíčkami."

#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Nemožno vytvoriť dočasný LFM bufer"

#: lazarusidestrconsts:lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Nemožno zmazať poškodený súbor %s%s%s"

#: lazarusidestrconsts:lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Nemožno zmazať súbor"

#: lazarusidestrconsts:lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Nemožno zmazať súbor %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Nemožno zmazať starý stavový súbor %s%s%s%sbalíčka %s."

#: lazarusidestrconsts:lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Nemožno nájsť %s v streame LFM."

#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Nemožno nájsť sekciu ResourceString v tejto alebo v niektorej z použitých jednotiek."

#: lazarusidestrconsts:lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Nemožno nájsť platné meno triedy v %s%s%s"

#: lazarusidestrconsts:lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Nemožno nájsť súbor %s%s%s."

#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr ""

#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Nemožno nájsť metódu, prosím opravte chyby zobrazené v okne správ."

#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Nemožno nájsť jednotku triedy komponentu %s%s%s."

#: lazarusidestrconsts:lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Nemožno získať zmeny editora."

#: lazarusidestrconsts:lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "Nemožno získať dátum súboru %s."

#: lazarusidestrconsts:lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Nemožno získať zdrojový kód pre návrhára."

#: lazarusidestrconsts:lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Nemožno načítať súbor"

#: lazarusidestrconsts:lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Nemožno načítať súbor %s%s%s."

#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Nemožno načítať starý resource súbor.%sResource súbor je prvý include súbor v sekcii %sinitialization.%sNapríklad {$I %s.lrs}.%sPravdepodobne syntaktická chyba."

#: lazarusidestrconsts:lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Nemožno načítať balíček"

#: lazarusidestrconsts:lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Nemožno načítať balíček %s%s%s"

#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Nemožno načítať triedu komponentu %s%s%s, pretože závisí sama na sebe."

#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Nemožno otvoriť návrhára.%sTrieda %s nie je potomkom triedy ako TForm alebo TDataModule."

#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Nemožno otvoriť balíček %s%s%s.%sTento balíček bol označený na inštaláciu."

#: lazarusidestrconsts:lisunabletoreadfile
msgid "Unable to read file"
msgstr "Nemožno čítať súbor"

#: lazarusidestrconsts:lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Nemožno čítať súbor %s%s%s!"

#: lazarusidestrconsts:lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Nemožno čítať súbor %s%s%s%sChyba: %s"

#: lazarusidestrconsts:lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Nemožno čítať súbor %s%s%s."

#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Nemožno čítať súbor balíčka  %s%s%s.%sChyba: %s"

#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Nemožno čítať stavový súbor %s projektu %s%sChyba: %s"

#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nemožno čítať stavový súbor %s%s%s%sbalíčka %s.%sChyba: %s"

#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Nemožno odstrániť starý záložný súbor %s%s%s!"

#: lazarusidestrconsts:lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Nemožno premenovať poškodený súbor %s%s%s%sna %s%s%s"

#: lazarusidestrconsts:lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Nemožno premenovať súbor"

#: lazarusidestrconsts:lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Nemožno premenovať súbor %s%s%s na %s%s%s!"

#: lazarusidestrconsts:lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Nemožno premenovať súbor %s%s%s%sna %s%s%s."

#: lazarusidestrconsts:lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Nemožno premenovať formulár v zdrojovom kóde"

#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Nemožno premenovať metódu, prosím opravte chyby zobrazené v okne správ."

#: lazarusidestrconsts:lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Nemožno premenovať premennú v zdrojovom kóde."

#: lazarusidestrconsts:lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Nemožno spustiť nástroj %s%s%s:%s%s"

#: lazarusidestrconsts:lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Nemožno uložiť súbor %s%s%s"

#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Nemožno nastaviť AnchorSide prvku"

#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Nemožno zobraziť abstraktné metódy tejto triedy, pretože"

#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Nemožno zobraziť metódu, prosím opravte chyby zobrazené v okne správ."

#: lazarusidestrconsts:lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Nemožno streamovať %s:T%s."

#: lazarusidestrconsts:lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Nemožno streamovať vybraté komponenty"

#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Nemožno streamovať vybraté komponenty"

#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Nemožno transformovať binárny stream komponentu %s:T%s na text."

#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Nemožno vytvoriť príkaz CreateForm v zdrojovom kóde projektu"

#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr ""

#: lazarusidestrconsts:lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Nemožno zapísať %s%s%s"

#: lazarusidestrconsts:lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Nemožno zapísať %s%s%s%s%s."

#: lazarusidestrconsts:lisunabletowritefile
msgid "Unable to write file"
msgstr "Nemožno zapisovať do súboru"

#: lazarusidestrconsts:lisunabletowritefile2
msgid "Unable to write file %s%s%s"
msgstr "Nemožno zapisovať do súboru %s%s%s"

#: lazarusidestrconsts:lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Nemožno zapísať súbor %s%s%s%sChyba: %s"

#: lazarusidestrconsts:lisunabletowritefilename
msgid "Unable to write file %s%s%s."
msgstr "Nemožno zapisovať do súboru %s%s%s."

#: lazarusidestrconsts:lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Nemožno zapísať súbor \"%s\":%s"

#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Nemožno zapísať balíček %s%s%s%sdo súboru %s%s%s.%sChyba: %s"

#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nemožno zapísať stavový súbor %s%s%s%sbalíčka %s.%sChyba: %s"

#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Nemožno zapísať stavový súbor projektu %s%sChyba: %s"

#: lazarusidestrconsts:lisunabletowritetofile2
msgid "Unable to write to file %s%s%s"
msgstr "Nemožno zapisovať do súboru %s%s%s"

#: lazarusidestrconsts:lisunabletowritetofile
msgid "Unable to write to file %s%s%s!"
msgstr "Nemožno zapisovať do súboru %s%s%s!"

#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Nemožno zapísať xml stream do %s%sChyba: %s"

#: lazarusidestrconsts:dlguncertopt
msgid "Uncertain Optimizations"
msgstr ""

#: lazarusidestrconsts:lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Odkomentovať výber"

#: lazarusidestrconsts:liscodetoolsdefsundefine
msgid "Undefine"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr ""

#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr ""

#: lazarusidestrconsts:dlgedunder
msgid "Underline"
msgstr "Podčiarknuté"

#: lazarusidestrconsts:lismenuundo
msgid "Undo"
msgstr "Späť"

#: lazarusidestrconsts:dlgundoaftersave
msgid "Undo after save"
msgstr "Späť po uložení"

#: lazarusidestrconsts:dlgundolimit
msgid "Undo limit"
msgstr "Limit vrátenia"

#: lazarusidestrconsts:srkmecblockunindent
msgid "Unindent block"
msgstr "Zmenšiť odsadenie bloku"

#: lazarusidestrconsts:lismenuunindentselection
msgid "Unindent selection"
msgstr "Zmenšiť odsadenie výberu"

#: lazarusidestrconsts:lispckedituninstall
msgid "Uninstall"
msgstr "Odinštalovať"

#: lazarusidestrconsts:lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Odinštalovať pri ďalšom štarte"

#: lazarusidestrconsts:lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Odinštalovať balíček %s?"

#: lazarusidestrconsts:lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Odinštalovať balíček?"

#: lazarusidestrconsts:lisuninstallselection
msgid "Uninstall selection"
msgstr "Odinštalovať výber"

#: lazarusidestrconsts:lispkgfiletypeunit
msgid "Unit"
msgstr "Jednotka"

#: lazarusidestrconsts:lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Jednotka %s%s%s bola zmenená  Uložiť?"

#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Jednotka %s%s%s bola z balíčka odstránená"

#: lazarusidestrconsts:lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Meno súboru jednotky:"

#: lazarusidestrconsts:uemshowunitinfo
msgid "Unit Info"
msgstr "Informácie o jednotke"

#: lazarusidestrconsts:lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Neplatné meno jednotky"

#: lazarusidestrconsts:lisa2punitname
msgid "Unit Name:"
msgstr "Meno jednotky:"

#: lazarusidestrconsts:lisaf2punitname
msgid "Unit Name: "
msgstr "Meno jednotky:"

#: lazarusidestrconsts:lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Výstupný adresár jednotky"

#: lazarusidestrconsts:lispkgdefsunitpath
msgid "Unit Path"
msgstr "Cesta jednotky"

#: lazarusidestrconsts:dlgcounitstyle
msgid "Unit Style:"
msgstr "Štýl jednotky:"

#: lazarusidestrconsts:dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Závislosti jednotky"

#: lazarusidestrconsts:lisa2punitfilename
msgid "Unit file name:"
msgstr "Meno súboru jednotky:"

#: lazarusidestrconsts:lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identifikátor jednotky existuje"

#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Meno jednotky už existuje"

#: lazarusidestrconsts:lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Meno jednotky začína s ..."

#: lazarusidestrconsts:lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Meno jednotky obsahuje ..."

#: lazarusidestrconsts:lisunitnotfound
msgid "Unit not found"
msgstr "Jednotka nenájdená"

#: lazarusidestrconsts:lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Jednotka nenájdená: %s%s%s"

#: lazarusidestrconsts:dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Výstupný adresár jednotky (-FU):"

#: lazarusidestrconsts:lisunitpaths
msgid "Unit paths"
msgstr "Cesty jednotiek"

#: lazarusidestrconsts:lisunitlfmfile
msgid "Unit: %s%sLFM file: %s"
msgstr "Jednotka: %s%sLFM súbor: %s"

#: lazarusidestrconsts:lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Meno jednotky už v existuje"

#: lazarusidestrconsts:lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Meno jednotky už v projekte existuje"

#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Meno jednotky a meno súboru nesúhlasia.%sPríklad: unit1.pas a Unit1"

#: lazarusidestrconsts:lispeunitname
msgid "Unitname:"
msgstr "Meno jednotky:"

#: lazarusidestrconsts:lisunitsnotfound2
msgid "Units not found"
msgstr "Jednotky nenájdené"

#: lazarusidestrconsts:lismenuviewunits
msgid "Units..."
msgstr "Jednotky ..."

#: lazarusidestrconsts:srvk_unknown
msgid "Unknown"
msgstr "Neznámy"

#: lazarusidestrconsts:lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Neuložený balíček"

#: lazarusidestrconsts:dlgupword
msgid "Up"
msgstr ""

#: lazarusidestrconsts:lisceoupdate
msgid "Update"
msgstr "Aktualizoavť"

#: lazarusidestrconsts:lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Aktualizovať/Prebudovať"

#: lazarusidestrconsts:lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Výber na veľké písmená"

#: lazarusidestrconsts:lispckoptsusage
msgid "Usage"
msgstr "Použitie"

#: lazarusidestrconsts:dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Použiť ANSI reťazce"

#: lazarusidestrconsts:dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "Použiť zväzok aplikácií pre spustenie a ladenie (lem darwin)"

#: lazarusidestrconsts:lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Použiť vylučovací filter"

#: lazarusidestrconsts:dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Použiť jednotku Heaptrc"

#: lazarusidestrconsts:lisuseincludefilter
msgid "Use Include Filter"
msgstr "Použiť zahŕňací filter"

#: lazarusidestrconsts:dlgusecustomconfig
msgid "Use addional Compiler Config File"
msgstr "Použiť doplnkový konfiguračný súbor prekladača"

#: lazarusidestrconsts:dlgedusedefcolor
msgid "Use default color"
msgstr "Použiť predvolené farby"

#: lazarusidestrconsts:dlgrunousedisplay
msgid "Use display"
msgstr "Použiť displej"

#: lazarusidestrconsts:dlguselaunchingapp
msgid "Use launching application"
msgstr "Použiť spúšťaciu aplikáciu"

#: lazarusidestrconsts:dlgpousemanifest
msgid "Use manifest file to enable themes (windows only)"
msgstr "Použiť súbor manifestu, pre zapnutie tém (len Windows)"

#: lazarusidestrconsts:dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Použiť štandardný konfiguračný súbor prekladača (fpc.cfg)"

#: lazarusidestrconsts:dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Použiť zvýrazňovanie syntaxe"

#: lazarusidestrconsts:lispkgmanguseunit
msgid "Use unit"
msgstr "Použiť jednotku"

#: lazarusidestrconsts:rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Použi nastavenia správcu okien"

#: lazarusidestrconsts:lisplduser
msgid "User"
msgstr "Používateľ"

#: lazarusidestrconsts:srkmecuserfirst
msgid "User First"
msgstr "Najprv používateľské"

#: lazarusidestrconsts:dlgedcustomext
msgid "User defined extension"
msgstr "Používateľom definovaná prípona"

#: lazarusidestrconsts:dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Používateľská prípona (.pp.xxx)"

#: lazarusidestrconsts:dlgrunouseroverrides
msgid "User overrides"
msgstr "Používateľské prepisuje"

#: lazarusidestrconsts:lisceuses
msgid "Uses"
msgstr ""

#: lazarusidestrconsts:dlgvaluecolor
msgid "Value"
msgstr "Hodnota"

#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Hodnota ako súborové cesty"

#: lazarusidestrconsts:liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Hodnota ako text"

#: lazarusidestrconsts:dlgrunovariable
msgid "Variable"
msgstr "Premenná"

#: lazarusidestrconsts:lisctdefvariablename
msgid "Variable Name"
msgstr "Meno premennej"

#: lazarusidestrconsts:dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Predpona premennej"

#: lazarusidestrconsts:liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Premenná:"

#: lazarusidestrconsts:lisctdefvariable
msgid "Variable: %s"
msgstr "Premenná: %s"

#: lazarusidestrconsts:liscevariables
msgid "Variables"
msgstr "Premenné"

#: lazarusidestrconsts:dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Výrečnosť počas prekladu"

#: lazarusidestrconsts:lisversion
msgid "Version"
msgstr "Verzia"

#: lazarusidestrconsts:versioninfotitle
msgid "Version Info"
msgstr "Informácie o verzii"

#: lazarusidestrconsts:rsversionnumbering
msgid "Version numbering"
msgstr "Číslovanie verzií"

#: lazarusidestrconsts:rsversion
msgid "Version:"
msgstr "Verzia:"

#: lazarusidestrconsts:lisvertical
msgid "Vertical"
msgstr "Zvislo"

#: lazarusidestrconsts:dlggridyhint
msgid "Vertical grid step size"
msgstr "Zvislá veľkosť kroku mriežky"

#: lazarusidestrconsts:lismenuviewanchoreditor
msgid "View Anchor Editor"
msgstr "Zobraziť Editor ukotvenia"

#: lazarusidestrconsts:uemviewcallstack
msgid "View Call Stack"
msgstr "Zobraziť Zásobník volaní"

#: lazarusidestrconsts:srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Zobraziť Prieskumník kódu"

#: lazarusidestrconsts:lismenuviewcomponentpalette
msgid "View Component Palette"
msgstr "Zobraziť Paletu komponentov"

#: lazarusidestrconsts:srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Zobraziť Editor dokumentácie"

#: lazarusidestrconsts:lishintviewforms
msgid "View Forms"
msgstr "Zobraziť formuláre"

#: lazarusidestrconsts:lismenuviewidespeedbuttons
msgid "View IDE speed buttons"
msgstr "Zobraziť tlačítka IDE"

#: lazarusidestrconsts:lismenuviewjumphistory
msgid "View Jump-History ..."
msgstr "Zobraziť Históriu skokov ..."

#: lazarusidestrconsts:srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Zobraziť Inšpektor objektov"

#: lazarusidestrconsts:lispckeditviewpackgesource
msgid "View Package Source"
msgstr "Zobraziť zdrojový kód balíčka"

#: lazarusidestrconsts:lisviewprojectunits
msgid "View Project Units"
msgstr "Zobraziť jednotky projektu"

#: lazarusidestrconsts:srkmectogglesearchresults
msgid "View Search Results"
msgstr "Zobraziť Výsledky hľadania"

#: lazarusidestrconsts:lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Zobraziť zdrojový kód (.lfm)"

#: lazarusidestrconsts:srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Zobraziť editor zdrojového kódu"

#: lazarusidestrconsts:lispeviewtodolist
msgid "View ToDo list"
msgstr "Zobraziť zoznam ToDo"

#: lazarusidestrconsts:lismenuviewunitdependencies
msgid "View Unit Dependencies"
msgstr "Zobraziť závislosti jednotky"

#: lazarusidestrconsts:liskmviewunitinfo
msgid "View Unit Info"
msgstr "Zobraziť info o jednotke"

#: lazarusidestrconsts:lismenuviewunitinfo
msgid "View Unit Information"
msgstr "Zobraziť info o jednotke"

#: lazarusidestrconsts:lishintviewunits
msgid "View Units"
msgstr "Zobraziť jednotky"

#: lazarusidestrconsts:srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Zobraziť Editor ukotvenia"

#: lazarusidestrconsts:srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Zobraziť body prerušenia"

#: lazarusidestrconsts:srkmectogglecallstack
msgid "View call stack"
msgstr "Zobraziť Zásobník volaní"

#: lazarusidestrconsts:srkmectogglecodebrowser
msgid "View code browser"
msgstr "Zobraziť Prehliadač kódu"

#: lazarusidestrconsts:srkmectogglecomppalette
msgid "View component palette"
msgstr "Zobraziť Paletu komponentov"

#: lazarusidestrconsts:srkmecviewcomponents
msgid "View components"
msgstr "Zobraziť komponenty"

#: lazarusidestrconsts:srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Zobraziť výstup debugera"

#: lazarusidestrconsts:srkmecviewforms
msgid "View forms"
msgstr "Zobraziť formuláre"

#: lazarusidestrconsts:liskmviewjumphistory
msgid "View jump history"
msgstr "Zobraziť históriu skokov"

#: lazarusidestrconsts:srkmectogglelocals
msgid "View local variables"
msgstr "Zobraziť lokálne premenné"

#: lazarusidestrconsts:srkmcatviewmenu
msgid "View menu commands"
msgstr "Príkazy menu Zobraziť"

#: lazarusidestrconsts:srkmectogglemessages
msgid "View messages"
msgstr "Zobraziť Správy"

#: lazarusidestrconsts:dlgmainviewforms
msgid "View project forms"
msgstr "Zobraziť formuláre projektu"

#: lazarusidestrconsts:liskmviewprojectoptions
msgid "View project options"
msgstr "Zobraziť voľby projektu"

#: lazarusidestrconsts:liskmviewprojectsource
msgid "View project source"
msgstr "Zobraziť zdrojový kód projektu"

#: lazarusidestrconsts:dlgmainviewunits
msgid "View project units"
msgstr "Zobraziť jednotky projektu"

#: lazarusidestrconsts:srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""

#: lazarusidestrconsts:srkmecviewtodolist
msgid "View todo list"
msgstr ""

#: lazarusidestrconsts:srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Zobraziť závislosti jednotiek"

#: lazarusidestrconsts:srkmecviewunitinfo
msgid "View unit information"
msgstr "Zobraziť info o jednotke"

#: lazarusidestrconsts:srkmecviewunits
msgid "View units"
msgstr "Zobraziť jednotky"

#: lazarusidestrconsts:srkmectogglewatches
msgid "View watches"
msgstr "Zobraziť Pozorovania"

#: lazarusidestrconsts:lishlpoptsviewers
msgid "Viewers"
msgstr "Prehliadača"

#: lazarusidestrconsts:lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Virtuálna jednotka"

#: lazarusidestrconsts:lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Virtuálna jednotka (zdrojový kód nie je v balíčku)"

#: lazarusidestrconsts:dlgvisiblegutter
msgid "Visible gutter"
msgstr "Viditeľný gutter"

#: lazarusidestrconsts:dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Viditeľný pravý okraj"

#: lazarusidestrconsts:lisccowarningmsg
msgid "WARNING: "
msgstr "UPOZORNENIE:"

#: lazarusidestrconsts:dlgambigwarn
msgid "Warn on compile"
msgstr "Upozorniť pri preklade"

#: lazarusidestrconsts:lisccowarningcaption
msgid "Warning"
msgstr "Upozorňovanie"

#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr ""

#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Upozornenie: Súbor %s%s%s%spatrí do aktuálneho projektu."

#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Upozornenie: Nájdený nejednoznačný súbor: %s%s%s. Zdrojový kód je: %s%s%s"

#: lazarusidestrconsts:liswatchpropert
msgid "Watch Properties"
msgstr ""

#: lazarusidestrconsts:liswlwatchlist
msgid "Watch list"
msgstr "Zoznam Pozorovaní"

#: lazarusidestrconsts:lismenuviewwatches
msgid "Watches"
msgstr "Pozorovania"

#: lazarusidestrconsts:dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Nový formulár pridať k automaticky vytváraným formulárom"

#: lazarusidestrconsts:lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Pri prepínaní súboru v editore"

#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Keď je tento súbor aktívny v editore ..."

#: lazarusidestrconsts:lisfindfilewhere
msgid "Where"
msgstr "Kde"

#: lazarusidestrconsts:dlgwidthpos
msgid "Width:"
msgstr "Šírka:"

#: lazarusidestrconsts:dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Aplikácia Win32 GUI"

#: lazarusidestrconsts:dlgwindow
msgid "Window"
msgstr "Okno"

#: lazarusidestrconsts:dlgwinpos
msgid "Window Positions"
msgstr "Pozície okna"

#: lazarusidestrconsts:lislazbuildwithstaticpackages
msgid "With packages"
msgstr "S balíčkami"

#: lazarusidestrconsts:liswithrequiredpackages
msgid "With required packages"
msgstr "S vyžadovanými balíčkami"

#: lazarusidestrconsts:liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Slovo na kurzore aktuálneho editora"

#: lazarusidestrconsts:srkmecwordcompletion
msgid "Word completion"
msgstr "Dokončovanie slov"

#: lazarusidestrconsts:dlgwordspolicies
msgid "Words"
msgstr "Slová"

#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Pracovný adresár (prázdne pre cestu súboru)"

#: lazarusidestrconsts:lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Pracovný adresár:"

#: lazarusidestrconsts:dlgroworkingdirectory
msgid "Working directory"
msgstr "Pracovný adresár"

#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Pracovný adresár (prázdne pre cestu súboru)"

#: lazarusidestrconsts:lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Pracovný adresár pre budovanie"

#: lazarusidestrconsts:lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Pracovný adresár pre spustenie"

#: lazarusidestrconsts:liswriteerror
msgid "Write Error"
msgstr "Chyba zápisu"

#: lazarusidestrconsts:dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Zapísať logo FPC"

#: lazarusidestrconsts:liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Chyba zápisu"

#: lazarusidestrconsts:liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Chyba zápisu: %s%sSúbor: %s%s%s"

#: lazarusidestrconsts:dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Predpona zápisu"

#: lazarusidestrconsts:lisxmlerror
msgid "XML Error"
msgstr "XML Chyba"

#: lazarusidestrconsts:lisxmlfiles
msgid "XML files"
msgstr "Súbory XML"

#: lazarusidestrconsts:lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""

#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Nemôžete vybudovať Lazarus počas ladenia alebo prekladu."

#: lazarusidestrconsts:dlgdoesnotexist
msgid "\" does not exist."
msgstr "\" neexistuje."

#: lazarusidestrconsts:uefilerotext2
msgid "\" is not writable."
msgstr "\" nie je zapisovateľný."

#: lazarusidestrconsts:lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" dokončené"

#: lazarusidestrconsts:srkmecabortbuild
msgid "abort build"
msgstr "zrušiť budovanie"

#: lazarusidestrconsts:srkmecaddbreakpoint
msgid "add break point"
msgstr "pridať bod prerušenia"

#: lazarusidestrconsts:srkmecaddwatch
msgid "add watch"
msgstr "pridať pozorovanie"

#: lazarusidestrconsts:srvk_apps
msgid "application key"
msgstr ""

#: lazarusidestrconsts:lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "automaticky inštalovaný dynamicky"

#: lazarusidestrconsts:lisoipautoinstallstatic
msgid "auto install static"
msgstr "automaticky inštalovaný staticky"

#: lazarusidestrconsts:lisbegins
msgid "begins"
msgstr "začína"

#: lazarusidestrconsts:srkmecbuildall
msgid "build all files of program/project"
msgstr "vybudovať všetky súbory programu/projektu"

#: lazarusidestrconsts:srkmecbuildfile
msgid "build file"
msgstr "vybudovať súbor"

#: lazarusidestrconsts:srkmecbuild
msgid "build program/project"
msgstr "vybudovať program/projekt"

#: lazarusidestrconsts:dlglefttopclr
msgid "color for left, top"
msgstr "farba ľavej a hornej"

#: lazarusidestrconsts:dlgrightbottomclr
msgid "color for right, bottom"
msgstr "farba pravej a dolnej"

#: lazarusidestrconsts:lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "Preložená jednotka FPC nenájdená: %s.ppu"

#: lazarusidestrconsts:srkmeccompileroptions
msgid "compiler options"
msgstr "voľby prekladača"

#: lazarusidestrconsts:liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "cesta prekladača"

#: lazarusidestrconsts:srkmecconfigbuildfile
msgid "config build file"
msgstr "konfiguračný súbor budovania"

#: lazarusidestrconsts:liscontains
msgid "contains"
msgstr "obsahuje"

#: lazarusidestrconsts:lisccocontains
msgid "contains "
msgstr "obsahuje "

#: lazarusidestrconsts:liscustomoptions
msgid "custom options"
msgstr "vlastné voľby"

#: lazarusidestrconsts:liscodefault
msgid "default (%s)"
msgstr "predvolené (%s)"

#: lazarusidestrconsts:lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "nepridávať znak"

#: lazarusidestrconsts:lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr ""

#: lazarusidestrconsts:srkmecevaluate
msgid "evaluate/modify"
msgstr "vyskúšať/zmeniť"

#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "súbor, do ktorého je zapísaný výstup ladenia. Ak nie je zadaný, ladiaci výstup je vypísaný do konzoly."

#: lazarusidestrconsts:lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake zlyhal"

#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgstr ""

#: lazarusidestrconsts:lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/sk"

#: lazarusidestrconsts:dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts:rsi18noptions
msgid "i18n Options"
msgstr "Voľby i18n"

#: lazarusidestrconsts:lisuidinproject
msgid "in Project:"
msgstr "v projekte:"

#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "vo všetkých balíčkoch a projektoch"

#: lazarusidestrconsts:lisfriincurrentunit
msgid "in current unit"
msgstr "v aktuálnej jednotke"

#: lazarusidestrconsts:lisfriinmainproject
msgid "in main project"
msgstr "v hlavnom projekte"

#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "v projekte/balíčku vlastniacom aktuálnu jednotku"

#: lazarusidestrconsts:lisincludepath
msgid "include path"
msgstr "cesta include"

#: lazarusidestrconsts:srkmecinspect
msgid "inspect"
msgstr "skontrolovať"

#: lazarusidestrconsts:lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "inštalovaný dynamicky"

#: lazarusidestrconsts:lisoipinstalledstatic
msgid "installed static"
msgstr "inštalovaný staticky"

#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "neplatné meno súboru preladača"

#: lazarusidestrconsts:lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [voľby] <meno-suboru-projektu>"

#: lazarusidestrconsts:srvk_lwin
msgid "left windows key"
msgstr "ľavá klávesa Win"

#: lazarusidestrconsts:lislibrarypath
msgid "library path"
msgstr "cesta knižnice"

#: lazarusidestrconsts:lisautomaticallyonlinebreak
msgid "line break"
msgstr "koniec riadku"

#: lazarusidestrconsts:lislinkeroptions
msgid "linker options"
msgstr "voľby linkera"

#: lazarusidestrconsts:dlgcdtlower
msgid "lowercase"
msgstr "malé písmená"

#: lazarusidestrconsts:lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "makro ProjectUnitPath"

#: lazarusidestrconsts:lisoipmissing
msgid "missing"
msgstr "chýbajúci"

#: lazarusidestrconsts:lisoipmodified
msgid "modified"
msgstr "zmenený"

#: lazarusidestrconsts:lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "nájdené viaceré konfigurácie prekladača:"

#: lazarusidestrconsts:lisnew
msgid "new"
msgstr ""

#: lazarusidestrconsts:lisccohasnewline
msgid "new line symbols"
msgstr "symboly nového riadku"

#: lazarusidestrconsts:lisuidno
msgid "no"
msgstr "nie"

#: lazarusidestrconsts:dlgnoautomaticrenaming
msgid "no automatic renaming"
msgstr "Bez automatického premenovania"

#: lazarusidestrconsts:lisccdnoclass
msgid "no class"
msgstr "žiadna trieda"

#: lazarusidestrconsts:liscconocfgfound
msgid "no fpc.cfg found"
msgstr "fpc.cfg nenájdený"

#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
msgid "no inherited description found"
msgstr "nenájdený žiadny zdedený popis"

#: lazarusidestrconsts:lisccononascii
msgid "non ASCII"
msgstr "nie je ASCII"

#: lazarusidestrconsts:lisnoname
msgid "noname"
msgstr "bez mena"

#: lazarusidestrconsts:lisnone2
msgid "none"
msgstr "žiadne"

#: lazarusidestrconsts:liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "nevybraté"

#: lazarusidestrconsts:lisobjectpath
msgid "object path"
msgstr "cesta objektov"

#: lazarusidestrconsts:lisold
msgid "old"
msgstr ""

#: lazarusidestrconsts:lisor
msgid "or"
msgstr "alebo"

#: lazarusidestrconsts:lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "balíček %s neuložený"

#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "základný súbor zdrojového kódu balíčka"

#: lazarusidestrconsts:srkmecpause
msgid "pause program"
msgstr "prerušiť program"

#: lazarusidestrconsts:lisctpleaseselectamacro
msgid "please select a macro"
msgstr "prosím vyberte makro"

#: lazarusidestrconsts:lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu existuje dvakrát: %s, %s"

#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "hlavný konfiguračný adresár, kde Lazarus uchováva svoje konfiguračné súbory. Predvolené je "

#: lazarusidestrconsts:srkmecquickcompile
msgid "quick compile, no linking"
msgstr "rýchly preklad, nelinkuje"

#: lazarusidestrconsts:lisoipreadonly
msgid "readonly"
msgstr "len na čítanie"

#: lazarusidestrconsts:lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "nájdená relatívna cesta jednotky v fpc cfg: %s"

#: lazarusidestrconsts:lisremove
msgid "remove"
msgstr "odstrániť"

#: lazarusidestrconsts:srkmecremovebreakpoint
msgid "remove break point"
msgstr "odstrániť bod prerušenia"

#: lazarusidestrconsts:srkmecresetdebugger
msgid "reset debugger"
msgstr "reštartovať debuger"

#: lazarusidestrconsts:srvk_rwin
msgid "right windows key"
msgstr "pravá klávesa Win"

#: lazarusidestrconsts:srkmecrunfile
msgid "run file"
msgstr "spustiť súbor"

#: lazarusidestrconsts:srkmecrunparameters
msgid "run parameters"
msgstr "parametre spustenia"

#: lazarusidestrconsts:srkmecrun
msgid "run program"
msgstr "spustiť program"

#: lazarusidestrconsts:lissaveallmodified
msgid "save all modified files"
msgstr "uložiť všetky zmenené súbory"

#: lazarusidestrconsts:lissavecurrenteditorfile
msgid "save current editor file"
msgstr "uložiť aktuálny súbor editora"

#: lazarusidestrconsts:lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "prehľadávať všetky &otvorené súbory"

#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "prehľadávať všetky súbory v &projekte"

#: lazarusidestrconsts:lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "prehľadávať a&dresáre"

#: lazarusidestrconsts:dlgtimesecondunit
msgid "sec"
msgstr "s"

#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "druhý konfiguračný adresár, v ktorom Lazarus hľadá súbory konfigurácie šablón. Predvolený je "

#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "nastaviť režim FPC na DELPHI"

#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "nastaviť režim FPC na GPC"

#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "nastaviť režim FPC na TP"

#: lazarusidestrconsts:lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "zapnúť IOCHECKS"

#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "zapnúť OVERFLOWCHECKS"

#: lazarusidestrconsts:lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "zapnúť RANGECHECKS"

#: lazarusidestrconsts:lisautomaticallyonspace
msgid "space"
msgstr "medzera"

#: lazarusidestrconsts:lisccospaces
msgid "spaces"
msgstr "medzery"

#: lazarusidestrconsts:lisccospecialcharacters
msgid "special characters"
msgstr "špeciálne znaky"

#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "konfiguračný súbor statických balíčkov"

#: lazarusidestrconsts:srkmecstopprogram
msgid "stop program"
msgstr "zastaviť program"

#: lazarusidestrconsts:listhishelpmessage
msgid "this help message"
msgstr "táto pomocná správa"

#: lazarusidestrconsts:lisunitpath
msgid "unit path"
msgstr "cesta jednotiek"

#: lazarusidestrconsts:srkmecunknown
msgid "unknown editor command"
msgstr "neznámy príkaz editora"

#: lazarusidestrconsts:lisccounusualchars
msgid "unusual characters"
msgstr "nezvyčajné znaky"

#: lazarusidestrconsts:lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "použiť jednotku HeapTrc"

#: lazarusidestrconsts:lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "použiť jednotku LineInfo"

#: lazarusidestrconsts:lisautomaticallyonwordend
msgid "word end"
msgstr "koniec slova"

#: lazarusidestrconsts:lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "zlý oddeľovač cesty"

#: lazarusidestrconsts:lisuidyes
msgid "yes"
msgstr "áno"