lazarus/languages/lazaruside.af_ZA.po
2014-05-18 12:42:22 +00:00

18450 lines
444 KiB
Plaintext

msgid ""
msgstr ""
"Project-Id-Version: Lazarus 0.9.19\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2006-09-21 10:58+0200\n"
"PO-Revision-Date: 2009-09-02 13:07+0200\n"
"Last-Translator: Graeme Geldenhuys <graemeg@gmail.com>\n"
"Language-Team: English <en@li.org>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Plural-Forms: \n"
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr ""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Plak"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Teks"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Regs"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr ""
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr ""
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr ""
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr ""
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Fout reël"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Reël"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Teks"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr ""
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr ""
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr ""
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr ""
#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr ""
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr ""
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr ""
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr ""
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr ""
#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr ""
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr ""
#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr ""
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr ""
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr ""
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr ""
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr ""
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr ""
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr ""
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr ""
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr ""
#: lazarusidestrconsts.dlgautosave
msgid "Auto Save"
msgstr ""
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr ""
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr ""
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr ""
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr ""
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr ""
#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr ""
#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr ""
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr ""
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr ""
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr ""
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr ""
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr ""
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr ""
#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr ""
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Toets"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""
#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr ""
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Laaste"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr ""
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr ""
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr ""
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr ""
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr ""
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr ""
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr ""
#: lazarusidestrconsts.dlgcentercursorline
msgid "Center cursor line"
msgstr ""
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr ""
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr ""
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr ""
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr ""
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Kleurskema"
#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr ""
#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr ""
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr ""
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr ""
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr ""
#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr ""
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr ""
#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr ""
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr ""
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""
#: lazarusidestrconsts.dlgcogdb
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr ""
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr ""
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr ""
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr ""
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr ""
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr ""
#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr ""
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr ""
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr ""
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr ""
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Kleure"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr ""
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Make default indent for new line if comment opens at column:"
msgstr ""
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr ""
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend, if matched or not matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend, if matched or not matched (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend, if matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr ""
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Vertaler Opsies"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr ""
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr ""
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr ""
#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr ""
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr ""
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr ""
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr ""
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr ""
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""
#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr ""
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr ""
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr ""
#: lazarusidestrconsts.dlgcoshowerr
msgid "Show errors"
msgstr ""
#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr ""
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr ""
#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr ""
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr ""
#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr ""
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr ""
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr ""
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr ""
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr ""
#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr ""
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr ""
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr ""
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr ""
#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr ""
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr ""
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr ""
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr ""
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr ""
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr ""
#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr ""
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr ""
#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop Files"
msgstr ""
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr ""
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr ""
#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr ""
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr ""
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr ""
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr ""
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr ""
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr ""
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr ""
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr ""
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr ""
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgedadd
msgid "Add ..."
msgstr ""
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Terug"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr ""
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr ""
#: lazarusidestrconsts.dlgedcodetempl
msgid "Code Templates"
msgstr ""
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr ""
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr ""
#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr ""
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr ""
#: lazarusidestrconsts.dlgededit
msgid "Edit ..."
msgstr ""
#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr ""
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr ""
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr ""
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr ""
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr ""
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr ""
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr ""
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr ""
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr ""
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr ""
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr ""
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr ""
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr ""
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Vra"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr ""
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr ""
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr ""
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr ""
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Taal"
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr ""
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr ""
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr ""
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr ""
#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr ""
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tipe"
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr ""
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr ""
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr ""
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr ""
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr ""
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr ""
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr ""
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr ""
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr ""
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr ""
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr ""
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr ""
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr ""
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr ""
#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Vertaler pad (%s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr ""
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr ""
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr ""
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr ""
#: lazarusidestrconsts.dlgfromcursor
msgid "&From cursor"
msgstr ""
#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Opsies"
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Kry posisie"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr ""
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr ""
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr ""
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr ""
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr ""
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr ""
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr ""
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr ""
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr ""
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr ""
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Omgewing"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr ""
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr ""
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr ""
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr ""
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr ""
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr ""
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr ""
#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr ""
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Hoogte:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr ""
#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr ""
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr ""
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr ""
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr ""
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr ""
#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr ""
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr ""
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr ""
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr ""
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr ""
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Verwerp"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr ""
#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr ""
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr ""
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr ""
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr ""
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr ""
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr ""
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert methods"
msgstr ""
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr ""
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr ""
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr ""
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr ""
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr ""
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr ""
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr ""
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr ""
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr ""
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr ""
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr ""
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Taal"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr ""
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr ""
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Links:"
#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr ""
#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly)"
msgstr ""
#: lazarusidestrconsts.dlglevel2opt
msgid "2 (quick optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevel3opt
msgid "3 (slow optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization)"
msgstr ""
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr ""
#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr ""
#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr ""
#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr ""
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr ""
#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr ""
#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr ""
#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr ""
#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr ""
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr ""
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr ""
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight of Word under Caret"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable timer for markup current word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr ""
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr ""
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr ""
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr ""
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr ""
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Regs"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Alles"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Teks"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find Editor for Jump Targets"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr ""
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr ""
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr ""
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr ""
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr ""
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr ""
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr ""
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr ""
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr ""
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr ""
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr ""
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr ""
#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Opsies"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr ""
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr ""
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr ""
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu) (delimiter is semicolon):"
msgstr ""
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr ""
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr ""
#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr ""
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr ""
#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr ""
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr ""
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr ""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr ""
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr ""
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr ""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr ""
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr ""
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr ""
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr ""
#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr ""
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr ""
#: lazarusidestrconsts.dlgpodpiaware
msgid "Enabled DPI Awareness (for Vista+)"
msgstr ""
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr ""
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr ""
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr ""
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr ""
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr ""
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr ""
#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr ""
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr ""
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr ""
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr ""
#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr ""
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr ""
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr ""
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr ""
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (Darwin only)"
msgstr ""
#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest file to enable themes (Windows only)"
msgstr ""
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr ""
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr ""
#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr ""
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr ""
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr ""
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr ""
#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr ""
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr ""
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr ""
#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr ""
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr ""
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr ""
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr ""
#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr ""
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Vervang Alles"
#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace With"
msgid "&Replace with"
msgstr "&Vervang met"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr ""
#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr ""
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr ""
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr ""
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr ""
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr ""
#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr ""
#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr ""
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr ""
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Omgewing"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr ""
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr ""
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr ""
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr ""
#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr ""
#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr ""
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr ""
#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr ""
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr ""
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr ""
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr ""
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr ""
#: lazarusidestrconsts.dlgscrollpastendline
msgid "Caret past end of line"
msgstr ""
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr ""
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr ""
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr ""
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr ""
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr ""
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr ""
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr ""
#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr ""
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr ""
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr ""
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr ""
#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr ""
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr ""
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr ""
#: lazarusidestrconsts.dlgshowfullfilenames
msgid "Show full file names"
msgstr ""
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr ""
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr ""
#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr ""
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr ""
#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr ""
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr ""
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr ""
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr ""
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr ""
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr ""
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr ""
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr ""
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr ""
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr ""
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr ""
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr ""
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr ""
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Spasie"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr ""
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr ""
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr ""
#: lazarusidestrconsts.dlgstatickeyword
msgid "Static keyword in objects"
msgstr ""
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr ""
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr ""
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr ""
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr ""
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr ""
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Sintaks opsies"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr ""
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr ""
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Kepe na spasies"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr ""
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr ""
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr ""
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr ""
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr ""
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr ""
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr ""
#: lazarusidestrconsts.dlgtexttofind
#, fuzzy
#| msgid "&Text to Find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "&Teks of te vind"
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Bo-kant:"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr ""
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr ""
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Ontdoen na stoor"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr ""
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Ontdoen limiet"
#: lazarusidestrconsts.dlgunitdepcaption
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr ""
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr ""
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr ""
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr ""
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr ""
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr ""
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr ""
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr ""
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr ""
#: lazarusidestrconsts.dlguseminimumime
msgid "Ime handled by System"
msgstr ""
#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr ""
#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr ""
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr ""
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr ""
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr ""
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr ""
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr ""
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr ""
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr ""
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr ""
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr ""
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Weite:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr ""
#: lazarusidestrconsts.dlgwinpos
msgid "Window positions"
msgstr ""
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr ""
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr ""
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr ""
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr ""
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr ""
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr ""
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr ""
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr ""
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr ""
#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Terug een"
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr ""
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr ""
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr ""
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr ""
#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr ""
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr ""
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Skaal"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr ""
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr ""
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr ""
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr ""
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr ""
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr ""
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr ""
#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr ""
#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr ""
#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgcolumnloc
msgid "Location"
msgstr ""
#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr ""
#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Voeg Lêers"
#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add Files to Package"
msgstr ""
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr ""
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr ""
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr ""
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr ""
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr ""
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr ""
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr ""
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr ""
#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create New File"
msgstr ""
#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr ""
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr ""
#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File %s%s%s already exists in the package."
msgstr ""
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr ""
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr ""
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr ""
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr ""
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr ""
#: lazarusidestrconsts.lisa2pnewcomponent
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
msgid "New Component"
msgstr ""
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr ""
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr ""
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr ""
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr ""
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr ""
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr ""
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr ""
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr ""
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr ""
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr ""
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr ""
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package already has a dependency on the package %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr ""
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr ""
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr ""
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr ""
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr ""
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr ""
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
msgstr ""
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr ""
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr ""
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr ""
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr ""
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr ""
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr ""
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr ""
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr ""
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr ""
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr ""
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr ""
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Aangaande Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr ""
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr ""
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr ""
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgstr ""
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr ""
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr ""
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr ""
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr ""
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr ""
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr ""
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr ""
#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Voeg by"
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr ""
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr ""
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr ""
#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr ""
#: lazarusidestrconsts.lisaddfilesindirectory
msgid "Add Files in Directory"
msgstr ""
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr ""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr ""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr ""
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr ""
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr ""
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr ""
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr ""
#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr ""
#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr ""
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr ""
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr ""
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr ""
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr ""
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr ""
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr ""
#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr ""
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr ""
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr ""
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr ""
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr ""
#: lazarusidestrconsts.lisaf2punitname
msgid "Unit name: "
msgstr ""
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr ""
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr ""
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr ""
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr ""
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr ""
#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr ""
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr ""
#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr ""
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr ""
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr ""
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr ""
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr ""
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr ""
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr ""
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr ""
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr ""
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr ""
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr ""
#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr ""
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr ""
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr ""
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr ""
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr ""
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr ""
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr ""
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr ""
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr ""
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr ""
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr ""
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr ""
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr ""
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr ""
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr ""
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr ""
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr ""
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr ""
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr ""
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr ""
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr ""
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr ""
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr ""
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr ""
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr ""
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr ""
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr ""
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr ""
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr ""
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr ""
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr ""
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr ""
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr ""
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr ""
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr ""
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr ""
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr ""
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr ""
#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr ""
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr ""
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr ""
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr ""
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr ""
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr ""
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr ""
#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "Voeg by"
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "Sluit"
#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Skrap"
#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr ""
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Vervang..."
#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr ""
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr ""
#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "&Staak"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr ""
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr ""
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Bou"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr ""
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Bou"
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr ""
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr ""
#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr ""
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Bou nuwe projek"
#: lazarusidestrconsts.lisbuildnumber
#, fuzzy
#| msgid "Build Number"
msgid "Build number"
msgstr "Bou Nommer"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Bou"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr ""
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr ""
#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr ""
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Kanselleer"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr ""
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr ""
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr ""
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr ""
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr ""
#: lazarusidestrconsts.liscannotcreatefile
msgid "Cannot create file %s%s%s"
msgstr ""
#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find Lazarus starter:%s%s"
msgstr ""
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr ""
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr ""
#: lazarusidestrconsts.liscaptiondiff
msgctxt "lazarusidestrconsts.liscaptiondiff"
msgid "Diff"
msgstr ""
#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr ""
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr ""
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr ""
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""
#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr ""
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr ""
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr ""
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr ""
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr ""
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr ""
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr ""
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr ""
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr ""
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr ""
#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr ""
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""
#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr ""
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr ""
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test Pascal file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr ""
#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr ""
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr ""
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr ""
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr ""
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr ""
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr ""
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr ""
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr ""
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr ""
#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr ""
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr ""
#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr ""
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr ""
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr ""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr ""
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr ""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr ""
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr ""
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr ""
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr ""
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr ""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr ""
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr ""
#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr ""
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr ""
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr ""
#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr ""
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr ""
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr ""
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr ""
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr ""
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr ""
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr ""
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr ""
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr ""
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr ""
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr ""
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr ""
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr ""
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr ""
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr ""
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr ""
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr ""
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr ""
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr ""
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr ""
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr ""
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occured during deletion of%s\"%s:%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr ""
#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr ""
#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr ""
#: lazarusidestrconsts.liscfeinfile
msgid "%sIn file %s%s"
msgstr ""
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr ""
#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr ""
#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr ""
#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr ""
#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr ""
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr ""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr ""
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Verander"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr ""
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr ""
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr ""
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr ""
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr ""
#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr ""
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr ""
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr ""
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr ""
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr ""
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr ""
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr ""
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontentratherthantimesta
msgid "Check for disk file changes via content rather than timestamp"
msgstr ""
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr ""
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr ""
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr ""
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr ""
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr ""
#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr ""
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr ""
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr ""
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr ""
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr ""
#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr ""
#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr ""
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr ""
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Kies 'n vouer"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr ""
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr ""
#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr ""
#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr ""
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr ""
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr ""
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr ""
#: lazarusidestrconsts.lisclassesppunotfoundcheckyourfpccfg
msgid "classes.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr ""
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr ""
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr ""
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr ""
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr ""
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr ""
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr ""
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr ""
#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr ""
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr ""
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr ""
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuild
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr ""
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr ""
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr ""
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr ""
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr ""
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""
#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr ""
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr ""
#: lazarusidestrconsts.lisclose
#, fuzzy
#| msgid "&Close"
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Sluit"
#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr ""
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr ""
#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr ""
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr ""
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr ""
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr ""
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr ""
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr ""
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr ""
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr ""
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr ""
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr ""
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr ""
#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you definitely want to do that."
msgstr ""
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr ""
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr ""
#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr ""
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr ""
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr ""
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr ""
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr ""
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr ""
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr ""
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr ""
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr ""
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr ""
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr ""
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<GEEN>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr ""
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr ""
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr ""
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr ""
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr ""
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr ""
#: lazarusidestrconsts.liscodetempladd
#, fuzzy
#| msgid "Add"
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Voeg by"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr ""
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr ""
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr ""
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Verander"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr ""
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr ""
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr ""
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Aksie: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Stoor en verlaat"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Ongespesifieseer"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Sleutelwoord"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Spasie"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Simbool"
#: lazarusidestrconsts.liscodetoolstemplatefile
msgid "CodeTools template file"
msgstr ""
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr ""
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr ""
#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr ""
#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr ""
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr ""
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr ""
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr ""
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr ""
#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr ""
#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr ""
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr ""
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr ""
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr ""
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr ""
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr ""
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Vertaleer"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Vertaler"
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr ""
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr ""
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Vertaler lêer"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr ""
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr ""
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr ""
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Vertaleer"
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a Pascal keyword."
msgstr ""
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr ""
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr ""
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr ""
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr ""
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr ""
#: lazarusidestrconsts.liscomptest
#, fuzzy
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "Toets"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr ""
#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr ""
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr ""
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr ""
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr ""
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr ""
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr ""
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr ""
#: lazarusidestrconsts.lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr ""
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr ""
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr ""
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr ""
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr ""
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr ""
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Gaan aan"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr ""
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr ""
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Bydraers"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr ""
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr ""
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr ""
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingfile
msgid "* Converting file %s *"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr ""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifixingusedunits
msgid "* Fixing used units for file %s *"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr ""
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr ""
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""
#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
msgid "Removed unit \"%s\" in uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "* Repairing form file %s *"
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr ""
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr ""
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr ""
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr ""
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr ""
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr ""
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr ""
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr ""
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr ""
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr ""
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr ""
#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Kopieer"
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr ""
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy All Shown and Hidden Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Kopieer vout"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Kopieer vout"
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr ""
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr ""
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr ""
#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr ""
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr ""
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr ""
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr ""
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr ""
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr ""
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr ""
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr ""
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr ""
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr ""
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr ""
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr ""
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr ""
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr ""
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr ""
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr ""
#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr ""
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr ""
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr ""
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr ""
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr ""
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Nutsgoed"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr ""
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr ""
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr ""
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr ""
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr ""
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr ""
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr ""
#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr ""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr ""
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr ""
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr ""
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after comments are deleted and macros are replaced."
msgstr ""
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr ""
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr ""
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr ""
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr ""
#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Sny"
#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr ""
#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr ""
#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr ""
#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr ""
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr ""
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Datum"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr ""
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to Clipboard"
msgstr ""
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr ""
#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr ""
#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr ""
#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr ""
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr ""
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr ""
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr ""
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr ""
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr ""
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr ""
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr ""
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr ""
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr ""
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr ""
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr ""
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr ""
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr ""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr ""
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr ""
#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr ""
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr ""
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr ""
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr ""
#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr ""
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr ""
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr ""
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr ""
#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr ""
#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr ""
#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr ""
#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr ""
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr ""
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr ""
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr ""
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr ""
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr ""
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr ""
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr ""
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr ""
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr ""
#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr ""
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr ""
#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr ""
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr ""
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr ""
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr ""
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr ""
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr ""
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr ""
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr ""
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr ""
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr ""
#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Stoor..."
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exist: %s"
msgstr ""
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr ""
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr ""
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr ""
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr ""
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Af"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr ""
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr ""
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr ""
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr ""
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr ""
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr ""
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr ""
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr ""
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr ""
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr ""
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr ""
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr ""
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr ""
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr ""
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Redigeer"
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr ""
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr ""
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr ""
#: lazarusidestrconsts.liseditorfiletypes
msgid "Editor file types"
msgstr ""
#: lazarusidestrconsts.liseditormacros
msgid "Editor macros"
msgstr ""
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr ""
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr ""
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr ""
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Alle projekte"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr ""
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "gebruik HeapTrc eenheid"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "gebruik LineInfo eenheid"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr ""
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr ""
#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr ""
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Sleutel"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Makro's"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr ""
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr ""
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr ""
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr ""
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr ""
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Alles"
#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr ""
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr ""
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr ""
#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr ""
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Publiek"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Gepubliseerde"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr ""
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr ""
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr ""
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr ""
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr ""
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr ""
#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr ""
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr ""
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr ""
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = replace whole identifier, Disable = replace prefix"
msgstr ""
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr ""
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr ""
#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr ""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr ""
#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr ""
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr ""
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr ""
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr ""
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr ""
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr ""
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Fout:"
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr ""
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr ""
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr ""
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Linking / Pass options to linker):"
msgstr ""
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr ""
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr ""
#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "ERROR: invalid build mode \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr ""
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr ""
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr ""
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr ""
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr ""
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr ""
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr ""
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Foute"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorwritingfile2
msgid "Error writing file %s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr ""
#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr ""
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr ""
#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr ""
#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr ""
#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr ""
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number"
msgstr ""
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr ""
#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""
#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr ""
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr ""
#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr ""
#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude filter"
msgstr ""
#: lazarusidestrconsts.lisexecutable
msgid "Executable"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr ""
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr ""
#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Programme"
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Verlaat"
#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr ""
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr ""
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr ""
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr ""
#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr ""
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr ""
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr ""
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr ""
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr ""
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr ""
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr ""
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts.lisexttoolexternaltools
#, fuzzy
#| msgid "External tools"
msgid "External Tools"
msgstr "Eksterne nutsgoed"
#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr ""
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Maksimum Nutsgoed bereik"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr ""
#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr ""
#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr ""
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr ""
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr ""
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr ""
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Lêer"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr ""
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr ""
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr ""
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr ""
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr ""
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr ""
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr ""
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr ""
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr ""
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Lêer is nie skryfbaar nie"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr ""
#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr ""
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr ""
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Lêer nie gevind nie"
#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr ""
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr ""
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Lêer is nie teks nie"
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr ""
#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr ""
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr ""
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr ""
#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr ""
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr ""
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectory
msgid "D&irectory"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr ""
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr ""
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr ""
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Alleenlik teks lêers"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr ""
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Waar"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr ""
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr ""
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Eerste"
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr ""
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr ""
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr ""
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Vorm"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Formaat fout"
#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr ""
#: lazarusidestrconsts.lisfpccfgismissing
msgid "fpc.cfg is missing."
msgstr ""
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr ""
#: lazarusidestrconsts.lisfpcmessagefile
msgid "FPC message file"
msgstr ""
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr ""
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr ""
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr ""
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "FPC Weergawe:"
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "FPC Weergawe (b.v. 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "FPDoc Redigeerder"
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr ""
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Raam"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr ""
#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr ""
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr ""
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr ""
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr ""
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr ""
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr ""
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr ""
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr ""
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "in hoof projek"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr ""
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr ""
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr ""
#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr ""
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr ""
#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr ""
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr ""
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr ""
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr ""
#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr ""
#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr ""
#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr ""
#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr ""
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr ""
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr ""
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr ""
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr ""
#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Help"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr ""
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr ""
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr ""
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr ""
#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr ""
#: lazarusidestrconsts.lishint
msgid "Hint"
msgstr ""
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr ""
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Stoor alles"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr ""
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr ""
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr ""
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr ""
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr ""
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr ""
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr ""
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr ""
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr ""
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Databasis"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr ""
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr ""
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr ""
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr ""
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr ""
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr ""
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr ""
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr ""
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr ""
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr ""
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr ""
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr ""
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr ""
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr ""
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr ""
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr ""
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr ""
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr ""
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr ""
#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr ""
#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr ""
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr ""
#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr ""
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr ""
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr ""
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr ""
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr ""
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr ""
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Stoor na lêer"
#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr ""
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%s%sFor example:%s"
msgstr ""
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr ""
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr ""
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr ""
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr ""
#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr ""
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr ""
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr ""
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr ""
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr ""
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr ""
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr ""
#: lazarusidestrconsts.lisincludefilter
msgid "Include filter"
msgstr ""
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr ""
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr ""
#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr ""
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr ""
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr ""
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr ""
#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted ..."
msgstr ""
#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr ""
#: lazarusidestrconsts.lisinfobuildcompile
msgctxt "lazarusidestrconsts.lisinfobuildcompile"
msgid "Compiling ..."
msgstr ""
#: lazarusidestrconsts.lisinfobuilderror
msgid "Error ..."
msgstr ""
#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr ""
#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success ..."
msgstr ""
#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr ""
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr ""
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr ""
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr ""
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr ""
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr ""
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr ""
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr ""
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Insit"
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr ""
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr ""
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr ""
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr ""
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr ""
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr ""
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr ""
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr ""
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr ""
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr ""
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr ""
#: lazarusidestrconsts.lisinspectclassinherit
msgid "%s : Class %s inherits from %s"
msgstr ""
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr ""
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr ""
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr ""
#: lazarusidestrconsts.lisinspectpointerto
msgid "Pointer to %s"
msgstr ""
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr ""
#: lazarusidestrconsts.lisinspectunavailable
msgid "%s : unavailable"
msgstr ""
#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr ""
#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr ""
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr ""
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr ""
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr ""
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr ""
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr ""
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr ""
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr ""
#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr ""
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr ""
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro %s%s%s. The macro name must be a Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr ""
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr ""
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr ""
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr ""
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr ""
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr ""
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr ""
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr ""
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr ""
#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr ""
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr ""
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr ""
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr ""
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr ""
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr ""
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr ""
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr ""
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr ""
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Hou naam"
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr ""
#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr ""
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr ""
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Sleutel"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr ""
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr ""
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr ""
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr ""
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr ""
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr ""
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klasiek"
#: lazarusidestrconsts.liskmcleanupcompiled
msgid "Clean up build files"
msgstr ""
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr ""
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr ""
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr ""
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr ""
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr ""
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr ""
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr ""
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr ""
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr ""
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr ""
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr ""
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr ""
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr ""
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr ""
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr ""
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr ""
#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr ""
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr ""
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr ""
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr ""
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr ""
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr ""
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr ""
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr ""
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr ""
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr ""
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr ""
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr ""
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr ""
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr ""
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr ""
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr ""
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr ""
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr ""
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr ""
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr ""
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr ""
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr ""
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr ""
#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr ""
#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr ""
#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr ""
#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr ""
#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr ""
#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr ""
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr ""
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr ""
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr ""
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr ""
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr ""
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr ""
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr ""
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr ""
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr ""
#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr ""
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr ""
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr ""
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr ""
#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus file"
msgstr ""
#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Lazarus forum"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr ""
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr ""
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr ""
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr ""
#: lazarusidestrconsts.lislazarusotherfile
msgid "Lazarus other file"
msgstr ""
#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Lazarus paket"
#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Lazarus projek"
#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr ""
#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr ""
#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr ""
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr ""
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr ""
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr ""
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr ""
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr ""
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr ""
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr ""
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr ""
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr ""
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr ""
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr ""
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr ""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr ""
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr ""
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr ""
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr ""
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr ""
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr ""
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr ""
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr ""
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr ""
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr ""
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr ""
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr ""
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr ""
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr ""
#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr ""
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr ""
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr ""
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr ""
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr ""
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr ""
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr ""
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr ""
#: lazarusidestrconsts.lisloadedsuccessfully
msgid "Loaded successfully"
msgstr ""
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr ""
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr ""
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr ""
#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr ""
#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr ""
#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr ""
#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr ""
#: lazarusidestrconsts.lislogmessage
msgid "Log Message"
msgstr ""
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr ""
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr ""
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr ""
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr ""
#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr ""
#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr ""
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr ""
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr ""
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr ""
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main unit has Application.CreateForm statements"
msgstr ""
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main unit has Application.Title statements"
msgstr ""
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr ""
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr ""
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr ""
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr ""
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr ""
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr ""
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr ""
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr ""
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr ""
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr ""
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr ""
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr ""
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr ""
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr ""
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr ""
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr ""
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr ""
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr ""
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr ""
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr ""
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr ""
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr ""
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr ""
#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr ""
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr ""
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr ""
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr ""
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr ""
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr ""
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr ""
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr ""
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr ""
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Bou Lêer"
#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus with current profile"
msgid "Build Lazarus with Current Profile"
msgstr "Bou Lazarus"
#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with Profile: %s"
msgstr ""
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr ""
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr ""
#: lazarusidestrconsts.lismenucleanupcompiled
msgid "Clean up Build Files ..."
msgstr ""
#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close A&ll Editor Files"
msgid "Close A&ll"
msgstr "Sluit alle lêers"
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr ""
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr ""
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr ""
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr ""
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Voltooi Bron"
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr ""
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr ""
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr ""
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr ""
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr ""
#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr ""
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr ""
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr ""
#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff ..."
msgstr ""
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Redigeer"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr ""
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr ""
#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr ""
#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr ""
#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr ""
#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr ""
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr ""
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr ""
#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr ""
#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr ""
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr ""
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr ""
#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr ""
#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr ""
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr ""
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Lêer"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr ""
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr ""
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr ""
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr ""
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr ""
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr ""
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr ""
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr ""
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr ""
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr ""
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Opsies..."
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr ""
#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr ""
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr ""
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr ""
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Help"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr ""
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr ""
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr ""
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr ""
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr ""
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr ""
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr ""
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr ""
#: lazarusidestrconsts.lismenuinsertgeneral
#, fuzzy
#| msgid "General"
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Algemeen"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertlgplnotice
#, fuzzy
#| msgid "LGPL notice"
msgid "LGPL Notice"
msgstr "LGPL nota"
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr ""
#: lazarusidestrconsts.lismenuinspect
#, fuzzy
#| msgid "Inspect ..."
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Inspekteur..."
#: lazarusidestrconsts.lismenujumpback
#, fuzzy
#| msgid "Jump back"
msgid "Jump Back"
msgstr "Spring terug"
#: lazarusidestrconsts.lismenujumpforward
#, fuzzy
#| msgid "Jump forward"
msgid "Jump Forward"
msgstr "Spring voorentoe"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Spring na"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr ""
#: lazarusidestrconsts.lismenujumptonextbookmark
#, fuzzy
#| msgid "Jump to next bookmark"
msgid "Jump to Next Bookmark"
msgstr "Spring na volgende boekmerk"
#: lazarusidestrconsts.lismenujumptonexterror
#, fuzzy
#| msgid "Jump to next error"
msgid "Jump to Next Error"
msgstr "Spring na volgende vout"
#: lazarusidestrconsts.lismenujumptoprevbookmark
#, fuzzy
#| msgid "Jump to previous bookmark"
msgid "Jump to Previous Bookmark"
msgstr "Spring na vorige boekmerk"
#: lazarusidestrconsts.lismenujumptopreverror
#, fuzzy
#| msgid "Jump to previous error"
msgid "Jump to Previous Error"
msgstr "Spring na vorige vout"
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr ""
#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr ""
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr ""
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr ""
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nuwe Vorm"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nuwe..."
#: lazarusidestrconsts.lismenunewpackage
#, fuzzy
#| msgid "New package ..."
msgid "New Package ..."
msgstr "Nuwe pakket..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nuwe Projek..."
#: lazarusidestrconsts.lismenunewprojectfromfile
#, fuzzy
#| msgid "New Project from file ..."
msgid "New Project from File ..."
msgstr "Nuwe Projek van lêer..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nuwe Eenheid"
#: lazarusidestrconsts.lismenuok
#, fuzzy
#| msgid "&Ok"
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&Goed"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Kry hulp aanlyn"
#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Laai..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
#, fuzzy
#| msgid "Open filename at cursor"
msgid "Open Filename at Cursor"
msgstr "Laai lêer by merker"
#: lazarusidestrconsts.lismenuopenpackage
#, fuzzy
#| msgid "Open loaded package ..."
msgid "Open Loaded Package ..."
msgstr "Maak gelaaide pakket oop..."
#: lazarusidestrconsts.lismenuopenpackagefile
#, fuzzy
#| msgid "Open package file (.lpk) ..."
msgid "Open Package File (.lpk) ..."
msgstr "Laai pakket lêer (.lpk)..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
#, fuzzy
#| msgid "Open package of current unit"
msgid "Open Package of Current Unit"
msgstr "Laai pakket van huidige eenheid"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Laai Projek..."
#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open &Recent ..."
msgid "Open &Recent"
msgstr "Laai &Onlangse..."
#: lazarusidestrconsts.lismenuopenrecentpkg
#, fuzzy
#| msgid "Open recent package"
msgid "Open Recent Package"
msgstr "Laai onlangse pakket..."
#: lazarusidestrconsts.lismenuopenrecentproject
#, fuzzy
#| msgid "Open Recent Project ..."
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Laai onlangse Projek..."
#: lazarusidestrconsts.lismenupackage
#, fuzzy
#| msgid "&Package"
msgid "Pa&ckage"
msgstr "&Pakket"
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr ""
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr ""
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr ""
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Prosedure Lys ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projek"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Projek Inspekteur"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Projek Opsies..."
#: lazarusidestrconsts.lismenuprojectrun
#, fuzzy
#| msgid "Run"
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Hardloop"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publieseer Projek..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr ""
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr ""
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr ""
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Verwyder van Projek..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr ""
#: lazarusidestrconsts.lismenureportingbug
#, fuzzy
#| msgid "Reporting a bug"
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Rapporteer 'n probleem..."
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr ""
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr ""
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Terugkeer"
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Hardloop"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Hardloop Lêer"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr ""
#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Run to &Cursor"
msgid "Step over to &Cursor"
msgstr "Hardloop tot by merker"
#: lazarusidestrconsts.lismenusave
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Stoor"
#: lazarusidestrconsts.lismenusaveas
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Stoor &As ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Stoor Projek"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Stoor Projek as ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Deursoek"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Kies"
#: lazarusidestrconsts.lismenuselectall
#, fuzzy
#| msgid "Select all"
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Kies alles"
#: lazarusidestrconsts.lismenuselectcodeblock
#, fuzzy
#| msgid "Select code block"
msgid "Select Code Block"
msgstr "Kies bron blok"
#: lazarusidestrconsts.lismenuselectline
#, fuzzy
#| msgid "Select line"
msgid "Select Line"
msgstr "Kies lyne"
#: lazarusidestrconsts.lismenuselectparagraph
#, fuzzy
#| msgid "Select paragraph"
msgid "Select Paragraph"
msgstr "Kies paragraaf"
#: lazarusidestrconsts.lismenuselecttobrace
#, fuzzy
#| msgid "Select to brace"
msgid "Select to Brace"
msgstr "Kies tot krulhakie"
#: lazarusidestrconsts.lismenuselectword
#, fuzzy
#| msgid "Select word"
msgid "Select Word"
msgstr "Kies woord"
#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr ""
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr ""
#: lazarusidestrconsts.lismenusortselection
#, fuzzy
#| msgid "Sort selection ..."
msgid "Sort Selection ..."
msgstr "Sorteer seleksie"
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr ""
#: lazarusidestrconsts.lismenustepinto
#, fuzzy
#| msgid "Step in&to"
msgid "Step In&to"
msgstr "Stap in"
#: lazarusidestrconsts.lismenustepintocontext
msgid "Step Into (Context)"
msgstr ""
#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepout
msgid "Step O&ut"
msgstr ""
#: lazarusidestrconsts.lismenustepover
#, fuzzy
#| msgid "&Step over"
msgid "&Step Over"
msgstr "Stap oor"
#: lazarusidestrconsts.lismenustepovercontext
msgid "Step Over (Context)"
msgstr ""
#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr ""
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Aangaande"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Inhoud"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr ""
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr ""
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr ""
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Soek"
#: lazarusidestrconsts.lismenutemplatefindnext
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
msgid "Find Next"
msgstr "Soek Volgende"
#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Maak Onlangse Oop"
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Tutoriaal"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Nutsgoed"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr ""
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr ""
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr ""
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr ""
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Aansig"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Anker Redigeerder"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr ""
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Breekpunte"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr ""
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr ""
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponente"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr ""
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewforms
#, fuzzy
#| msgid "Forms..."
msgid "Forms ..."
msgstr "Vorms..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lismenuviewidespeedbuttons
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE Speed Buttons"
msgstr ""
#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr ""
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr ""
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr ""
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr ""
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgid "Terminal Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr ""
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr ""
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr ""
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr ""
#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr ""
#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr ""
#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr ""
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr ""
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr ""
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr ""
#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr ""
#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr ""
#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr ""
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr ""
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr ""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr ""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr ""
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr ""
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr ""
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr ""
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr ""
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr ""
#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr ""
#: lazarusidestrconsts.lismitnotice
msgid "<description>%sCopyright (c) <year> <copyright holders>%sPermission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:%sThe above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.%sTHE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr ""
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr ""
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr ""
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr ""
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr ""
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr ""
#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
msgid "expected \":=\" after macro name, but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
msgid "expected macro name, but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmfromto
msgid "From %s to %s"
msgstr ""
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr ""
#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgid "Move selected item down"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemup
msgid "Move selected item up"
msgstr ""
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr ""
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr ""
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr ""
#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr ""
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr ""
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr ""
#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmwas
msgid "(was \"%s\")"
msgstr ""
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr ""
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr ""
#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More >>"
msgstr ""
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr ""
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr ""
#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr ""
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr ""
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr ""
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr ""
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr ""
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr ""
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr ""
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr ""
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr ""
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr ""
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr ""
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Nuwe"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr ""
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr ""
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr ""
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr ""
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr ""
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr ""
#: lazarusidestrconsts.lisnewmacroname
msgid "Macro %d"
msgstr ""
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr ""
#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr ""
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr ""
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr ""
#: lazarusidestrconsts.lisno
msgid "No"
msgstr ""
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr ""
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr ""
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr ""
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr ""
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr ""
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr ""
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr ""
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr ""
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr ""
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr ""
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr ""
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr ""
#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr ""
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr ""
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr ""
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr ""
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr ""
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr ""
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""
#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid Pascal identifier"
msgstr ""
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Links"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Regs"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr ""
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr ""
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr ""
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr ""
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr ""
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr ""
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr ""
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr ""
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr ""
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr ""
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr ""
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr ""
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr ""
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr ""
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr ""
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr ""
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr ""
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr ""
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr ""
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr ""
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr ""
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr ""
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr ""
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr ""
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr ""
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr ""
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr ""
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Staat"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr ""
#: lazarusidestrconsts.lisok
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr ""
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr ""
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr ""
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr ""
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr ""
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr ""
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr ""
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr ""
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr ""
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr ""
#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr ""
#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr ""
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr ""
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr ""
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr ""
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr ""
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr ""
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr ""
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr ""
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr ""
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr ""
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr ""
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr ""
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr ""
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr ""
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr ""
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr ""
#: lazarusidestrconsts.lisor
msgid "or"
msgstr ""
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr ""
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project or IDE build mode."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr ""
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr ""
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr ""
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr ""
#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr ""
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr ""
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr ""
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr ""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr ""
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr ""
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr ""
#: lazarusidestrconsts.lispage
msgid "Page"
msgstr ""
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""
#: lazarusidestrconsts.lispascalfile
msgid "Pascal file"
msgstr ""
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr ""
#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Plak"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr ""
#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr ""
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr ""
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr ""
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr ""
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr ""
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr ""
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr ""
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr ""
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr ""
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr ""
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr ""
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr ""
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr ""
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr ""
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Rus"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr ""
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr ""
#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr ""
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr ""
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr ""
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr ""
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr ""
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Kompileer alles?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Vertaleer paket"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr ""
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr ""
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr ""
#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr ""
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr ""
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr ""
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr ""
#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr ""
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr ""
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr ""
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr ""
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr ""
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr ""
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr ""
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr ""
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr ""
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr ""
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr ""
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr ""
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr ""
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr ""
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr ""
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr ""
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr ""
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr ""
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr ""
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr ""
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr ""
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr ""
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr ""
#: lazarusidestrconsts.lispckeditsavepackage
#, fuzzy
#| msgid "Save package"
msgid "Save Package"
msgstr "Stoor paket"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr ""
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr ""
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr ""
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr ""
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr ""
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr ""
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr ""
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr ""
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr ""
#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr ""
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr ""
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr ""
#: lazarusidestrconsts.lispckoptsauthor
#, fuzzy
#| msgid "Author:"
msgid "Author"
msgstr "Skrywer:"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr ""
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr ""
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr ""
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr ""
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr ""
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr ""
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr ""
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr ""
#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr ""
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr ""
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr ""
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr ""
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr ""
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr ""
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr ""
#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr ""
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr ""
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr ""
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr ""
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr ""
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr ""
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr ""
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr ""
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr ""
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr ""
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr ""
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr ""
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr ""
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr ""
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr ""
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr ""
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr ""
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr ""
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr ""
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr ""
#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr ""
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr ""
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr ""
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr ""
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr ""
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr ""
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr ""
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr ""
#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr ""
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr ""
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr ""
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr ""
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr ""
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr ""
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr ""
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr ""
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr ""
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr ""
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr ""
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr ""
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr ""
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr ""
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr ""
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
msgstr ""
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Teks"
#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr ""
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr ""
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr ""
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr ""
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr ""
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr ""
#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr ""
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr ""
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr ""
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr ""
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr ""
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr ""
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr ""
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr ""
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr ""
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr ""
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr ""
#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr ""
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr ""
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr ""
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr ""
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr ""
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr ""
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr ""
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr ""
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr ""
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr ""
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr ""
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr ""
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr ""
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr ""
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr ""
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr ""
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr ""
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a Lazarus package."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr ""
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr ""
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr ""
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr ""
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr ""
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr ""
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr ""
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr ""
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr ""
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr ""
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "verwyder"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr ""
#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr ""
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Cannot register components without unit"
msgstr ""
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr ""
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr ""
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr ""
#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr ""
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr ""
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr ""
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr ""
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr ""
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr ""
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr ""
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr ""
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr ""
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr ""
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options / Additions and Overrides%s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr ""
#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr ""
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr ""
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr ""
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr ""
#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr ""
#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr ""
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr ""
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgstr ""
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr ""
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr ""
#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Alles>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr ""
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr ""
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr ""
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr ""
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Spring no seleksie"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Nuks>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objek"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr ""
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tipe"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr ""
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr ""
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr ""
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr ""
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr ""
#: lazarusidestrconsts.lisposavesessionfoldstate
msgid "Save fold info"
msgstr ""
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr ""
#: lazarusidestrconsts.lisposavesessionjumphistory
msgid "Save jump history"
msgstr ""
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr ""
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr ""
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr ""
#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr ""
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr ""
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr ""
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr ""
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr ""
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr ""
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr ""
#: lazarusidestrconsts.lisprogramnotfound
msgid "Program %s not found"
msgstr ""
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr ""
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr ""
#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add Files to Project"
msgstr ""
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr ""
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr ""
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr ""
#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr ""
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid Pascal unit name"
msgstr ""
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Ongeldige weergawe"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr ""
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr ""
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr ""
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Pakket Naam:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Pakket is nie gevind nie"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr ""
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr ""
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisprojaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to Project"
msgstr "Las by projek"
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Eenheid naam bestaan alreeds"
#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr ""
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projek het verander"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr ""
#: lazarusidestrconsts.lisprojectcount
msgid "%d projects"
msgstr ""
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr ""
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr ""
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Projek lêer"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr ""
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Projek informasie lêer is geskrap"
#: lazarusidestrconsts.lisprojectinformation
#, fuzzy
#| msgid "Project Information"
msgid "Project information"
msgstr "Projek Informasie"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projek is hardloopbaar"
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr ""
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr ""
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr ""
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr ""
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr ""
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr ""
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built"
msgstr ""
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "projek eenheid"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr ""
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr ""
#: lazarusidestrconsts.lisprojfiles
msgid "Files:"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr ""
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr ""
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr ""
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr ""
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr ""
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Fout"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr ""
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr ""
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Vra vir waarde"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr ""
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr ""
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr ""
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr ""
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr ""
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr ""
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr ""
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid exclude filter"
msgstr ""
#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid include filter"
msgstr ""
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ""
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr ""
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr ""
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr ""
#: lazarusidestrconsts.lispwnewproject
#, fuzzy
#| msgid "New Project"
msgid "&New Project"
msgstr "Nuwe Projek"
#: lazarusidestrconsts.lispwopenproject
#, fuzzy
#| msgid "Open Project"
msgid "&Open Project"
msgstr "Laai Projek"
#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent Project"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Laai Onlangse"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr ""
#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr ""
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr ""
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr ""
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr ""
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr ""
#: lazarusidestrconsts.lisquitlazarus
#, fuzzy
#| msgid "Quit Lazarus"
msgid "&Quit Lazarus"
msgstr "Verlaat Lazarus"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Lees Fout"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr ""
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr ""
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr ""
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr ""
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr ""
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Herdoen"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Registers"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr ""
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr ""
#: lazarusidestrconsts.lisremove
#, fuzzy
#| msgid "remove"
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "verwyder"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr ""
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Verwyder alle eenhede"
#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr ""
#: lazarusidestrconsts.lisremovefromproject
#, fuzzy
#| msgid "Remove from project"
msgid "Remove from Project"
msgstr "Verwyder van projek"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr ""
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr ""
#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr ""
#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr ""
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr ""
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr ""
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr ""
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""
#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr ""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr ""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr ""
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr ""
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr ""
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr ""
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr ""
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr ""
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr ""
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr ""
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr ""
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr ""
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr ""
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Vervang"
#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacedtypeswiths
msgid "Replaced type \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr ""
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr ""
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr ""
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr ""
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr ""
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr ""
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr ""
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr ""
#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr ""
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr ""
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr ""
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr ""
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr ""
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Herlaai"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr ""
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr ""
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr ""
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Regs"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr ""
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr ""
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr ""
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr ""
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr ""
#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr ""
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Hardloop"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr ""
#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Hardloop"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr ""
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr ""
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr ""
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Hardloop"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr ""
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr ""
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgstr ""
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr ""
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr ""
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr ""
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE is besig"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr ""
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr ""
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr ""
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""
#: lazarusidestrconsts.lissave
#, fuzzy
#| msgid "Save ..."
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Stoor..."
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Stoor Alles"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr ""
#: lazarusidestrconsts.lissaveallmessagestofile
#, fuzzy
#| msgid "Save all messages to file"
msgid "Save All Messages to File"
msgstr "Stoor alle boodskappe na leêr"
#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr ""
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr ""
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr ""
#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Stoor Alles"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr ""
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Stoor veranderinge?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr ""
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr ""
#: lazarusidestrconsts.lissavedsuccessfully
msgid "Saved successfully"
msgstr ""
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr ""
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr ""
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr ""
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr ""
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr ""
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr ""
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr ""
#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr ""
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Stoor voorkeure"
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Stoor"
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr ""
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr ""
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr ""
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr ""
#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr ""
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr ""
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr ""
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr ""
#: lazarusidestrconsts.lisselectanotherlclwidgetsetmacrolclwidgettype
msgid "Select another LCL widget set (macro LCLWidgetType)"
msgstr ""
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr ""
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr ""
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr ""
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr ""
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr ""
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr ""
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr ""
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr ""
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr ""
#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr ""
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr ""
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr ""
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr ""
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr ""
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr ""
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr ""
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr ""
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr ""
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr ""
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr ""
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr ""
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr ""
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr ""
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr ""
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview Gutter"
msgstr ""
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr ""
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr ""
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr ""
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr ""
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr ""
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr ""
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr ""
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr ""
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr ""
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr ""
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr ""
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr ""
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr ""
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr ""
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr ""
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr ""
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr ""
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr ""
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr ""
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr ""
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr ""
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr ""
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr ""
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr ""
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr ""
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Verwerp Spasie"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr ""
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opsies"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr ""
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr ""
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Aanvaar"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr ""
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr ""
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr ""
#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr ""
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr ""
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr ""
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr ""
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr ""
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr ""
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Spasieer evereedig"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr ""
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr ""
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr ""
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr ""
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr ""
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Stop"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr ""
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr ""
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr ""
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr ""
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr ""
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr ""
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr ""
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr ""
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr ""
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr ""
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr ""
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr ""
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Sukses"
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr ""
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr ""
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr ""
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr ""
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr ""
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr ""
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr ""
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr ""
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Keep"
#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr ""
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr ""
#: lazarusidestrconsts.listaborderof
#, fuzzy
#| msgid "Tab Order of"
msgid "Tab Order of %s"
msgstr "Keep orde van"
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr ""
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr ""
#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr ""
#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr ""
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr ""
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr ""
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr ""
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr ""
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr ""
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr ""
#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr ""
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ""
#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid "Inserts an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgstr ""
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr ""
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr ""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The Codetools found an error:%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr ""
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr ""
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr ""
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
msgid "The %s contains a nonexistent directory:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr ""
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr ""
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
msgstr ""
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr ""
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr ""
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr ""
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr ""
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr ""
#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr ""
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr ""
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr ""
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?"
msgstr ""
#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr ""
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr ""
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr ""
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr ""
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr ""
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr ""
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s to build modes?"
msgstr ""
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s to build modes?"
msgstr ""
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr ""
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr ""
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr ""
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""
#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr ""
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr ""
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
msgstr ""
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr ""
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr ""
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr ""
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr ""
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr ""
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr ""
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr ""
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr ""
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr ""
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr ""
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr ""
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr ""
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr ""
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr ""
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr ""
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr ""
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr ""
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr ""
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit %s%s%s already exists."
msgstr ""
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr ""
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr ""
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr ""
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr ""
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr ""
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr ""
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr ""
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr ""
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "hierdie hulp boodskap"
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr ""
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr ""
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr ""
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr ""
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr ""
#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr ""
#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr ""
#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr ""
#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Reël"
#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr ""
#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr ""
#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Staat"
#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr ""
#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr ""
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Titel"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr ""
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr ""
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: remove trailing path delimiter"
msgstr ""
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr ""
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr ""
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr ""
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr ""
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr ""
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr ""
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr ""
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr ""
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr ""
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr ""
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr ""
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr ""
#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr ""
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr ""
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr ""
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr ""
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr ""
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr ""
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr ""
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr ""
#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr ""
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr ""
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr ""
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr ""
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr ""
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr ""
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr ""
#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr ""
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr ""
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Lettertipe sonder UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr ""
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr ""
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr ""
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr ""
#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr ""
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr ""
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr ""
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr ""
#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr ""
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr ""
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr ""
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "nee"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr ""
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Tipe:"
#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr ""
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "ja"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr ""
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr ""
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr ""
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread2
msgid "Unable to add the dependency %s, because the package %s has already a dependency to %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr ""
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr ""
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr ""
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr ""
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr ""
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr ""
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr ""
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefile4
msgid "Unable to create file %s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file, because there is already a directory with this name."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr ""
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr ""
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr ""
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr ""
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr ""
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr ""
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr ""
#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr ""
#: lazarusidestrconsts.lisunabletoopen
msgid "Unable to open \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr ""
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr ""
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr ""
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr ""
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr ""
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr ""
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr ""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr ""
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr ""
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr ""
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr ""
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr ""
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr ""
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr ""
#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr ""
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritetofile
msgid "Unable to write to file %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr ""
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Ontdoen"
#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr ""
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr ""
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr ""
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr ""
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr ""
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr ""
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr ""
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr ""
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr ""
#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr ""
#: lazarusidestrconsts.lisunusedunitsof
msgid "Unused units of %s"
msgstr ""
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr ""
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Op"
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr ""
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr ""
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr ""
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr ""
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr ""
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr ""
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr ""
#: lazarusidestrconsts.lisuseandclose
msgid "Use and close"
msgstr ""
#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr ""
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr ""
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr ""
#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use exclude filter"
msgstr ""
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr ""
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr ""
#: lazarusidestrconsts.lisuseincludefilter
msgid "Use include filter"
msgstr ""
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr ""
#: lazarusidestrconsts.lisusemessagefile
msgid "Use message file:"
msgstr ""
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr ""
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr ""
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr ""
#: lazarusidestrconsts.lisusesub
msgctxt "lazarusidestrconsts.lisusesub"
msgid "Use >>"
msgstr ""
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr ""
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr ""
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr ""
#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr ""
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr ""
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr ""
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr ""
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr ""
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr ""
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr ""
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr ""
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr ""
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr ""
#: lazarusidestrconsts.lisviewbreakpointproperties
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr ""
#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr ""
#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr ""
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr ""
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr ""
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr ""
#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr ""
#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr ""
#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr ""
#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr ""
#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr ""
#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr ""
#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr ""
#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr ""
#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr ""
#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr ""
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%s%sThere is already a configuration from version %s in%s%s%s"
msgstr ""
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr ""
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr ""
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr ""
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr ""
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr ""
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr ""
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr ""
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr ""
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr ""
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr ""
#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr ""
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Eienskappe"
#: lazarusidestrconsts.liswlwatchlist
msgid "Watch List"
msgstr ""
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr ""
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr ""
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr ""
#: lazarusidestrconsts.lisworkingdirectorynotfound
msgid "Working directory %s not found"
msgstr ""
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr ""
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr ""
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr ""
#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr ""
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr ""
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr ""
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr ""
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldunabletodeletefile
msgid "Unable to delete file \"%s\""
msgstr ""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr ""
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr ""
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""
#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr ""
#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr ""
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr ""
#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr ""
#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr ""
#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr ""
#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr ""
#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr ""
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""
#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr ""
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr ""
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr ""
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr ""
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr ""
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr ""
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr ""
#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr ""
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr ""
#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr ""
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr ""
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnnameshint
msgid "Column Names"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
msgid "Strategy for saving Columns"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnwidthhint
msgid "Column Width"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomgeometry
msgid "Custom geometry"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomgeometryhint
msgid "User can define window's position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
msgid "Fixed default geometry"
msgstr ""
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
msgid "Always the same fixed position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
msgid "Let windowmanager decide"
msgstr ""
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
msgid "System windowmanagers have different strategies for positioning windows"
msgstr ""
#: lazarusidestrconsts.rsiwppositionwindowlisthint
msgid "Windows that have been open. They may be closed now."
msgstr ""
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr ""
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
msgid "Use previous position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplittercustomposition
msgid "Custom Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterdefault
msgid "Default Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
msgid "Restore with window"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
msgid "Restore Size"
msgstr ""
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikaans"
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabies"
#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or English)"
msgstr ""
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr ""
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr ""
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr ""
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Nederlands"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "English"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr ""
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr ""
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Duits"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr ""
#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr ""
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr ""
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr ""
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr ""
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr ""
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr ""
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr ""
#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr ""
#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr ""
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Rusies"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr ""
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr ""
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Spaans"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr ""
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr ""
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr ""
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr ""
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr ""
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr ""
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr ""
#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr ""
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Tipe"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr ""
#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr ""
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr ""
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr ""
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr ""
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr ""
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr ""
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr ""
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Makro's"
#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr ""
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr ""
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr ""
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr ""
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr ""
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr ""
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr ""
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr ""
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr ""
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr ""
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr ""
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr ""
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr ""
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr ""
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr ""
#: lazarusidestrconsts.srkmecbuildlazarus
#, fuzzy
#| msgid "Build lazarus"
msgid "Build Lazarus"
msgstr "Bou Lazarus"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr ""
#: lazarusidestrconsts.srkmeccleanupcompiled
msgid "clean up build files"
msgstr ""
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr ""
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr ""
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr ""
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr ""
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr ""
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr ""
#: lazarusidestrconsts.srkmeccompletecode
#, fuzzy
#| msgid "Complete code"
msgctxt "lazarusidestrconsts.srkmeccompletecode"
msgid "Complete Code"
msgstr "Voltooi bron"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr ""
#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr ""
#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr ""
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr ""
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr ""
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr ""
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr ""
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr ""
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr ""
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr ""
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr ""
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr ""
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr ""
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr ""
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr ""
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr ""
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr ""
#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr ""
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr ""
#: lazarusidestrconsts.srkmecfind
#, fuzzy
#| msgid "Find text"
msgid "Find Text"
msgstr "Vind volgende"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr ""
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr ""
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr ""
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr ""
#: lazarusidestrconsts.srkmecfindinfiles
#, fuzzy
#| msgid "Find in files"
msgid "Find in Files"
msgstr "Vind in leêrs"
#: lazarusidestrconsts.srkmecfindnext
#, fuzzy
#| msgid "Find next"
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Vind volgende"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr ""
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr ""
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
#, fuzzy
#| msgid "Find previous"
msgid "Find Previous"
msgstr "Vind vorige"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr ""
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr ""
#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr ""
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr ""
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr ""
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr ""
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr ""
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr ""
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr ""
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr ""
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor half-word left"
msgstr ""
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor half-word right"
msgstr ""
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr ""
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr ""
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr ""
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr ""
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr ""
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr ""
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr ""
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspekteur"
#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr ""
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr ""
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr ""
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr ""
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr ""
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr ""
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr ""
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr ""
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr ""
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr ""
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr ""
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr ""
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr ""
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr ""
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr ""
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr ""
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr ""
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr ""
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr ""
#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr ""
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr ""
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr ""
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr ""
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr ""
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr ""
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr ""
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr ""
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr ""
#: lazarusidestrconsts.srkmecreplace
#, fuzzy
#| msgid "Replace text"
msgid "Replace Text"
msgstr "Vervang teks"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Rapporteer 'n probleem..."
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr ""
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr ""
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "hardloop program"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr ""
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr ""
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr ""
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr ""
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr ""
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr ""
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr ""
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Kies alles"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr ""
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr ""
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr ""
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select half-word left"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select half-word right"
msgstr ""
#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr ""
#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr ""
#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr ""
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr ""
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr ""
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr ""
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr ""
#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr ""
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr ""
#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr ""
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr ""
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr ""
#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr ""
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr ""
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr ""
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr ""
#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr ""
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr ""
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr ""
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr ""
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr ""
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr ""
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr ""
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr ""
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr ""
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr ""
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr ""
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr ""
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr ""
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr ""
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr ""
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr ""
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr ""
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr ""
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr ""
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr ""
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr ""
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr ""
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr ""
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr ""
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr ""
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr ""
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr ""
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr ""
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr ""
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr ""
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr ""
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr ""
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr ""
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr ""
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr ""
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr ""
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr ""
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr ""
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr ""
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr ""
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr ""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr ""
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr ""
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr ""
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr ""
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr ""
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr ""
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr ""
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr ""
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "Sluit Bladsy"
#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Kopieer lêer"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr ""
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr ""
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr ""
#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr ""
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr ""
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr ""
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr ""
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr ""
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Gaan na Boekmerke"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr ""
#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "Inspekteur..."
#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr ""
#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr ""
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr ""
#: lazarusidestrconsts.uemmovepageleft
#, fuzzy
#| msgid "Move page left"
msgid "Move Page Left"
msgstr "Skyf bladsy links"
#: lazarusidestrconsts.uemmovepageleftmost
#, fuzzy
#| msgid "Move page leftmost"
msgid "Move Page Leftmost"
msgstr "Skyf bladsy na vêr links"
#: lazarusidestrconsts.uemmovepageright
#, fuzzy
#| msgid "Move page right"
msgid "Move Page Right"
msgstr "Skyf bladsy regs"
#: lazarusidestrconsts.uemmovepagerightmost
#, fuzzy
#| msgid "Move page rightmost"
msgid "Move Page Rightmost"
msgstr "Skyf bladsy na vêr regs"
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr ""
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr ""
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr ""
#: lazarusidestrconsts.uemnextbookmark
#, fuzzy
#| msgid "Goto next Bookmark"
msgid "Goto Next Bookmark"
msgstr "Gaan na volgende Boekmerk"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Gemodifiseer"
#: lazarusidestrconsts.uemopenfileatcursor
#, fuzzy
#| msgid "&Open file at cursor"
msgid "&Open File at Cursor"
msgstr "&Laai lêer by merker"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr ""
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Prosedure Spring"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr ""
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr ""
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Hardloop tot by Merker"
#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr ""
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Wys Lyn Nommers"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr ""
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr ""
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr ""
#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr ""
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Nog nie geimplementeer nie"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr ""
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr ""
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr ""
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Druk taaklys items"