mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-11-03 06:59:29 +01:00
19348 lines
611 KiB
Plaintext
19348 lines
611 KiB
Plaintext
msgid ""
|
||
msgstr ""
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Project-Id-Version: lazaruside\n"
|
||
"POT-Creation-Date: \n"
|
||
"PO-Revision-Date: 2013-05-12 21:00+0100\n"
|
||
"Last-Translator: Lucas Martin <codedeep@hotmail.com>\n"
|
||
"Language-Team: \n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
|
||
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
|
||
msgid "Select Groups"
|
||
msgstr "Seleccionar Grupos"
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
|
||
msgid "Select groups to disable when breakpoint is hit"
|
||
msgstr "Seleccionar grupos para desactivar cuando salte punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
|
||
msgid "Select groups to enable when breakpoint is hit"
|
||
msgstr "Seleccionar grupos para activar cuando salte punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
|
||
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
|
||
msgstr "Algunos grupos en la lista Activar / Desactivar no existen.%0:sCrearlos?%0:s%0:s%1:s"
|
||
|
||
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
||
msgid "Use predefined scheme"
|
||
msgstr "Usar combinación predefinida"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetall
|
||
msgid "Reset all settings"
|
||
msgstr "Restablecer todos los ajustes"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetgutter
|
||
msgid "Reset all gutter settings"
|
||
msgstr "Restablecer todos los ajustes de la columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresettext
|
||
msgid "Reset all text settings"
|
||
msgstr "Restablecer todos los ajustes de texto"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
||
msgid "Add history point"
|
||
msgstr "Añadir punto al historial"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
||
msgid "Context Menu"
|
||
msgstr "Menu Contextual"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
||
msgid "Context Menu (debug)"
|
||
msgstr "Menu Contextual (debug)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
||
msgid "Context Menu (tab)"
|
||
msgstr "Menu Contextual (tab)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
||
msgid "Jumps to implementation"
|
||
msgstr "Salto a la implementacion"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
||
msgid "Jumps to implementation/other block end"
|
||
msgstr "Salto a la implementacion/final bloque"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
||
msgid "History back"
|
||
msgstr "Retroceder en el historial"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
||
msgid "History forward"
|
||
msgstr "Avanzar en el historial"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
||
msgid "Nothing/Default"
|
||
msgstr "Nada/Por defecto"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
||
msgid "Paste"
|
||
msgstr "Pegar"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
||
msgid "Continue %0:s (Bound to: %1:s)"
|
||
msgstr "Continuar %0:s (Limitado a: %1:s)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
||
msgid "Continue %0:s"
|
||
msgstr "Continuar %0:s"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
||
msgid "Select text"
|
||
msgstr "Selecionar texto"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
||
msgid "Select text (lines)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
||
msgid "Select text (tokens)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
||
msgid "Select text (words)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
||
#, fuzzy
|
||
#| msgid "Select text (Columns)"
|
||
msgid "Select text (Column mode)"
|
||
msgstr "Selecionar texto (Columnas)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
||
#, fuzzy
|
||
#| msgid "Select text (Lines)"
|
||
msgid "Select text (Line mode)"
|
||
msgstr "Selecionar texto (Lineas)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
||
msgid "Set free bookmark"
|
||
msgstr "Establecer bookmark libre"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
||
msgid "Select current Line (Full)"
|
||
msgstr "Selecionar Linea actual (Completa)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
||
msgid "Select current Line (Text)"
|
||
msgstr "Selecionar Linea actual (Texto)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
||
msgid "Select current Paragraph"
|
||
msgstr "Selecionar Paragrafo actual"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
||
msgid "Select current Word"
|
||
msgstr "Selecionar Palabra actual"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
||
msgid "Reset zoom"
|
||
msgstr "Resetear zoom"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplediff
|
||
#| msgid "This page does not represent your current settings. See advandced page. Use this page to reset any advanced changes"
|
||
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
||
msgstr "Esta página no representa sus ajustes actuales. Vea la página de ajustes avanzados. Utilice esta página para restaurar cualquier cambio de ajustes avanzado"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
||
msgid "General"
|
||
msgstr "General"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
||
#, fuzzy
|
||
#| msgid "Standard, All actions (breakpoint, fold) on Mouse down"
|
||
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
||
msgstr "Normal. Todas las acciones (punto de interrupción, plegado) al hacer clic"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
||
#, fuzzy
|
||
#| msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
|
||
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
||
msgstr "Extendido, Acciones (punto de interrupción, plegado) al soltar el ratón. Selección hacer clic y mover"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
||
msgid "Gutter"
|
||
msgstr "Columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
||
msgid "Right mouse includes caret move"
|
||
msgstr "Clic Derecho también desplaza el cursor de texto"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
||
msgid "Text"
|
||
msgstr "Texto"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
||
msgid "Alt-Ctrl Button"
|
||
msgstr "Alt-Ctrl Boton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
||
msgid "Alt-Ctrl Wheel"
|
||
msgstr "Alt-Ctrl Rueda raton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
||
msgid "Alt Button"
|
||
msgstr "Alt Boton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
||
msgid "Alt Wheel"
|
||
msgstr "Alt Rueda de raton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
||
msgid "Ctrl Button"
|
||
msgstr "Ctrl Boton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
||
msgid "Ctrl Wheel"
|
||
msgstr "Rueda de raton Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
||
#, fuzzy
|
||
#| msgid "Drag Selection (copy/paste)"
|
||
msgid "Drag selection (copy/paste)"
|
||
msgstr "Arrastrar selección (copiar/pegar)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
||
msgid "Extra-1 Button"
|
||
msgstr "Boton Extra-1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
||
msgid "Extra-2 Button"
|
||
msgstr "Boton Extra-2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
||
msgid "Alt Double"
|
||
msgstr "Doble Atl"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
||
msgid "Ctrl Double"
|
||
msgstr "Doble Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
||
msgid "Double"
|
||
msgstr "Doble"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
||
msgid "Shift Double"
|
||
msgstr "Doble Mayusculas"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
||
msgid "Quad"
|
||
msgstr "Cuádruple"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
||
msgid "Triple"
|
||
msgstr "Triple"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
||
msgid "Middle Button"
|
||
msgstr "Botón Central"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
||
msgid "Middle"
|
||
msgstr "Central"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
||
msgid "Extra 1"
|
||
msgstr "Extra 1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
||
msgid "Extra 2"
|
||
msgstr "Extra 2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
||
msgid "Left 1"
|
||
msgstr "Izquierda 1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
||
msgid "Left 2"
|
||
msgstr "Izquierda 2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
||
msgid "Right"
|
||
msgstr "Derecho"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
||
msgid "Wheel"
|
||
msgstr "Rueda de raton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
||
msgid "Right Button"
|
||
msgstr "Boton Derecho"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
||
msgid "Shift-Alt-Ctrl Button"
|
||
msgstr "Mayus-Alt-Ctrl Boton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
||
msgid "Shift-Alt-Ctrl"
|
||
msgstr "Mayus-Alt-Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
||
msgid "Shift-Alt Button"
|
||
msgstr "Mayus-Alt Boton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
||
msgid "Shift-Alt Wheel"
|
||
msgstr "Mayus-Alt Rueda de raton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
||
msgid "Shift-Ctrl Button"
|
||
msgstr "Mayus-Ctrl Boton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
||
msgid "Shift-Ctrl Wheel"
|
||
msgstr "Mayus-Ctrl Rueda de raton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
||
msgid "Shift Button"
|
||
msgstr "Mayusculas Boton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
||
msgid "Wheel"
|
||
msgstr "Rueda de raton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
||
msgid "Shift Wheel"
|
||
msgstr "Mayusculas Rueda de raton"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewarning
|
||
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
||
msgstr "Tiene cambios sin guardar. El uso de ésta página revertirá cualquier cambio hecho en la página avanzada"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
||
msgid "Scroll horizontal (System speed)"
|
||
msgstr "Scroll horizontal (Sistema velocidad)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
||
msgid "Scroll horizontal (Single line)"
|
||
msgstr "Scroll horizontal (Linea simple)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
||
msgid "Scroll horizontal (Page)"
|
||
msgstr "Scroll horizontal (Página)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
||
msgid "Scroll horizontal (Half page)"
|
||
msgstr "Scroll horizontal (Media página)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
||
msgid "Scroll horizontal (Page, less one line)"
|
||
msgstr "Scroll horizontal (Página, menos una linea)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
||
msgid "Nothing/Default"
|
||
msgstr "Nada/Por Defecto"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
||
msgid "Scroll (System speed)"
|
||
msgstr "Scroll (sistema velocidad)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
||
msgid "Scroll (Single line)"
|
||
msgstr "Scroll (Linea simple)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
||
msgid "Scroll (Page)"
|
||
msgstr "Scroll (Página)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
||
msgid "Scroll (Half page)"
|
||
msgstr "Scroll (Media pagina)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
||
msgid "Scroll (Page, less one line)"
|
||
msgstr "Scroll (Pagina, menos una linea)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
||
msgid "Zoom"
|
||
msgstr "Zoom"
|
||
|
||
#: lazarusidestrconsts.dlfnopredefinedscheme
|
||
msgid "< None >"
|
||
msgstr "< Ninguno >"
|
||
|
||
#: lazarusidestrconsts.dlfreadonlycolor
|
||
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
||
msgid "Read Only"
|
||
msgstr "Sólo-Lectura"
|
||
|
||
#: lazarusidestrconsts.dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr "Minúsculas, primera letra en mayúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr "Añadir operador de asignación :="
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
||
msgid "Brackets highlight"
|
||
msgstr "Resaltado de paréntesis"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
||
msgid "Code folding tree"
|
||
msgstr "Plegado de código"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdefault
|
||
msgid "Default Text"
|
||
msgstr "Texto Predeterminado"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
||
msgid "Disabled breakpoint"
|
||
msgstr "Punto de interrupción desactivado"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
||
msgid "Enabled breakpoint"
|
||
msgstr "Punto de interrupción activado"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
||
msgid "Error line"
|
||
msgstr "Línea de error"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
||
msgid "Execution point"
|
||
msgstr "Punto de ejecución"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
||
msgid "Folded code marker"
|
||
msgstr "Marcador de plegado de código"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
||
msgid "Global"
|
||
msgstr "Global"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
||
msgid "Gutter"
|
||
msgstr "Columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
||
msgid "Line"
|
||
msgstr "Línea"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
||
msgid "Syncron Edit"
|
||
msgstr "Edición Sincronizada"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
||
msgid "Template Edit"
|
||
msgstr "Edición de Plantilla"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
||
msgid "Text"
|
||
msgstr "Texto"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
||
msgid "Gutter Separator"
|
||
msgstr "Separador de la columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
||
msgid "Incremental others"
|
||
msgstr "Incremental, otros"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
||
msgid "Highlight current word"
|
||
msgstr "Resaltar palabra actual"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
||
msgid "Incremental search"
|
||
msgstr "Incremental, busqueda"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
||
msgid "Invalid breakpoint"
|
||
msgstr "Punto de Interrupción no válido"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
||
msgid "Current line highlight"
|
||
msgstr "Resaltado de línea actual"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
||
msgid "Line number"
|
||
msgstr "Número de línea"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
||
msgid "Modified line"
|
||
msgstr "Línea modificada"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
||
msgid "Mouse link"
|
||
msgstr "Enlace de Ratón"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
||
msgid "Selected Area"
|
||
msgstr "Area seleccionada"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
||
msgid "Active Cell"
|
||
msgstr "Celda activa"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
||
msgid "Other Cells"
|
||
msgstr "Otras celdas"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr "Celdas sincronizadas"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
||
msgid "Active Cell"
|
||
msgstr "Celda activa"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
||
msgid "Other Cells"
|
||
msgstr "Otras celdas"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr "Celdas sincronizadas"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
||
msgid "Text block"
|
||
msgstr "Bloque de texto"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
||
msgid "Unknown breakpoint"
|
||
msgstr "Punto de interrupción desconocido"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
||
msgid "Word-Brackets"
|
||
msgstr "Palabra Inicial-Final"
|
||
|
||
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
||
msgid "Visualized Special Chars"
|
||
msgstr "Visualizados Caracteres especiales"
|
||
|
||
#: lazarusidestrconsts.dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "Añadir punto y coma"
|
||
|
||
#: lazarusidestrconsts.dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "Ajustar línea superior para mostrar el comentario anterior"
|
||
|
||
#: lazarusidestrconsts.dlgallfiles
|
||
msgid "All files"
|
||
msgstr "Todos los archivos"
|
||
|
||
#: lazarusidestrconsts.dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "Alfabéticamente"
|
||
|
||
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
||
msgid "Always visible cursor"
|
||
msgstr "Cursor siempre visible"
|
||
|
||
#: lazarusidestrconsts.dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr "Acción de archivo ambigua:"
|
||
|
||
#: lazarusidestrconsts.dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr "Advertencia al compilar"
|
||
|
||
#: lazarusidestrconsts.dlgansicommenttab
|
||
msgid "Ansi (* *)"
|
||
msgstr "Ansi (* *)"
|
||
|
||
#: lazarusidestrconsts.dlgapplicationsettings
|
||
#, fuzzy
|
||
#| msgid "Application Settings"
|
||
msgid "Application settings"
|
||
msgstr "Configuraciones de la aplicación"
|
||
|
||
#: lazarusidestrconsts.dlgassertcode
|
||
#, fuzzy
|
||
#| msgid "Include Assertion Code"
|
||
msgid "Include assertion code"
|
||
msgstr "Incluir código de Aserción"
|
||
|
||
#: lazarusidestrconsts.dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr "Crear formularios automáticamente:"
|
||
|
||
#: lazarusidestrconsts.dlgautocreatenewforms
|
||
msgid "When creating new forms, add them to auto-created forms"
|
||
msgstr "Al crear formularios nuevos, añadirlos a formularios creados automáticamente"
|
||
|
||
#: lazarusidestrconsts.dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "Borrar archivo automáticamente"
|
||
|
||
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
||
msgid "Auto Display Function Prototypes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautohidecursor
|
||
msgid "Hide mouse when typing"
|
||
msgstr "Ocultar el cursor del ratón al escribir"
|
||
|
||
#: lazarusidestrconsts.dlgautoindent
|
||
msgctxt "lazarusidestrconsts.dlgautoindent"
|
||
msgid "Auto indent"
|
||
msgstr "Sangrar Automáticamente"
|
||
|
||
#: lazarusidestrconsts.dlgautoindentlink
|
||
#, fuzzy
|
||
#| msgid "(Setup smart indent)"
|
||
msgid "(Set up smart indent)"
|
||
msgstr "(Configurar sangrado inteligente)"
|
||
|
||
#: lazarusidestrconsts.dlgautoindenttype
|
||
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
||
msgid "Auto indent"
|
||
msgstr "Sangrar Automáticamente"
|
||
|
||
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
||
msgid "Auto remove empty methods"
|
||
msgstr "Eliminar métodos vacios automáticamente"
|
||
|
||
#: lazarusidestrconsts.dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr "Renombrar automáticamente en minúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgautosave
|
||
#, fuzzy
|
||
#| msgid "Auto save"
|
||
msgid "Auto Save"
|
||
msgstr "Guardar Automáticamente"
|
||
|
||
#: lazarusidestrconsts.dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr "Formularios disponibles:"
|
||
|
||
#: lazarusidestrconsts.dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "Fondo"
|
||
|
||
#: lazarusidestrconsts.dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(no hay subdirectorio)"
|
||
|
||
#: lazarusidestrconsts.dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr "Mismo nombre (en subdirectorio)"
|
||
|
||
#: lazarusidestrconsts.dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr "Detrás de los métodos"
|
||
|
||
#: lazarusidestrconsts.dlgblockgroupoptions
|
||
#, fuzzy
|
||
#| msgid "Selection:"
|
||
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
||
msgid "Selection"
|
||
msgstr "Selección"
|
||
|
||
#: lazarusidestrconsts.dlgblockindent
|
||
#, fuzzy
|
||
#| msgid "Block indent"
|
||
msgid "Block indent (spaces)"
|
||
msgstr "Sangrado de bloque (espacios)"
|
||
|
||
#: lazarusidestrconsts.dlgblockindentkeys
|
||
msgid "Block indent"
|
||
msgstr "Sangrado de bloque"
|
||
|
||
#: lazarusidestrconsts.dlgblockindentlink
|
||
msgid "(edit keys)"
|
||
msgstr "(editar llaves)"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypecopy
|
||
msgid "Space/tab as prev Line"
|
||
msgstr "Espacio/TAB como en línea anterior"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypepos
|
||
msgid "Position only"
|
||
msgstr "Solamente posición"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypespace
|
||
msgid "Spaces"
|
||
msgstr "Espacios"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
||
msgid "Tabs, cut off"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
||
msgid "Tabs, then spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblocktabindent
|
||
msgid "Block indent (tabs)"
|
||
msgstr "Sangrado de bloque (tabs)"
|
||
|
||
#: lazarusidestrconsts.dlgbrackethighlight
|
||
msgid "Bracket highlight"
|
||
msgstr "Resaltado de paréntesis"
|
||
|
||
#: lazarusidestrconsts.dlgbracketmatchgroup
|
||
msgid "Matching bracket pairs"
|
||
msgstr "Coincidente con pares de paréntesis"
|
||
|
||
#: lazarusidestrconsts.dlgcasesensitive
|
||
#, fuzzy
|
||
#| msgid "&Case Sensitive"
|
||
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
||
msgid "&Case sensitive"
|
||
msgstr "&Sensible a mayúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr "Comprobando opciones del compilador"
|
||
|
||
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
||
msgid "orphaned file found: %s"
|
||
msgstr "archivo huérfano encontrado: %s"
|
||
|
||
#: lazarusidestrconsts.dlgccoresults
|
||
msgid "Results"
|
||
msgstr "Resultados"
|
||
|
||
#: lazarusidestrconsts.dlgccotest
|
||
msgctxt "lazarusidestrconsts.dlgccotest"
|
||
msgid "Test"
|
||
msgstr "Probar"
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr "Probando: Comprobando compilador ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr "Probando: Comprobando configuración del compilador ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr "Probando: Comprobando fecha del compilador ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr "Probando: Compilando un archivo vacío ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestmissingppu
|
||
msgid "Test: Checking missing fpc ppu ..."
|
||
msgstr "Probando: Comprobando ppu de fpc desaparecida ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr "Probando: Comprobando fuentes en las rutas de búsqueda ppu de fpc ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr "Probando: Compilando un archivo vacío"
|
||
|
||
#: lazarusidestrconsts.dlgccousingconfigfile
|
||
msgid "using config file %s"
|
||
msgstr "utilizando el archivo de configuración %s"
|
||
|
||
#: lazarusidestrconsts.dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr "Orden de la clase"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "En último lugar"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr "minúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgcdtpreview
|
||
#, fuzzy
|
||
#| msgid "Preview (Max line length = 1)"
|
||
msgid "Preview (max line length = 1)"
|
||
msgstr "Vista previa (máx. largo de línea = 1)"
|
||
|
||
#: lazarusidestrconsts.dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr "Prefijo de lectura"
|
||
|
||
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr "Sufijo Almacenado"
|
||
|
||
#: lazarusidestrconsts.dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr "MAYÚSCULAS"
|
||
|
||
#: lazarusidestrconsts.dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr "Prefijo de variable"
|
||
|
||
#: lazarusidestrconsts.dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr "Prefijo de escritura"
|
||
|
||
#: lazarusidestrconsts.dlgcentercursorline
|
||
#, fuzzy
|
||
#| msgid "Center Cursor Line"
|
||
msgid "Center cursor line"
|
||
msgstr "Centrar línea de cursor"
|
||
|
||
#: lazarusidestrconsts.dlgcharcasefileact
|
||
#, fuzzy
|
||
#| msgid "Save As - auto rename pascal files lower case"
|
||
msgid "Save As - auto rename Pascal files lower case"
|
||
msgstr "Guardar como - autorenombrar archivos pascal en minúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
||
msgid "Check packages on form create"
|
||
msgstr "Comprobar los paquetes al crear el formulario"
|
||
|
||
#: lazarusidestrconsts.dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr "Escoja archivo de plantilla de código (*.dci)"
|
||
|
||
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr "Mostrar botón cerrar en las pestañas"
|
||
|
||
#: lazarusidestrconsts.dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr "Combinación de colores"
|
||
|
||
#: lazarusidestrconsts.dlgcmacro
|
||
#, fuzzy
|
||
#| msgid "C Style Macros (global)"
|
||
msgid "C style macros (global)"
|
||
msgstr "Estilo de macros C (global)"
|
||
|
||
#: lazarusidestrconsts.dlgcoansistr
|
||
#, fuzzy
|
||
#| msgid "Use ansi strings"
|
||
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
||
msgid "Use Ansistrings"
|
||
msgstr "Usar ansi strings"
|
||
|
||
#: lazarusidestrconsts.dlgcoasmstyle
|
||
#, fuzzy
|
||
#| msgid "Assembler style:"
|
||
msgid "Assembler style"
|
||
msgstr "Estilo de ensamblador:"
|
||
|
||
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
||
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
||
msgid "Messages"
|
||
msgstr "Mensajes"
|
||
|
||
#: lazarusidestrconsts.dlgcochecksandassertion
|
||
msgid "Checks and assertion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocompilercommands
|
||
msgid "Compiler Commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocops
|
||
#, fuzzy
|
||
#| msgid "C Style Operators (*=, +=, /= and -=)"
|
||
msgid "C style operators (*=, +=, /= and -=)"
|
||
msgstr "Estilo de operadores C (*=, +=, /= y -=)"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatemakefile
|
||
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Crear Makefile"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugging
|
||
#, fuzzy
|
||
#| msgid "Debugging info"
|
||
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
||
msgid "Debugging"
|
||
msgstr "Depurando información"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "Adiciones a la ruta del depurador (ninguna):"
|
||
|
||
#: lazarusidestrconsts.dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr "Creación de Código"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenableboth
|
||
msgid "Both"
|
||
msgstr "Ambos"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenablefold
|
||
msgid "Fold"
|
||
msgstr "Plegar"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenablehide
|
||
msgid "Hide"
|
||
msgstr "Ocultar"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
||
msgid "Reverse fold-order in Popup"
|
||
msgstr "Invertir el orden de plegado en ventana emergente"
|
||
|
||
#: lazarusidestrconsts.dlgcogdb
|
||
#, fuzzy
|
||
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
|
||
msgid "Generate debugging info for GDB (slower / increases exe-size)"
|
||
msgstr "Generar información de depuración para GDB (Retarda la compilación / incrementa tamaño del exe)"
|
||
|
||
#: lazarusidestrconsts.dlgcoheaptrc
|
||
#, fuzzy
|
||
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
|
||
msgid "Use Heaptrc unit (check for mem-leaks)"
|
||
msgstr "Usar la unidad Heaptrc (comprobacion de perdidas de memoria(mem-leaks))"
|
||
|
||
#: lazarusidestrconsts.dlgcoincfiles
|
||
#, fuzzy
|
||
#| msgid "Include Files (-Fi):"
|
||
msgid "Include files (-Fi):"
|
||
msgstr "Archivos de inclusión (-Fi):"
|
||
|
||
#: lazarusidestrconsts.dlgcoinfoforgdb
|
||
msgid "Info for GDB"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr "Librerias (-Fl):"
|
||
|
||
#: lazarusidestrconsts.dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "Enlazando"
|
||
|
||
#: lazarusidestrconsts.dlgcoloadsave
|
||
msgid "Load/Save"
|
||
msgstr "Cargar/Guardar"
|
||
|
||
#: lazarusidestrconsts.dlgcolor
|
||
msgid "Color"
|
||
msgstr "Color"
|
||
|
||
#: lazarusidestrconsts.dlgcolorlink
|
||
msgid "(Edit Color)"
|
||
msgstr "(Editar color)"
|
||
|
||
#: lazarusidestrconsts.dlgcolornotmodified
|
||
msgid "Not modified"
|
||
msgstr "Sin modificar"
|
||
|
||
#: lazarusidestrconsts.dlgcolors
|
||
msgctxt "lazarusidestrconsts.dlgcolors"
|
||
msgid "Colors"
|
||
msgstr "Colores"
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr "Parámetros de la línea de comandos (sin el nombre de la aplicación)"
|
||
|
||
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
||
msgid "Make default indent for new line if comment opens at column:"
|
||
msgstr "Hacer por defecto sangrado para nueva línea si un comentario se abre en columna:"
|
||
|
||
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
||
msgid "Limit indent to"
|
||
msgstr "Límite de sangrado a"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinue
|
||
msgid "Prefix comments on linebreak"
|
||
msgstr "Prefijos de comentarios en salto de linea"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematch
|
||
msgid "Match current line"
|
||
msgstr "Concide la linea actual"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
||
msgid "Match text including \"*\" of token \"(*\""
|
||
msgstr "Concide el texto incluiendo \"*\" de muestra \"(*\""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
||
msgid "Match whole line"
|
||
msgstr "Coincidir toda la línea"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
||
msgid "Match text after token \"%s\""
|
||
msgstr "Coincidir texto después de muestra \"%s\""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
||
msgid "Match text including token \"%s\""
|
||
msgstr "Coincide texto incluido muestra \"%s\""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
||
msgid "Prefix new line"
|
||
msgstr "Prefijo nueva linea"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
||
msgid "Align Prefix at indent of previous line"
|
||
msgstr "Alinear Prefijo con el sangrado de la linea anterior"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
||
msgid "Align Prefix below start of comment on first comment line"
|
||
msgstr "Alinear Prefijo a continuación inicio de comentario en primera línea de comentario"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
||
msgid "Do not indent prefix"
|
||
msgstr "No sangrar el prefijo"
|
||
|
||
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
||
msgid "Comments"
|
||
msgstr "Comentarios"
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
||
msgid "Extend, if matched or not matched"
|
||
msgstr "Extender, si coincide o no coincide"
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
||
msgid "Extend, if matched or not matched (not at EOL)"
|
||
msgstr "Extender, si coincide o no coincide (no en EOL)"
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
||
msgid "Extend, if matched"
|
||
msgstr "Extender, si coincide"
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
||
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
|
||
msgstr "Extender, si coincide y cursor en el medio de texto (no en EOL)"
|
||
|
||
#: lazarusidestrconsts.dlgcompilationandlinking
|
||
msgid "Compilation and Linking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessage
|
||
#, fuzzy
|
||
#| msgid "Compiler Messages"
|
||
msgid "Compiler messages"
|
||
msgstr "Mensajes del compilador"
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessages
|
||
msgid "Compiler messages language file"
|
||
msgstr "Archivo de idioma de los mensajes del compilador"
|
||
|
||
#: lazarusidestrconsts.dlgcompileroptions
|
||
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
||
msgid "Compiler Options"
|
||
msgstr "Opciones del Compilador"
|
||
|
||
#: lazarusidestrconsts.dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr "Completar Propiedades"
|
||
|
||
#: lazarusidestrconsts.dlgconfigandtarget
|
||
msgid "Config and Target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgconfigfiles
|
||
#, fuzzy
|
||
#| msgid "Config Files:"
|
||
msgid "Config files"
|
||
msgstr "Archivos de configuración"
|
||
|
||
#: lazarusidestrconsts.dlgcoother
|
||
msgctxt "lazarusidestrconsts.dlgcoother"
|
||
msgid "Other"
|
||
msgstr "Otros"
|
||
|
||
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
||
msgid "Other debugging info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr "Desbordamiento"
|
||
|
||
#: lazarusidestrconsts.dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr "Procesando"
|
||
|
||
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
||
msgid "Copy/Paste with fold info"
|
||
msgstr "Copiar/Pegar con información de plegado"
|
||
|
||
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr "Copiar palabra al Copiar Nada"
|
||
|
||
#: lazarusidestrconsts.dlgcorange
|
||
msgid "Range"
|
||
msgstr "Rango"
|
||
|
||
#: lazarusidestrconsts.dlgcorelocatable
|
||
msgid "Relocatable"
|
||
msgstr "Reubicable"
|
||
|
||
#: lazarusidestrconsts.dlgcosetasdefault
|
||
msgid "Set compiler options as default"
|
||
msgstr "Establecer las opciones del compilador por defecto"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowerr
|
||
#, fuzzy
|
||
#| msgid "Show Errors"
|
||
msgid "Show errors"
|
||
msgstr "Mostrar errores"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowoptions
|
||
#| msgid "Show Options"
|
||
msgid "&Show Options"
|
||
msgstr "Mo&strar Opciones"
|
||
|
||
#: lazarusidestrconsts.dlgcosmartlinkable
|
||
#, fuzzy
|
||
#| msgid "Smart Linkable"
|
||
msgid "Smart linkable"
|
||
msgstr "Enlazado inteligete"
|
||
|
||
#: lazarusidestrconsts.dlgcosources
|
||
#, fuzzy
|
||
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr "Otras fuentes (archivos .pp/.pas, usados solo por el IDE pero no por el compilador)"
|
||
|
||
#: lazarusidestrconsts.dlgcostack
|
||
msgid "Stack"
|
||
msgstr "Pila(stack)"
|
||
|
||
#: lazarusidestrconsts.dlgcostrip
|
||
#, fuzzy
|
||
#| msgid "Strip Symbols From Executable"
|
||
msgid "Strip symbols from executable"
|
||
msgstr "Eliminar Símbolos del ejecutable"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltype
|
||
#, fuzzy
|
||
#| msgid "Choose type of debug info"
|
||
msgid "Type of debug info"
|
||
msgstr "Elija el tipo de información de depuración"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypeauto
|
||
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
||
msgid "Automatic"
|
||
msgstr "Automatico"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
||
msgid "Dwarf2"
|
||
msgstr "Dwarf2"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
||
msgid "Dwarf with sets"
|
||
msgstr "Dwarf con conjuntos"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
||
msgid "Dwarf3 (beta)"
|
||
msgstr "Dwarf3 (beta)"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypestabs
|
||
msgid "Stabs"
|
||
msgstr "Stabs"
|
||
|
||
#: lazarusidestrconsts.dlgcotrashvariables
|
||
msgid "Trash variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcounitstyle
|
||
#, fuzzy
|
||
#| msgid "Unit Style"
|
||
msgid "Unit style"
|
||
msgstr "Estilo de unidad"
|
||
|
||
#: lazarusidestrconsts.dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr "Generar código para valgrind"
|
||
|
||
#: lazarusidestrconsts.dlgcoverbosity
|
||
msgid "Verbosity"
|
||
msgstr "Verbosidad"
|
||
|
||
#: lazarusidestrconsts.dlgcppinline
|
||
#, fuzzy
|
||
#| msgid "C++ Styled INLINE"
|
||
msgid "C++ styled INLINE"
|
||
msgstr "INLINE Estilizado C++"
|
||
|
||
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
|
||
msgid "Ctrl-middle-click on tab closes all others"
|
||
msgstr "Ctrl + clic del botón central del ratón en una pestaña cierra todas las demás"
|
||
|
||
#: lazarusidestrconsts.dlgcurlycommenttab
|
||
msgid "Curly { }"
|
||
msgstr "Llaves {}"
|
||
|
||
#: lazarusidestrconsts.dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr "Cursor más allá de EOL"
|
||
|
||
#: lazarusidestrconsts.dlgcursorgroupoptions
|
||
#, fuzzy
|
||
#| msgid "Cursor:"
|
||
msgid "Cursor"
|
||
msgstr "Cursor"
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipsselection
|
||
msgid "Cursor skips selection"
|
||
msgstr "Cursor salta la selección"
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipstab
|
||
msgid "Cursor skips tabs"
|
||
msgstr "Cursor salta tabulaciones"
|
||
|
||
#: lazarusidestrconsts.dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr "Extensión definida por usuario (.pp.xxx)"
|
||
|
||
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr "Ruta del editor"
|
||
|
||
#: lazarusidestrconsts.dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr "Tipo de depurador y ruta"
|
||
|
||
#: lazarusidestrconsts.dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr "Fuente predeterminada del editor"
|
||
|
||
#: lazarusidestrconsts.dlgdefvaluecolor
|
||
msgid "Default Value"
|
||
msgstr "Valor predeterminado"
|
||
|
||
#: lazarusidestrconsts.dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr "Borrar plantilla"
|
||
|
||
#: lazarusidestrconsts.dlgdesktop
|
||
msgid "Desktop"
|
||
msgstr "Escritorio"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopbuttons
|
||
msgid "Buttons - "
|
||
msgstr "Botones - "
|
||
|
||
#: lazarusidestrconsts.dlgdesktopfiles
|
||
#, fuzzy
|
||
#| msgid "Desktop files"
|
||
msgid "Desktop Files"
|
||
msgstr "Archivos del escritorio"
|
||
|
||
#: lazarusidestrconsts.dlgdesktophints
|
||
msgid "Hints"
|
||
msgstr "Descripciones"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmenus
|
||
msgid "Menus - "
|
||
msgstr "Menus - "
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmisc
|
||
msgid "Misc Options"
|
||
msgstr "Otras Opciones"
|
||
|
||
#: lazarusidestrconsts.dlgdirection
|
||
msgid "Direction"
|
||
msgstr "Dirección"
|
||
|
||
#: lazarusidestrconsts.dlgdisableantialiasing
|
||
msgid "Disable anti-aliasing"
|
||
msgstr "Desactivar anti-aliasing"
|
||
|
||
#: lazarusidestrconsts.dlgdividercolordefault
|
||
msgid "Use right margin color"
|
||
msgstr "Usar el mismo color que el margen derecho"
|
||
|
||
#: lazarusidestrconsts.dlgdividerdrawdepth
|
||
msgid "Draw divider level"
|
||
msgstr "Dibujar nivel divisor"
|
||
|
||
#: lazarusidestrconsts.dlgdividernestcolor
|
||
msgid "Nested line color"
|
||
msgstr "Color de líneas anidadas"
|
||
|
||
#: lazarusidestrconsts.dlgdividertopcolor
|
||
msgid "Line color"
|
||
msgstr "Color de Línea"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasbeginendname
|
||
msgid "Begin/End"
|
||
msgstr "Begin/End"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasprocedurename
|
||
msgid "Procedure/Function"
|
||
msgstr "Procedimiento/Función"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
||
msgid "Class/Struct"
|
||
msgstr "Class/Struct"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
||
msgid "Class/Struct (local)"
|
||
msgstr "Class/Struct (local)"
|
||
|
||
#: lazarusidestrconsts.dlgdivpastryname
|
||
msgid "Try/Except"
|
||
msgstr "Try/Except"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
||
msgid "Unit sections"
|
||
msgstr "Secciones de la Unidad"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasusesname
|
||
msgid "Uses clause"
|
||
msgstr "Clausula Uses"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
||
msgid "Var/Type"
|
||
msgstr "Var/Type"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
||
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
||
msgid "Var/Type (local)"
|
||
msgstr "Var/Type (local)"
|
||
|
||
#: lazarusidestrconsts.dlgedadd
|
||
#, fuzzy
|
||
#| msgid "Add..."
|
||
msgid "Add ..."
|
||
msgstr "Añadir ..."
|
||
|
||
#: lazarusidestrconsts.dlgedback
|
||
msgid "Back"
|
||
msgstr "Atrás"
|
||
|
||
#: lazarusidestrconsts.dlgedbold
|
||
msgid "Bold"
|
||
msgstr "Negrita"
|
||
|
||
#: lazarusidestrconsts.dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr "Subdirectorio"
|
||
|
||
#: lazarusidestrconsts.dlgedcodetempl
|
||
#, fuzzy
|
||
#| msgid "Code templates"
|
||
msgid "Code Templates"
|
||
msgstr "Plantillas de Código"
|
||
|
||
#: lazarusidestrconsts.dlgedcompleteblocks
|
||
#, fuzzy
|
||
#| msgid "Add close statement for pascal blocks"
|
||
msgid "Add close statement for Pascal blocks"
|
||
msgstr "Añadir sentencia de finalización en bloques pascal"
|
||
|
||
#: lazarusidestrconsts.dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr "Extensión definida por usuario"
|
||
|
||
#: lazarusidestrconsts.dlgeddelayinsec
|
||
msgid "(%s sec delay)"
|
||
msgstr "(%s seg. de retraso)"
|
||
|
||
#: lazarusidestrconsts.dlgeddisplay
|
||
msgid "Display"
|
||
msgstr "Visualizar"
|
||
|
||
#: lazarusidestrconsts.dlgededit
|
||
#, fuzzy
|
||
#| msgid "Edit..."
|
||
msgid "Edit ..."
|
||
msgstr "Editar ..."
|
||
|
||
#: lazarusidestrconsts.dlgedfiles
|
||
#, fuzzy
|
||
#| msgid "Editor files"
|
||
msgid "Editor Files"
|
||
msgstr "Archivos del Editor"
|
||
|
||
#: lazarusidestrconsts.dlgedidcomlet
|
||
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
||
msgid "Identifier completion"
|
||
msgstr "Completado de identificador"
|
||
|
||
#: lazarusidestrconsts.dlgedinvert
|
||
msgid "Invert"
|
||
msgstr "Invertir"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
||
msgid "Ignore Locks, use longest unused editor"
|
||
msgstr "Ignorar Bloqueos, usar el editor menos usado"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
||
msgid "Ignore Locks, if editor is current"
|
||
msgstr "Ignorar Bloqueos, si el editor es el actual"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
||
msgid "Ignore Locks, if editor in current window"
|
||
msgstr "Ignorar Bloqueos, si el editor está en la ventana actual"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
||
msgid "Locked, if text in view"
|
||
msgstr "Bloqueado, si el texto está a la vista"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
||
msgid "Unlocked"
|
||
msgstr "Desbloqueado"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
||
msgid "Unlocked, if text in centered view"
|
||
msgstr "Desbloqueado, si el texto está a la vista y centrado"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
||
msgid "New tab, existing or new window"
|
||
msgstr "Pestaña nueva, existente o en ventana nueva"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
||
msgid "New tab in new window"
|
||
msgstr "Pestaña nueva en ventana nueva"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
||
msgid "New tab in existing window"
|
||
msgstr "Pestaña nueva en ventana existente"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
||
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
||
msgstr "Esta opción usará el editor menos usado para un archivo, incluso si esta bloqueado y/o necesita desplazamiento. La decisión de cuál es el editor menos usado no será determinada por el orden en el que las ventanas fueron enfocadas, incluso si está establecido por la configuración \"Orden para el mismo criterio\". Esta opción siempre será exitosa, las demás opciones no serán comprobadas nunca."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
||
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
||
msgstr "Esta opción comprobará si el editor actualmente activo tiene el archivo de destino y si es así, será usado, incluso si está bloqueado y/o necesita desplazamiento"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
||
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
||
msgstr "Esta opción comprobará si hay un editor para el archivo de destino en la ventana actual y si es así, este editor será usado, incluso si está bloqueado y/o necesita desplazamiento"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
||
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
||
msgstr "Esta opción usará un editor bloqueado (y unicamente uno bloqueado), el cuál no necesite desplazamiento para mostrar el punto de destino del salto (ya estará en el area visible de la pantalla)."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
||
msgid "This option will use any not locked Editor."
|
||
msgstr "Esta opción usará cualquier editor sin bloquear"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
||
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
||
msgstr "Esta opción usará un editor sin bloquear, el cuál no necesite desplazamiento para para mostrar el punto de destino del salto (ya estará en el area visible de la pantalla, excluyendo 2-5 líneas en la parte superior/inferior)."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
||
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
||
msgstr "Esta opción abrirá una pestaña nueva en una ventana existente o nueva, si no se encuentra ninguna pestaña bloqueada. Esta opción siempre será exitosa, las demás opciones no serán comprobadas nunca."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
||
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
||
msgstr "Si no se encuentra ninguna pestaña bloqueada, entonces esta opción abrirá una pestaña nueva en una ventana nueva (incluso si otras ventanas existentes pudieran ser usadas para la pestaña nueva). Esta opción siempre será exitosa, las demás opciones no serán comprobadas nunca."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
||
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
|
||
msgstr "Si no se encuentra ninguna pestaña bloqueada esta opción abrirá una pestaña nueva en una ventana existente (y unicamente en una existente). La pestaña solo será abierta si una ventana existe y que aún no tenga un editor para el archivo de destino"
|
||
|
||
#: lazarusidestrconsts.dlgedital
|
||
msgid "Italic"
|
||
msgstr "Cursiva"
|
||
|
||
#: lazarusidestrconsts.dlgeditorfontsize
|
||
msgid "Editor font size"
|
||
msgstr "Tamaño fuente del editor"
|
||
|
||
#: lazarusidestrconsts.dlgeditoroptions
|
||
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
||
msgid "Editor options"
|
||
msgstr "Opciones del editor"
|
||
|
||
#: lazarusidestrconsts.dlgeditschemdefaults
|
||
msgid "Scheme globals"
|
||
msgstr "Combinaciones globales"
|
||
|
||
#: lazarusidestrconsts.dlgedmisc
|
||
msgid "Misc"
|
||
msgstr "Miscelánea"
|
||
|
||
#: lazarusidestrconsts.dlgedoff
|
||
msgid "Off"
|
||
msgstr "No Usar"
|
||
|
||
#: lazarusidestrconsts.dlgedon
|
||
msgid "On"
|
||
msgstr "Usar"
|
||
|
||
#: lazarusidestrconsts.dlgedtabindent
|
||
msgid "Tab and Indent"
|
||
msgstr "Tabulación y Sangrado"
|
||
|
||
#: lazarusidestrconsts.dlgedunder
|
||
msgid "Underline"
|
||
msgstr "Subrayado"
|
||
|
||
#: lazarusidestrconsts.dlgelementattributes
|
||
msgid "Element Attributes"
|
||
msgstr "Atributos del Elemento"
|
||
|
||
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
||
msgid "End key jumps to nearest end"
|
||
msgstr "Saltar al end más cercano con la tecla END"
|
||
|
||
#: lazarusidestrconsts.dlgenvask
|
||
msgid "Ask"
|
||
msgstr "Preguntar"
|
||
|
||
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr "Nota: Los Archivos del proyecto son todos los archivos en el directorio del proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "Copia de seguridad"
|
||
|
||
#: lazarusidestrconsts.dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "Archivos"
|
||
|
||
#: lazarusidestrconsts.dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "Rejilla"
|
||
|
||
#: lazarusidestrconsts.dlgenvlanguage
|
||
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
||
msgid "Language"
|
||
msgstr "Idioma"
|
||
|
||
#: lazarusidestrconsts.dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr "Líneas guía"
|
||
|
||
#: lazarusidestrconsts.dlgenvmisc
|
||
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Miscelánea"
|
||
|
||
#: lazarusidestrconsts.dlgenvnone
|
||
msgctxt "lazarusidestrconsts.dlgenvnone"
|
||
msgid "None"
|
||
msgstr "Nada"
|
||
|
||
#: lazarusidestrconsts.dlgenvotherfiles
|
||
#, fuzzy
|
||
#| msgid "Other files"
|
||
msgid "Other Files"
|
||
msgstr "Otros Archivos"
|
||
|
||
#: lazarusidestrconsts.dlgenvproject
|
||
#, fuzzy
|
||
#| msgid "Project"
|
||
msgid "Tabs for project"
|
||
msgstr "Pestañas de proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgenvtype
|
||
msgctxt "lazarusidestrconsts.dlgenvtype"
|
||
msgid "Type"
|
||
msgstr "Tipo"
|
||
|
||
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
|
||
msgid "Focus messages after compilation"
|
||
msgstr "Enfocar la ventana de mensajes después de compilar"
|
||
|
||
#: lazarusidestrconsts.dlgextracharspacing
|
||
msgid "Extra char spacing"
|
||
msgstr "Espaciado extra entre letras"
|
||
|
||
#: lazarusidestrconsts.dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr "Espaciando línea extra"
|
||
|
||
#: lazarusidestrconsts.dlgextsymb
|
||
msgid "Use external gdb debug symbols file"
|
||
msgstr "Usar archivo externo de símbolos de depuración para gdb"
|
||
|
||
#: lazarusidestrconsts.dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr "Extensiones de archivo"
|
||
|
||
#: lazarusidestrconsts.dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr "Buscar texto desde el cursor"
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunk
|
||
msgid "Chunk"
|
||
msgstr "Fragmento"
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunksect
|
||
msgid "Chunk section"
|
||
msgstr "Sección de Fragmento"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlasp
|
||
msgid "ASP"
|
||
msgstr "ASP"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
||
msgid "Comment"
|
||
msgstr "Comentario"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
||
msgid "Node"
|
||
msgstr "Nodo"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmitem
|
||
msgid "Item"
|
||
msgstr "Elemento"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmlist
|
||
msgid "List <>"
|
||
msgstr "Lista <>"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmobject
|
||
msgid "Object (inherited, inline)"
|
||
msgstr "Objecto (heredado, en línea)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
||
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
||
msgid "Var/Type (local)"
|
||
msgstr "Var/Type (local)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasansicomment
|
||
msgid "Comment (* *)"
|
||
msgstr "Comentario (* *)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasasm
|
||
msgid "Asm"
|
||
msgstr "Asm"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasbeginend
|
||
msgid "Begin/End (nested)"
|
||
msgstr "Begin/End (anidados)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasborcomment
|
||
msgid "Comment { }"
|
||
msgstr "Comentario { }"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpascase
|
||
msgid "Case"
|
||
msgstr "Case"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclass
|
||
msgid "Class/Object"
|
||
msgstr "Class/Object"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclasssection
|
||
msgid "public/private"
|
||
msgstr "public/private"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasexcept
|
||
msgid "Except/Finally"
|
||
msgstr "Except/Finally"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifdef
|
||
msgid "{$IfDef}"
|
||
msgstr "{$IfDef}"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifthen
|
||
msgid "If/Then/Else"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
||
msgid "Nested Comment"
|
||
msgstr "Comentarios anidados"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
||
msgid "Begin/End (procedure)"
|
||
msgstr "Begin/End (procedure)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocedure
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Procedimiento"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprogram
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
||
msgid "Program"
|
||
msgstr "Programa"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrecord
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
||
msgid "Record"
|
||
msgstr "Record"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrepeat
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
||
msgid "Repeat"
|
||
msgstr "Repeat"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
||
msgid "Comment //"
|
||
msgstr "Comentario //"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpastry
|
||
msgid "Try"
|
||
msgstr "Try"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunit
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
||
msgid "Unit"
|
||
msgstr "Unidad"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunitsection
|
||
msgid "Unit section"
|
||
msgstr "Sección Unit"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuserregion
|
||
msgid "{%Region}"
|
||
msgstr "{%Region}"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuses
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
||
msgid "Uses"
|
||
msgstr "Uses"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasvartype
|
||
msgid "Var/Type (global)"
|
||
msgstr "Var/Type (global)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcdata
|
||
msgid "CData"
|
||
msgstr "CData"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
||
msgid "Comment"
|
||
msgstr "Comentario"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmldoctype
|
||
msgid "DocType"
|
||
msgstr "DocType"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
||
msgid "Node"
|
||
msgstr "Nodo"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlprocess
|
||
msgid "Processing Instruction"
|
||
msgstr "Procesando Instrucción"
|
||
|
||
#: lazarusidestrconsts.dlgforecolor
|
||
msgid "Foreground"
|
||
msgstr "Color de texto"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr "Política de inserción de Procedimientos"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr "Mantener el orden de los procedimientos"
|
||
|
||
#: lazarusidestrconsts.dlgfpcpath
|
||
msgid "Compiler path (e.g. %s)"
|
||
msgstr "Ruta de compilador (%s)"
|
||
|
||
#: lazarusidestrconsts.dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr "Directorio de las fuentes de FPC"
|
||
|
||
#: lazarusidestrconsts.dlgframecolor
|
||
#| msgid "Frame color"
|
||
msgid "Text-mark"
|
||
msgstr "Marco de Texto"
|
||
|
||
#: lazarusidestrconsts.dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "Editor de Formulario"
|
||
|
||
#: lazarusidestrconsts.dlgfrombeginning
|
||
msgid "From b&eginning"
|
||
msgstr "Desde el principio"
|
||
|
||
#: lazarusidestrconsts.dlgfromcursor
|
||
#, fuzzy
|
||
#| msgid "&From Cursor"
|
||
msgid "&From cursor"
|
||
msgstr "&Desde el cursor"
|
||
|
||
#: lazarusidestrconsts.dlgfropts
|
||
msgctxt "lazarusidestrconsts.dlgfropts"
|
||
msgid "Options"
|
||
msgstr "Opciones"
|
||
|
||
#: lazarusidestrconsts.dlggetposition
|
||
msgid "Get position"
|
||
msgstr "Obtener posición"
|
||
|
||
#: lazarusidestrconsts.dlgglobal
|
||
msgid "&Global"
|
||
msgstr "&Global"
|
||
|
||
#: lazarusidestrconsts.dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr "Generar código para gprof"
|
||
|
||
#: lazarusidestrconsts.dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr "Coger color"
|
||
|
||
#: lazarusidestrconsts.dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr "Color de rejilla"
|
||
|
||
#: lazarusidestrconsts.dlggridx
|
||
msgid "Grid size X"
|
||
msgstr "Tamaño X de rejilla"
|
||
|
||
#: lazarusidestrconsts.dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr "Tamaño de paso de la rejilla Horizontal"
|
||
|
||
#: lazarusidestrconsts.dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr "Tamaño Y de rejilla"
|
||
|
||
#: lazarusidestrconsts.dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr "Tamaño de paso vertical de la rejilla"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodeexplorer
|
||
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorador de Código"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodetools
|
||
msgid "Codetools"
|
||
msgstr "Codetools"
|
||
|
||
#: lazarusidestrconsts.dlggroupdebugger
|
||
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Depurador"
|
||
|
||
#: lazarusidestrconsts.dlggroupeditor
|
||
msgid "Editor"
|
||
msgstr "Editor"
|
||
|
||
#: lazarusidestrconsts.dlggroupenvironment
|
||
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
||
msgid "Environment"
|
||
msgstr "Entorno"
|
||
|
||
#: lazarusidestrconsts.dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr "Deshacer en grupo"
|
||
|
||
#: lazarusidestrconsts.dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr "Mostrar líneas guía"
|
||
|
||
#: lazarusidestrconsts.dlggutter
|
||
msgctxt "lazarusidestrconsts.dlggutter"
|
||
msgid "Gutter"
|
||
msgstr "Columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
||
msgid "Collapsed"
|
||
msgstr "Colapsado"
|
||
|
||
#: lazarusidestrconsts.dlgguttercolor
|
||
msgid "Gutter Color"
|
||
msgstr "Color de la columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlggutteredgecolor
|
||
msgid "Gutter Edge Color"
|
||
msgstr "Color del borde de la columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlggutterseparatorindex
|
||
msgid "Gutter separator index"
|
||
msgstr "Indice del separador de la columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr "Desplazar media página"
|
||
|
||
#: lazarusidestrconsts.dlgheapandstacksize
|
||
msgid "Heap and stack sizes"
|
||
msgstr "Tamaños del monton(Heap) y pila(stack)"
|
||
|
||
#: lazarusidestrconsts.dlgheapsize
|
||
#, fuzzy
|
||
#| msgid "Heap Size"
|
||
msgid "Heap size"
|
||
msgstr "Tamaño del monton(Heap)"
|
||
|
||
#: lazarusidestrconsts.dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "Altura:"
|
||
|
||
#: lazarusidestrconsts.dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr "Esconder ventanas del IDE al ejecutar"
|
||
|
||
#: lazarusidestrconsts.dlghidemessagesicons
|
||
msgid "Hide Messages Icons"
|
||
msgstr "Ocultar iconos en ventana de mensajes"
|
||
|
||
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
||
msgid "Hide tab in single page windows"
|
||
msgstr "Esconder pestaña en ventanas con una sola página"
|
||
|
||
#: lazarusidestrconsts.dlghighlightcolor
|
||
msgid "Highlight Color"
|
||
msgstr "Color de Realce"
|
||
|
||
#: lazarusidestrconsts.dlghighlightfontcolor
|
||
msgid "Highlight Font Color"
|
||
msgstr "Color Resaltado de fuente"
|
||
|
||
#: lazarusidestrconsts.dlghighlightleftofcursor
|
||
msgid "Left Of Cursor"
|
||
msgstr "A la izquierda del cursor"
|
||
|
||
#: lazarusidestrconsts.dlghighlightrightofcursor
|
||
msgid "Right Of Cursor"
|
||
msgstr "A la derecha del cursor"
|
||
|
||
#: lazarusidestrconsts.dlghintsparametersendernotused
|
||
#, fuzzy
|
||
#| msgid "Show Hints for parameter \"Sender\" not used"
|
||
msgid "Show hints for parameter \"Sender\" not used"
|
||
msgstr "Mostrar sugerencias por parámetro \"Sender\" no usado"
|
||
|
||
#: lazarusidestrconsts.dlghintsunused
|
||
#, fuzzy
|
||
#| msgid "Show Hints for unused units in main source"
|
||
msgid "Show hints for unused units in main"
|
||
msgstr "Mostrar sugerencias de unidades no usadas en la principal(main)"
|
||
|
||
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr "La tecla inicio va al comienzo más cercano"
|
||
|
||
#: lazarusidestrconsts.dlghostapplication
|
||
msgid "Host application"
|
||
msgstr "Aplicación anfitriona"
|
||
|
||
#: lazarusidestrconsts.dlgidentifiercompletion
|
||
#, fuzzy
|
||
#| msgid "Identifier completion"
|
||
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
||
msgid "Identifier Completion"
|
||
msgstr "Completado de identificador"
|
||
|
||
#: lazarusidestrconsts.dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr "Política de Identificadores"
|
||
|
||
#: lazarusidestrconsts.dlgideoptions
|
||
msgid "IDE Options"
|
||
msgstr "Opciones del IDE"
|
||
|
||
#: lazarusidestrconsts.dlgifdefblockactive
|
||
msgid "Active $IFDEF code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefblockinactive
|
||
msgid "Inactive $IFDEF code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
||
msgid "Included mixed state $IFDEF code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodeactive
|
||
msgid "Active $IFDEF node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodeinactive
|
||
msgid "Inactive $IFDEF node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
||
msgid "Included mixed state $IFDEF node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgignoreverb
|
||
msgid "Ignore"
|
||
msgstr "Ignorar"
|
||
|
||
#: lazarusidestrconsts.dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr "Incluir variables del sistema"
|
||
|
||
#: lazarusidestrconsts.dlgindentsindentgroupoptions
|
||
msgid "Indent"
|
||
msgstr "Sangrado"
|
||
|
||
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
||
#, fuzzy
|
||
#| msgid "Indent and Tabs"
|
||
msgid "Tabs"
|
||
msgstr "Sangrado y Tabulación"
|
||
|
||
#: lazarusidestrconsts.dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr "Delante de métodos"
|
||
|
||
#: lazarusidestrconsts.dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr "El Nombre del constructor debe de ser 'init' (destructor 'done')"
|
||
|
||
#: lazarusidestrconsts.dlginsertclassparts
|
||
msgid "Insert class parts"
|
||
msgstr "Insertar partes de clase"
|
||
|
||
#: lazarusidestrconsts.dlginsertimplementation
|
||
msgid "Implementation"
|
||
msgstr "Implementación"
|
||
|
||
#: lazarusidestrconsts.dlginsertinterface
|
||
msgid "Interface"
|
||
msgstr "Interfaz"
|
||
|
||
#: lazarusidestrconsts.dlginsertmethods
|
||
msgid "Insert methods"
|
||
msgstr "Insertar metodos"
|
||
|
||
#: lazarusidestrconsts.dlginsertsection
|
||
msgid "Insert into Uses section of"
|
||
msgstr "Insertar en la sección Uses"
|
||
|
||
#: lazarusidestrconsts.dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr "Insertar espacio después de"
|
||
|
||
#: lazarusidestrconsts.dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr "Insertar espacio delante de"
|
||
|
||
#: lazarusidestrconsts.dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr "Intervalo en segundos"
|
||
|
||
#: lazarusidestrconsts.dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr "Saltar (por ejemplo, Saltar a método)"
|
||
|
||
#: lazarusidestrconsts.dlgkeepcursorx
|
||
msgid "Keep cursor X position"
|
||
msgstr "Mantener posición X del cursor"
|
||
|
||
#: lazarusidestrconsts.dlgkeylink
|
||
msgid "(Edit Key)"
|
||
msgstr "(Editar Llave)"
|
||
|
||
#: lazarusidestrconsts.dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr "Atajos de teclado"
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr "Errores de acceso rápido"
|
||
|
||
#: lazarusidestrconsts.dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr "Política de Palabras Claves"
|
||
|
||
#: lazarusidestrconsts.dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "Permitir LABEL y GOTO"
|
||
|
||
#: lazarusidestrconsts.dlglang
|
||
msgctxt "lazarusidestrconsts.dlglang"
|
||
msgid "Language"
|
||
msgstr "Lenguaje"
|
||
|
||
#: lazarusidestrconsts.dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr "El último (es decir, al final del código)"
|
||
|
||
#: lazarusidestrconsts.dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr "Directorio de Lazarus (predeterminado para todos los proyectos)"
|
||
|
||
#: lazarusidestrconsts.dlgleftpos
|
||
msgid "Left:"
|
||
msgstr "Izquierda:"
|
||
|
||
#: lazarusidestrconsts.dlglefttopclr
|
||
#, fuzzy
|
||
#| msgid "Guid lines Left,Top"
|
||
msgid "Guide lines Left,Top"
|
||
msgstr "Líneas guía Izquierda,Arriba"
|
||
|
||
#: lazarusidestrconsts.dlglevel1opt
|
||
#, fuzzy
|
||
#| msgid "Level 1 (quick and debugger friendly)"
|
||
msgid "1 (quick, debugger friendly)"
|
||
msgstr "Nivel 1 (rápido y amigable con el depurador)"
|
||
|
||
#: lazarusidestrconsts.dlglevel2opt
|
||
#, fuzzy
|
||
#| msgid "Level 2 (Level 1 + quick optimizations)"
|
||
msgid "2 (quick optimizations)"
|
||
msgstr "Nivel 2 (Nivel 1 + optimizaciones rápidas)"
|
||
|
||
#: lazarusidestrconsts.dlglevel3opt
|
||
#, fuzzy
|
||
#| msgid "Level 3 (Level 2 + slow optimizations)"
|
||
msgid "3 (slow optimizations)"
|
||
msgstr "Nivel 3 (Nivel 2 + optimizaciones lentas)"
|
||
|
||
#: lazarusidestrconsts.dlglevelnoneopt
|
||
#, fuzzy
|
||
#| msgid "Level 0 (no extra optimizations)"
|
||
msgid "0 (no optimization)"
|
||
msgstr "Nivel 0 (sin optimizaciones extra)"
|
||
|
||
#: lazarusidestrconsts.dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr "División de líneas"
|
||
|
||
#: lazarusidestrconsts.dlglinksmart
|
||
#, fuzzy
|
||
#| msgid "Link Smart"
|
||
msgid "Link smart"
|
||
msgstr "Enlazado Inteligente"
|
||
|
||
#: lazarusidestrconsts.dlglnumsbct
|
||
#, fuzzy
|
||
#| msgid "Display Line Numbers in Run-time Error Backtraces"
|
||
msgid "Display line numbers in run-time error backtraces"
|
||
msgstr "Visualizar números de líneas en los errores de tiempo de ejecución en trazados inversos"
|
||
|
||
#: lazarusidestrconsts.dlgloaddfile
|
||
msgid "Load desktop settings from file"
|
||
msgstr "Cargar configuración del escritorio"
|
||
|
||
#: lazarusidestrconsts.dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr "Menú Principal"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewforms
|
||
#, fuzzy
|
||
#| msgid "View project forms"
|
||
msgid "View Project Forms"
|
||
msgstr "Ver Formularios del Proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewframes
|
||
#, fuzzy
|
||
#| msgid "View project frames"
|
||
msgid "View Project Frames"
|
||
msgstr "Mostrar Frames del proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewunits
|
||
#, fuzzy
|
||
#| msgid "View project units"
|
||
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
||
msgid "View Project Units"
|
||
msgstr "Ver Unidades del Proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgmakepath
|
||
msgid "Make path"
|
||
msgstr "Ruta de Make"
|
||
|
||
#: lazarusidestrconsts.dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr "Margen y columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr "Color de marca"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupgroup
|
||
#, fuzzy
|
||
#| msgid "Word under Caret Highlight"
|
||
msgid "Highlight of Word under Caret"
|
||
msgstr "Resaltado de la palabra bajo el Cursor de Texto"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefined
|
||
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
||
msgid "User defined markup"
|
||
msgstr "Marcado definido por el usuario"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
||
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
||
msgid "Delete"
|
||
msgstr "Borrar"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
||
msgid "Delete list \"%s\"?"
|
||
msgstr "¿Borrar lista \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
||
msgid "Add Word or Term"
|
||
msgstr "Añadir palabra o término"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
||
msgid "Remove Word or Term"
|
||
msgstr "Eliminar palabra o término"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
||
msgid "Toggle Word or Term"
|
||
msgstr "Cambiar palabra o término"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
||
msgid "Duplicate Term"
|
||
msgstr "Término duplicado"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
||
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
||
msgstr "El término %s ya existe. Los duplicados se quitarán cuando se guarda la lista."
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
||
msgid "Add/Remove in all editors"
|
||
msgstr "Añadir/Quitar en todos los editores"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
||
msgid "Delete list"
|
||
msgstr "Borrar lista"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
||
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
||
msgid "Name"
|
||
msgstr "Nombre"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
||
msgid "Add list"
|
||
msgstr "Añadir lista"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
||
msgid "Case sensitive"
|
||
msgstr "Sensible a mayúsculas y minúsculas"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
||
msgid "Set bound at term end"
|
||
msgstr "Establecer limite al finalizar el término"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
||
msgid "Set bound at term start"
|
||
msgstr "Establecer limite al comenzar el término"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
||
msgid "Ignore bounds for terms longer than"
|
||
msgstr "Ignorar los limites de terminos más largos"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
||
msgid "selection"
|
||
msgstr "selección"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
||
msgid "current word"
|
||
msgstr "palabra actual"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
||
msgid "Settings for terms added by key"
|
||
msgstr "Configuración de términos añadidas por clave"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
||
msgid "Smart match selection bounds"
|
||
msgstr "Selecion inteligente de coincidencias para establecer límites"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
||
msgid "New list"
|
||
msgstr "Nueva lista"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
||
msgid "No lists"
|
||
msgstr "No hay listas"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
||
msgid "Select ..."
|
||
msgstr "Seleccione ..."
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
||
msgid "Key Settings"
|
||
msgstr "Configuración de teclas"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
||
msgid "Main settings"
|
||
msgstr "Configuración principal"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
||
msgid "Match word boundaries for words up to this length:"
|
||
msgstr "Coincidir límites de palabra para palabras de hasta esta longitud:"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
||
#, fuzzy
|
||
#| msgid "Ignore Keywords"
|
||
msgid "Ignore keywords"
|
||
msgstr "Ignorar Palabras Clave"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
||
#, fuzzy
|
||
#| msgid "Disable Timer for Markup Current Word"
|
||
msgid "Disable timer for markup current word"
|
||
msgstr "Desactivar Temporizador para Señalización de Palabra Actual"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordtrim
|
||
#, fuzzy
|
||
#| msgid "Trim Spaces (when highlighting current selection)"
|
||
msgid "Trim spaces (when highlighting current selection)"
|
||
msgstr "Recortar Espacios (Cuando se realce la selección actual)"
|
||
|
||
#: lazarusidestrconsts.dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr "Contador máximo"
|
||
|
||
#: lazarusidestrconsts.dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr "Longitud máxima de línea:"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr "Nº Máximo de Archivos recientes"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr "Nº Máximo de Archivos de Proyecto recientes"
|
||
|
||
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr "Mezclar métodos y propiedades"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn1
|
||
msgid "Single"
|
||
msgstr "Simple"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn2
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
||
msgid "Double"
|
||
msgstr "Doble"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn3
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
||
msgid "Triple"
|
||
msgstr "Triple"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn4
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
||
msgid "Quad"
|
||
msgstr "Cuádruple"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnany
|
||
msgid "Any"
|
||
msgstr "Cualquiera"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
||
msgid "Extra 1"
|
||
msgstr "Extra 1"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
||
msgid "Extra 2"
|
||
msgstr "Extra 2"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
||
msgid "Left"
|
||
msgstr "Izquierdo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
||
msgid "Middle"
|
||
msgstr "Medio"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
||
msgid "Make Fallback"
|
||
msgstr "Convertir en Ultimo Recurso"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnright
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
||
msgid "Right"
|
||
msgstr "Derecho"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
||
msgid "Wheel down"
|
||
msgstr "Rueda de raton abajo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
||
msgid "Wheel up"
|
||
msgstr "Rueda de raton arriba"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcapture
|
||
msgid "Capture"
|
||
msgstr "Capturar"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
||
msgid "Move Caret (extra)"
|
||
msgstr "Mover Cursor de Texto (extra)"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
||
msgid "Act on Mouse up"
|
||
msgstr "Actuar al soltar el Botón del Ratón"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescaction
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
||
msgid "Action"
|
||
msgstr "Acción"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
||
msgid "Click"
|
||
msgstr "Clic"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
||
msgid "Edit Mouse"
|
||
msgstr "Editar Ratón"
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrordup
|
||
msgid "Duplicate Entry"
|
||
msgstr "Elemento Duplicada"
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
||
msgid "This entry conflicts with an existing entry"
|
||
msgstr "Esta entrada entra en conflicto con una entrada ya existente"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
||
msgid "Button"
|
||
msgstr "Botón"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
||
msgid "Caret"
|
||
msgstr "Cursor de Texto"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
||
msgid "Context"
|
||
msgstr "Contexto"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcount
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
||
msgid "Click"
|
||
msgstr "Clic"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
||
msgid "Action"
|
||
msgstr "Acción"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddir
|
||
msgid "Up/Down"
|
||
msgstr "Arriba/Abajo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadopt
|
||
msgid "Option"
|
||
msgstr "Opción"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadorder
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
||
msgid "Order"
|
||
msgstr "Ordenar"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
||
msgid "Priority"
|
||
msgstr "Prioridad"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptions
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
||
msgid "Mouse"
|
||
msgstr "Ratón"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsadv
|
||
msgid "Advanced"
|
||
msgstr "Avanzado"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
||
msgid "IDE-Command"
|
||
msgstr "Comando-IDE"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
||
msgid "n"
|
||
msgstr "N"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
||
msgid "Y"
|
||
msgstr "S"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
||
msgid "Y"
|
||
msgstr "S"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeall
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
||
msgid "All"
|
||
msgstr "Todo"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
||
msgid "Gutter"
|
||
msgstr "Columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
||
msgid "Fold Tree"
|
||
msgstr "Plegado de Código"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
||
msgid "Collapsed [+]"
|
||
msgstr "Colapsado [+]"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
||
msgid "Expanded [-]"
|
||
msgstr "Expandido [-]"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
||
msgid "Line Numbers"
|
||
msgstr "Números de Línea"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodemain
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
||
msgid "Text"
|
||
msgstr "Texto"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
||
msgid "Selection"
|
||
msgstr "Selección"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptopt2label
|
||
msgid "Opt"
|
||
msgstr "Opt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheract
|
||
msgid "Other actions using the same button"
|
||
msgstr "Otras acciones que usan el mismo botón"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
||
#, fuzzy
|
||
#| msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
|
||
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
||
msgstr "Estos se pueden ejecutar dependiendo de las teclas modificadoras, Ajustes Predeterminados, Simple/Doble, Arriba/Abajo ..."
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
||
msgid "Filter Mod-Keys"
|
||
msgstr "Filtrar Teclas-Modificadoras"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
||
msgid "Priority"
|
||
msgstr "Prioridad"
|
||
|
||
#: lazarusidestrconsts.dlgmsgs
|
||
msgctxt "lazarusidestrconsts.dlgmsgs"
|
||
msgid "Messages"
|
||
msgstr "Mensajes"
|
||
|
||
#: lazarusidestrconsts.dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "Multiselección"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
||
#, fuzzy
|
||
#| msgid "Find editor for jump targets"
|
||
msgid "Find Editor for Jump Targets"
|
||
msgstr "Encontrar editor para los objetivos de un salto:"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
||
msgid "Order to use for editors matching the same criteria"
|
||
msgstr "Orden de uso de editores que coincidan con el mismo criterio"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
||
msgid "Most recent focused editor for this file"
|
||
msgstr "Editor enfocado más recientemente para este archivo"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
||
msgid "Editor (for file) in most recent focused window"
|
||
msgstr "Editor (para el archivo) en la ventana enfocada más recientemente"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
||
msgid "Priority list of criteria to choose an editor:"
|
||
msgstr "Lista de prioridades de los criterios para elegir un editor:"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinoptions
|
||
msgid "Pages and Windows"
|
||
msgstr "Páginas y Ventanas"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwintabgroup
|
||
#, fuzzy
|
||
#| msgid "Notebook Tabs:"
|
||
msgid "Notebook Tabs"
|
||
msgstr "Pestañas del Editor:"
|
||
|
||
#: lazarusidestrconsts.dlgnaming
|
||
msgid "Naming"
|
||
msgstr "Nombrar"
|
||
|
||
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
||
#| msgid "no automatic renaming"
|
||
msgid "No automatic renaming"
|
||
msgstr "No renombrar automáticamente"
|
||
|
||
#: lazarusidestrconsts.dlgnoavailableunits
|
||
msgid "No available units to add."
|
||
msgstr "No hay unidades disponible a añadir."
|
||
|
||
#: lazarusidestrconsts.dlgnobrackethighlight
|
||
msgid "No Highlight"
|
||
msgstr "Sin Realce"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabpos
|
||
msgid "Source notebook tabs position"
|
||
msgstr "Posición de las pestañas en el editor"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlineafter
|
||
#, fuzzy
|
||
#| msgid "Do not split line after:"
|
||
msgid "Do not split line after"
|
||
msgstr "No dividir la línea después de:"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlinefront
|
||
#, fuzzy
|
||
#| msgid "Do not split line In front of:"
|
||
msgid "Do not split line in front of"
|
||
msgstr "No dividir la línea delante de:"
|
||
|
||
#: lazarusidestrconsts.dlgobjinsp
|
||
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
||
msgid "Object Inspector"
|
||
msgstr "Inspector de Objetos"
|
||
|
||
#: lazarusidestrconsts.dlgoiitemheight
|
||
msgid "Item height"
|
||
msgstr "Altura de elemento"
|
||
|
||
#: lazarusidestrconsts.dlgoimiscellaneous
|
||
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Miscelánea"
|
||
|
||
#: lazarusidestrconsts.dlgoioptions
|
||
msgctxt "lazarusidestrconsts.dlgoioptions"
|
||
msgid "Options"
|
||
msgstr "Opciones"
|
||
|
||
#: lazarusidestrconsts.dlgoispeedsettings
|
||
msgid "Speed settings"
|
||
msgstr "Configuración Rápida"
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
||
msgid "Use default Delphi settings"
|
||
msgstr "Usar Ajustes pretederminados de Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
||
msgid "Use default Lazarus settings"
|
||
msgstr "Usar ajustes predeterminados de Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgoptimizationlevels
|
||
msgid "Optimization levels"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgotheroptimizations
|
||
msgid "Other optimizations"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgotherunitfiles
|
||
#, fuzzy
|
||
#| msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
||
msgid "Other unit files (-Fu) (delimiter is semicolon):"
|
||
msgstr "Otros archivos de unidad (-Fu) (Separados por un punto y coma):"
|
||
|
||
#: lazarusidestrconsts.dlgoverwriteblock
|
||
#, fuzzy
|
||
#| msgid "Overwrite Block"
|
||
msgid "Overwrite block"
|
||
msgstr "Sobreescribir Bloque"
|
||
|
||
#: lazarusidestrconsts.dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr "Descripciones en la paleta de componentes"
|
||
|
||
#: lazarusidestrconsts.dlgpasext
|
||
#, fuzzy
|
||
#| msgid "Default pascal extension"
|
||
msgid "Default Pascal extension"
|
||
msgstr "Extensión Pascal predeterminada"
|
||
|
||
#: lazarusidestrconsts.dlgpasextkeywords
|
||
msgid "Highlight control statements as keywords"
|
||
msgstr "Resaltar sentencias de control como palabras clave"
|
||
|
||
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
||
#, fuzzy
|
||
#| msgid "Extended Pascal keyword options"
|
||
msgid "Extended Pascal Keyword Options"
|
||
msgstr "Opciones de palabras clave en Extended Pascal"
|
||
|
||
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
||
msgid "Matching Keywords"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpassoptslinker
|
||
#, fuzzy
|
||
#| msgid "Pass options to linker (delimiter is space)"
|
||
msgid "Pass options to linker with \"-k\", delimiter is space"
|
||
msgstr "Pasar opciones al enlazador (espacio como delimitador)"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywords
|
||
#, fuzzy
|
||
#| msgid "Highlight String keyword(s)"
|
||
msgid "Highlight \"String\" keyword(s)"
|
||
msgstr "Resaltar palabra(s) clave String"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
||
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
||
msgid "Default"
|
||
msgstr "Predeterminada"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
||
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
||
msgid "None"
|
||
msgstr "Nada"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
||
msgid "Only \"String\""
|
||
msgstr "Solo \"String\""
|
||
|
||
#: lazarusidestrconsts.dlgpersistentblock
|
||
#, fuzzy
|
||
#| msgid "Persistent Block"
|
||
msgid "Persistent block"
|
||
msgstr "Bloque Persistente"
|
||
|
||
#: lazarusidestrconsts.dlgpersistentcursor
|
||
msgid "Persistent cursor"
|
||
msgstr "Cursor Persistente"
|
||
|
||
#: lazarusidestrconsts.dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "Aplicación"
|
||
|
||
#: lazarusidestrconsts.dlgpoasinvoker
|
||
msgid "as invoker (asInvoker)"
|
||
msgstr "como invocador (asInvoker)"
|
||
|
||
#: lazarusidestrconsts.dlgpoclearicon
|
||
#, fuzzy
|
||
#| msgid "Clear Icon"
|
||
msgid "&Clear Icon"
|
||
msgstr "Quitar Icono"
|
||
|
||
#: lazarusidestrconsts.dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr "Crear envoltorio de la aplicación"
|
||
|
||
#: lazarusidestrconsts.dlgpodefaulticon
|
||
msgid "Load &Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpodpiaware
|
||
#, fuzzy
|
||
#| msgid "Dpi aware application (for Vista+)"
|
||
msgid "Enabled DPI Awareness (for Vista+)"
|
||
msgstr "Activar DPI Awareness (para Vista+)"
|
||
|
||
#: lazarusidestrconsts.dlgpoexecutionlevel
|
||
msgid "Execution Level"
|
||
msgstr "Nivel execución"
|
||
|
||
#: lazarusidestrconsts.dlgpofroms
|
||
msgid "Forms"
|
||
msgstr "Formulario"
|
||
|
||
#: lazarusidestrconsts.dlgpohighestavailable
|
||
msgid "highest available (highestAvailable)"
|
||
msgstr "el mas alto disponible (highestAvailable)"
|
||
|
||
#: lazarusidestrconsts.dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr "Internacionalización"
|
||
|
||
#: lazarusidestrconsts.dlgpoicon
|
||
msgid "Icon:"
|
||
msgstr "Icono:"
|
||
|
||
#: lazarusidestrconsts.dlgpoicondesc
|
||
msgid "(size: %d:%d, bpp: %d)"
|
||
msgstr "(tamaño: %d:%d, bpp: %d)"
|
||
|
||
#: lazarusidestrconsts.dlgpoicondescnone
|
||
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
||
msgid "(none)"
|
||
msgstr "(ninguno)"
|
||
|
||
#: lazarusidestrconsts.dlgpoloadicon
|
||
#, fuzzy
|
||
#| msgid "Load Icon"
|
||
msgid "&Load Icon"
|
||
msgstr "Cargar Icono"
|
||
|
||
#: lazarusidestrconsts.dlgpomisc
|
||
msgctxt "lazarusidestrconsts.dlgpomisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Miscelánea"
|
||
|
||
#: lazarusidestrconsts.dlgporequireadministrator
|
||
msgid "require administrator (requireAdministrator)"
|
||
msgstr "requiere administrador (requireAdministrator)"
|
||
|
||
#: lazarusidestrconsts.dlgporesources
|
||
msgid "Resources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgposaveicon
|
||
#, fuzzy
|
||
#| msgid "Save Icon"
|
||
msgid "&Save Icon"
|
||
msgstr "Guardar Icono"
|
||
|
||
#: lazarusidestrconsts.dlgposavesession
|
||
msgid "Session"
|
||
msgstr "Sesión"
|
||
|
||
#: lazarusidestrconsts.dlgpotitle
|
||
msgid "Title:"
|
||
msgstr "Título:"
|
||
|
||
#: lazarusidestrconsts.dlgpouiaccess
|
||
msgid "UI Access (uiAccess)"
|
||
msgstr "Acceso UI (uiAccess)"
|
||
|
||
#: lazarusidestrconsts.dlgpouseappbundle
|
||
#, fuzzy
|
||
#| msgid "Use Application Bundle for running and debugging (darwin only)"
|
||
msgid "Use Application Bundle for running and debugging (Darwin only)"
|
||
msgstr "Use el envoltorio de la aplicación para ejecución y depuración (sólo Darwin)"
|
||
|
||
#: lazarusidestrconsts.dlgpousemanifest
|
||
#| msgid "Use manifest file to enable themes (windows only)"
|
||
msgid "Use manifest file to enable themes (Windows only)"
|
||
msgstr "Usar el archivo de manifiesto para activar temas (sólo Windows)"
|
||
|
||
#: lazarusidestrconsts.dlgpriorities
|
||
msgid "Priorities"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgproject
|
||
msgctxt "lazarusidestrconsts.dlgproject"
|
||
msgid "Project"
|
||
msgstr "Proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr "Opciones del Proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptionsfor
|
||
msgid "Options for Project: %s"
|
||
msgstr "Opciones para el Proyecto: %s"
|
||
|
||
#: lazarusidestrconsts.dlgprojfiles
|
||
#, fuzzy
|
||
#| msgid "Project files"
|
||
msgid "Project Files"
|
||
msgstr "Archivos del proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgpromptonreplace
|
||
#, fuzzy
|
||
#| msgid "&Prompt On Replace"
|
||
msgid "&Prompt on replace"
|
||
msgstr "&Preguntar al Reemplazar"
|
||
|
||
#: lazarusidestrconsts.dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr "Completado de Propiedades"
|
||
|
||
#: lazarusidestrconsts.dlgpropnamecolor
|
||
msgid "Property Name"
|
||
msgstr "Nombre de la propiedad"
|
||
|
||
#: lazarusidestrconsts.dlgqautoclosecompiledialog
|
||
msgid "Auto close compile dialog"
|
||
msgstr "Cerrar automaticamente el diálogo de compilación"
|
||
|
||
#: lazarusidestrconsts.dlgqopenlastprj
|
||
msgid "Open last project at start"
|
||
msgstr "Abrir último proyecto al iniciar"
|
||
|
||
#: lazarusidestrconsts.dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr "Mostrar espaciado del borde"
|
||
|
||
#: lazarusidestrconsts.dlgqshowcompiledialog
|
||
msgid "Show compile dialog"
|
||
msgstr "Mostrar diálogo de compilación"
|
||
|
||
#: lazarusidestrconsts.dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr "Mostrar rejilla"
|
||
|
||
#: lazarusidestrconsts.dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr "Ajustar a rejilla"
|
||
|
||
#: lazarusidestrconsts.dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr "Referencia"
|
||
|
||
#: lazarusidestrconsts.dlgregularexpressions
|
||
#, fuzzy
|
||
#| msgid "Regular E&xpressions"
|
||
msgid "Regular e&xpressions"
|
||
msgstr "Expresiones &Regulares"
|
||
|
||
#: lazarusidestrconsts.dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr "Reemplazar &todo"
|
||
|
||
#: lazarusidestrconsts.dlgreplacewith
|
||
#, fuzzy
|
||
#| msgid "&Replace With"
|
||
msgid "&Replace with"
|
||
msgstr "&Reemplazar con"
|
||
|
||
#: lazarusidestrconsts.dlgreport
|
||
msgid "Report"
|
||
msgstr "Informe"
|
||
|
||
#: lazarusidestrconsts.dlgrightbottomclr
|
||
#| msgid "color for right, bottom"
|
||
msgid "Guide lines Right,Bottom"
|
||
msgstr "Líneas guía Derecha,Abajo"
|
||
|
||
#: lazarusidestrconsts.dlgrightclickselects
|
||
#, fuzzy
|
||
#| msgid "Right Click selects"
|
||
msgid "Right click selects"
|
||
msgstr "Click derecho selecciona"
|
||
|
||
#: lazarusidestrconsts.dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr "Margen derecho"
|
||
|
||
#: lazarusidestrconsts.dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr "Directorio de trabajo"
|
||
|
||
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
||
msgid "Select grandchildren"
|
||
msgstr "Seleccionar nietos"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
||
#| msgid "Creation"
|
||
msgid "Rubberband Creation"
|
||
msgstr "Creación de goma elástica"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
||
#| msgid "Selection"
|
||
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
||
msgid "Rubberband Selection"
|
||
msgstr "Selección de goma elástica"
|
||
|
||
#: lazarusidestrconsts.dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr "Pantalla (no para win32, e.j. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
|
||
#: lazarusidestrconsts.dlgrunoenvironment
|
||
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
||
msgid "Environment"
|
||
msgstr "Entorno"
|
||
|
||
#: lazarusidestrconsts.dlgrunolocal
|
||
msgid "Local"
|
||
msgstr "Local"
|
||
|
||
#: lazarusidestrconsts.dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr "Variables del sistema"
|
||
|
||
#: lazarusidestrconsts.dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr "Usar pantalla"
|
||
|
||
#: lazarusidestrconsts.dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr "Usar reemplazos"
|
||
|
||
#: lazarusidestrconsts.dlgrunparameters
|
||
#, fuzzy
|
||
#| msgid "Run parameters"
|
||
msgid "Run Parameters"
|
||
msgstr "Parámetros de ejecución"
|
||
|
||
#: lazarusidestrconsts.dlgsavedfile
|
||
msgid "Save desktop settings to file"
|
||
msgstr "Guardar configuración del escritorio"
|
||
|
||
#: lazarusidestrconsts.dlgsavedlinecolor
|
||
msgid "Saved line"
|
||
msgstr "Línea guardada"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr "Guardar información del editor para archivos cerrados"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr "Guardar información del Editor sólo para archivos del proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgscope
|
||
msgid "Scope"
|
||
msgstr "Alcance"
|
||
|
||
#: lazarusidestrconsts.dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr "Desplazar una menos"
|
||
|
||
#: lazarusidestrconsts.dlgscrollgroupoptions
|
||
#, fuzzy
|
||
#| msgid "Scrolling:"
|
||
msgid "Scrolling"
|
||
msgstr "Desplazamiento"
|
||
|
||
#: lazarusidestrconsts.dlgscrollhint
|
||
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
||
msgid "Show scroll hint"
|
||
msgstr "Mostrar descripción de desplazamiento"
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr "Desplazar después de fin de archivo"
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendline
|
||
#| msgid "Scroll past end of line"
|
||
msgid "Caret past end of line"
|
||
msgstr "Cursor sobrepasa fin de línea"
|
||
|
||
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
||
msgid "Search directory \"%s\" not found."
|
||
msgstr "Directorio de busqueda \"%s\" no encontrado."
|
||
|
||
#: lazarusidestrconsts.dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr "Búsqueda terminada por el usuario"
|
||
|
||
#: lazarusidestrconsts.dlgsearchcaption
|
||
#, fuzzy
|
||
#| msgid "Searching..."
|
||
msgid "Searching ..."
|
||
msgstr "Buscando ..."
|
||
|
||
#: lazarusidestrconsts.dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr "Rutas"
|
||
|
||
#: lazarusidestrconsts.dlgselectedtext
|
||
#, fuzzy
|
||
#| msgid "&Selected Text"
|
||
msgid "&Selected text"
|
||
msgstr "Texto &Seleccionado"
|
||
|
||
#: lazarusidestrconsts.dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr "Asignar predeterminado en todos los elementos"
|
||
|
||
#: lazarusidestrconsts.dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr "Asignar predeterminado al elemento"
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr "Fijar propiedad Variable"
|
||
|
||
#: lazarusidestrconsts.dlgshowallunits
|
||
msgid "Show all units"
|
||
msgstr "Mostrar todas las unidades"
|
||
|
||
#: lazarusidestrconsts.dlgshowcaps
|
||
msgid "Show component captions"
|
||
msgstr "Mostrar títulos de componentes"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr "Mostrar procedimentos compilados"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Mostrar números de línea"
|
||
|
||
#: lazarusidestrconsts.dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "Mostrar condicionales"
|
||
|
||
#: lazarusidestrconsts.dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr "Mostrar información de depuración"
|
||
|
||
#: lazarusidestrconsts.dlgshowedrhints
|
||
msgid "Show editor hints"
|
||
msgstr "Mostrar sugerencias en el editor"
|
||
|
||
#: lazarusidestrconsts.dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr "Mostrar todo"
|
||
|
||
#: lazarusidestrconsts.dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr "Mostrar información del ejecutable (Sólo Win32)"
|
||
|
||
#: lazarusidestrconsts.dlgshowfullfilenames
|
||
msgid "Show full file names"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr "Mostrar información general"
|
||
|
||
#: lazarusidestrconsts.dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr "Mostrar sugerencias en la columna de marcas"
|
||
|
||
#: lazarusidestrconsts.dlgshowhint
|
||
#, fuzzy
|
||
#| msgid "Show Hints"
|
||
msgctxt "lazarusidestrconsts.dlgshowhint"
|
||
msgid "Show hints"
|
||
msgstr "Mostrar sugerencias"
|
||
|
||
#: lazarusidestrconsts.dlgshowlinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Mostrar números de línea"
|
||
|
||
#: lazarusidestrconsts.dlgshownotes
|
||
#, fuzzy
|
||
#| msgid "Show Notes"
|
||
msgid "Show notes"
|
||
msgstr "Mostrar notas"
|
||
|
||
#: lazarusidestrconsts.dlgshownothing
|
||
msgid "Show nothing (only errors)"
|
||
msgstr "No mostrar nada (Sólo errores)"
|
||
|
||
#: lazarusidestrconsts.dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr "Mostrar resumen"
|
||
|
||
#: lazarusidestrconsts.dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr "Mostrar archivos probados"
|
||
|
||
#: lazarusidestrconsts.dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr "Mostrar archivos usados"
|
||
|
||
#: lazarusidestrconsts.dlgshowwarnings
|
||
#, fuzzy
|
||
#| msgid "Show Warnings"
|
||
msgid "Show warnings"
|
||
msgstr "Mostrar advertencias"
|
||
|
||
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
||
msgid "Show single button in TaskBar"
|
||
msgstr "Mostrar un único boton en la barra de tareas"
|
||
|
||
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
||
msgid "Skip forward class declarations"
|
||
msgstr "Omitir declaraciones de clase forward"
|
||
|
||
#: lazarusidestrconsts.dlgslashcommenttab
|
||
msgid "Slash //"
|
||
msgstr "Barra oblicua //"
|
||
|
||
#: lazarusidestrconsts.dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr "Tabuladores inteligentes"
|
||
|
||
#: lazarusidestrconsts.dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr "Símbolo atrás (.pp~)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr "Contador (.pp;1)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr "Símbolo delante (.~pp)"
|
||
|
||
#: lazarusidestrconsts.dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr "Ajustar a líneas guía"
|
||
|
||
#: lazarusidestrconsts.dlgspacenotcosmos
|
||
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
||
msgid "Space"
|
||
msgstr "Espacio"
|
||
|
||
#: lazarusidestrconsts.dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr "Descripciones en los botones principales (abrir, guardar, ...)"
|
||
|
||
#: lazarusidestrconsts.dlgsrcedit
|
||
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
||
msgid "Source Editor"
|
||
msgstr "Editor de código"
|
||
|
||
#: lazarusidestrconsts.dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr "Origen"
|
||
|
||
#: lazarusidestrconsts.dlgstacksize
|
||
msgid "Stack size"
|
||
msgstr "Tamaño pila(stack)"
|
||
|
||
#: lazarusidestrconsts.dlgstatickeyword
|
||
#, fuzzy
|
||
#| msgid "Static Keyword in Objects"
|
||
msgid "Static keyword in objects"
|
||
msgstr "Palabra clave estática en los Objetos"
|
||
|
||
#: lazarusidestrconsts.dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr "Parar después de número de errores:"
|
||
|
||
#: lazarusidestrconsts.dlgstringautoappend
|
||
msgid "Append text to close string"
|
||
msgstr "Anexar texto para cerrar la cadena"
|
||
|
||
#: lazarusidestrconsts.dlgstringautoprefix
|
||
msgid "Prefix string on new line"
|
||
msgstr "Cadena de prefijo en nueva línea"
|
||
|
||
#: lazarusidestrconsts.dlgstringbreakindenttab
|
||
msgid "String ''"
|
||
msgstr "Cadena ''"
|
||
|
||
#: lazarusidestrconsts.dlgstringenableautocontinue
|
||
msgid "Extend strings on linebreak"
|
||
msgstr "Extender cadenas en rupturas de linea"
|
||
|
||
#: lazarusidestrconsts.dlgsubpropcolor
|
||
msgid "SubProperties"
|
||
msgstr "SubPropiedades"
|
||
|
||
#: lazarusidestrconsts.dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr "Opciones de sintaxis"
|
||
|
||
#: lazarusidestrconsts.dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr "Tabulador sangra bloques"
|
||
|
||
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
||
msgid "Show tab numbers in notebook"
|
||
msgstr "Mostrar números en las pestañas del editor"
|
||
|
||
#: lazarusidestrconsts.dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr "Tabuladores a espacios"
|
||
|
||
#: lazarusidestrconsts.dlgtabwidths
|
||
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
||
msgid "Tab widths"
|
||
msgstr "Ancho del Tabulador"
|
||
|
||
#: lazarusidestrconsts.dlgtargetcpufamily
|
||
msgid "Target CPU family"
|
||
msgstr "Familia CPU deseada"
|
||
|
||
#: lazarusidestrconsts.dlgtargetos
|
||
msgctxt "lazarusidestrconsts.dlgtargetos"
|
||
msgid "Target OS"
|
||
msgstr "SO deseado"
|
||
|
||
#: lazarusidestrconsts.dlgtargetplatform
|
||
#, fuzzy
|
||
#| msgid "Target Platform"
|
||
msgid "Target platform"
|
||
msgstr "Plataforma objetivo"
|
||
|
||
#: lazarusidestrconsts.dlgtargetproc
|
||
msgid "Target processor"
|
||
msgstr "Procesador deseado"
|
||
|
||
#: lazarusidestrconsts.dlgtargetspecificoptions
|
||
msgid "Target-specific options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr "Directorio para construir proyectos de prueba"
|
||
|
||
#: lazarusidestrconsts.dlgtexttofind
|
||
#, fuzzy
|
||
#| msgid "&Text to Find"
|
||
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
||
msgid "&Text to find"
|
||
msgstr "&Texto a buscar"
|
||
|
||
#: lazarusidestrconsts.dlgtopinfohint
|
||
msgid "Current Class/Proc Hint"
|
||
msgstr "Pista del actual clase/Procedimiento"
|
||
|
||
#: lazarusidestrconsts.dlgtoppos
|
||
msgid "Top:"
|
||
msgstr "Alto:"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
||
#, fuzzy
|
||
#| msgid "Trim Spaces Style"
|
||
msgid "Trim spaces style"
|
||
msgstr "Estilo de recorte de espacios"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
||
msgid "Caret or Edit"
|
||
msgstr "Cursor de Texto o Editar"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
||
msgid "Line Edited"
|
||
msgstr "Línea Editada"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
||
msgid "Leave line"
|
||
msgstr "Abandonar línea"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
||
msgid "Position Only"
|
||
msgstr "Solamente posición"
|
||
|
||
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr "Quitar espacios sobrantes"
|
||
|
||
#: lazarusidestrconsts.dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "Deshacer después de guardar"
|
||
|
||
#: lazarusidestrconsts.dlgundogroupoptions
|
||
#, fuzzy
|
||
#| msgid "Undo / Redo:"
|
||
msgid "Undo / Redo"
|
||
msgstr "Deshacer / Rehacer"
|
||
|
||
#: lazarusidestrconsts.dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "Límite para deshacer"
|
||
|
||
#: lazarusidestrconsts.dlgunitdepcaption
|
||
#, fuzzy
|
||
#| msgid "Unit dependencies"
|
||
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
|
||
msgid "Unit Dependencies"
|
||
msgstr "Dependencias de Unidad"
|
||
|
||
#: lazarusidestrconsts.dlgunitdeprefresh
|
||
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
||
msgid "Refresh"
|
||
msgstr "Refrescar"
|
||
|
||
#: lazarusidestrconsts.dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr "Directorio de salida de la unidad (-FU):"
|
||
|
||
#: lazarusidestrconsts.dlgunsavedlinecolor
|
||
msgid "Unsaved line"
|
||
msgstr "Línea sin guardar"
|
||
|
||
#: lazarusidestrconsts.dlgusecodefolding
|
||
#, fuzzy
|
||
#| msgid "Code folding"
|
||
msgid "Code Folding"
|
||
msgstr "Plegando código"
|
||
|
||
#: lazarusidestrconsts.dlgusecustomconfig
|
||
#, fuzzy
|
||
#| msgid "Use additional Compiler Config File"
|
||
msgid "Use additional compiler config file"
|
||
msgstr "Usar archivo de configuración de compilador adicional"
|
||
|
||
#: lazarusidestrconsts.dlgusedividerdraw
|
||
#, fuzzy
|
||
#| msgid "Divider drawing"
|
||
msgid "Divider Drawing"
|
||
msgstr "Dibujado de Divisor"
|
||
|
||
#: lazarusidestrconsts.dlgusefpccfg
|
||
#, fuzzy
|
||
#| msgid "Use standard Compiler Config File (fpc.cfg)"
|
||
msgid "Use standard compiler config file (fpc.cfg)"
|
||
msgstr "Usar el archivo estandar de configuración del compilador (fpc.cfg)"
|
||
|
||
#: lazarusidestrconsts.dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr "Usar al lanzar aplicación"
|
||
|
||
#: lazarusidestrconsts.dlguseminimumime
|
||
msgid "Ime handled by System"
|
||
msgstr "Ime manejados por el Sistema"
|
||
|
||
#: lazarusidestrconsts.dlguserschemeerror
|
||
msgid "Failed to load user-scheme file %s"
|
||
msgstr "Falló al cargar el archivo de combinaciones del usuario %s"
|
||
|
||
#: lazarusidestrconsts.dlguseschemedefaults
|
||
msgid "Use (and edit) global scheme settings"
|
||
msgstr "Usar (y editar) ajustes de combinación global"
|
||
|
||
#: lazarusidestrconsts.dlguseschemelocal
|
||
msgid "Use local scheme settings"
|
||
msgstr "Usar ajustes de combinación local"
|
||
|
||
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr "Usar resaltado de sintaxis"
|
||
|
||
#: lazarusidestrconsts.dlgusetabshistory
|
||
msgid "Use tab history when closing tabs"
|
||
msgstr "Usar historial cuando cierre pestañas"
|
||
|
||
#: lazarusidestrconsts.dlguseunitcaption
|
||
#, fuzzy
|
||
#| msgid "Use a unit from this project"
|
||
msgid "Add unit to Uses section"
|
||
msgstr "Usar una unidad de este proyecto"
|
||
|
||
#: lazarusidestrconsts.dlgvaluecolor
|
||
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
||
msgid "Value"
|
||
msgstr "Valor"
|
||
|
||
#: lazarusidestrconsts.dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr "Detalles durante la compilación:"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr "Columna de marcas visible"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr "Ver margen derecho"
|
||
|
||
#: lazarusidestrconsts.dlgwholewordsonly
|
||
#, fuzzy
|
||
#| msgid "&Whole Words Only"
|
||
msgid "&Whole words only"
|
||
msgstr "Sólo &Palabras Completas"
|
||
|
||
#: lazarusidestrconsts.dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr "Anchura:"
|
||
|
||
#: lazarusidestrconsts.dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr "Aplicación gráfica Win32"
|
||
|
||
#: lazarusidestrconsts.dlgwindow
|
||
msgctxt "lazarusidestrconsts.dlgwindow"
|
||
msgid "Window"
|
||
msgstr "Ventana"
|
||
|
||
#: lazarusidestrconsts.dlgwinpos
|
||
#, fuzzy
|
||
#| msgid "Window Positions"
|
||
msgid "Window positions"
|
||
msgstr "Posiciones de las ventanas"
|
||
|
||
#: lazarusidestrconsts.dlgwordexceptions
|
||
msgid "Exceptions"
|
||
msgstr "Excepciones"
|
||
|
||
#: lazarusidestrconsts.dlgwordspolicies
|
||
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
||
msgid "Words"
|
||
msgstr "Palabras"
|
||
|
||
#: lazarusidestrconsts.dlgwrdpreview
|
||
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
||
msgid "Preview"
|
||
msgstr "Vista previa"
|
||
|
||
#: lazarusidestrconsts.dlgwritefpclogo
|
||
#, fuzzy
|
||
#| msgid "Write an FPC logo"
|
||
msgid "Write FPC logo"
|
||
msgstr "Escribir un logo FPC"
|
||
|
||
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr "Los componentes multiseleccionados deben ser de un único formulario."
|
||
|
||
#: lazarusidestrconsts.fdmalignmenu
|
||
msgid "Align ..."
|
||
msgstr "Alinear ..."
|
||
|
||
#: lazarusidestrconsts.fdmdeleteselection
|
||
#| msgid "Delete selection"
|
||
msgid "Delete Selection"
|
||
msgstr "Borrar Selección"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorhorizontal
|
||
#| msgid "Mirror horizontal"
|
||
msgid "Mirror Horizontal"
|
||
msgstr "Reflejar Horizontal"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorvertical
|
||
#| msgid "Mirror vertical"
|
||
msgid "Mirror Vertical"
|
||
msgstr "Reflejar Vertical"
|
||
|
||
#: lazarusidestrconsts.fdmorderbackone
|
||
#| msgid "Back one"
|
||
msgid "Back One"
|
||
msgstr "Retroceder Uno"
|
||
|
||
#: lazarusidestrconsts.fdmorderforwardone
|
||
#| msgid "Forward one"
|
||
msgid "Forward One"
|
||
msgstr "Avanzar Uno"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetoback
|
||
#| msgid "Move to back"
|
||
msgid "Move to Back"
|
||
msgstr "Mover al Fondo"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetofront
|
||
#| msgid "Move to front"
|
||
msgid "Move to Front"
|
||
msgstr "Mover al Frente"
|
||
|
||
#: lazarusidestrconsts.fdmresetmenu
|
||
msgid "Reset ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmsaveformasxml
|
||
#, fuzzy
|
||
#| msgid "Save form as XML"
|
||
msgid "Save Form as XML"
|
||
msgstr "Guardar formulario como XML"
|
||
|
||
#: lazarusidestrconsts.fdmscalemenu
|
||
msgid "Scale ..."
|
||
msgstr "Escala ..."
|
||
|
||
#: lazarusidestrconsts.fdmscaleword
|
||
msgid "Scale"
|
||
msgstr "Escala"
|
||
|
||
#: lazarusidestrconsts.fdmselectall
|
||
msgctxt "lazarusidestrconsts.fdmselectall"
|
||
msgid "Select All"
|
||
msgstr "Seleccionar Todo"
|
||
|
||
#: lazarusidestrconsts.fdmsizemenu
|
||
msgid "Size ..."
|
||
msgstr "Tamaño ..."
|
||
|
||
#: lazarusidestrconsts.fdmsizeword
|
||
msgid "Size"
|
||
msgstr "Tamaño"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr "Opción: Ajustar a rejilla"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr "Opción: Ajustar a líneas guía"
|
||
|
||
#: lazarusidestrconsts.fdmzorder
|
||
msgid "Z-order"
|
||
msgstr "Orden-Z"
|
||
|
||
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
||
msgid "On Both Sides"
|
||
msgstr "En ambos Lados"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnclearhint
|
||
msgid "Clear all snapshots"
|
||
msgstr "Limpiar todas las instantáneas"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnenablehint
|
||
msgid "Toggle view snapshot or current"
|
||
msgstr "Alternar vista instantánea o actual"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnmakesnaphint
|
||
msgid "Take Snapshot"
|
||
msgstr "Tomar instantánea"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnpowerhint
|
||
msgid "Switch on/off automatic snapshots"
|
||
msgstr "Interruptor de encendido/apagado instantáneas automáticas"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnremovehint
|
||
msgid "Remove selected entry"
|
||
msgstr "Eliminar la entrada seleccionada"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnshowhisthint
|
||
msgid "View history"
|
||
msgstr "Ver historial"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnshowsnaphint
|
||
msgid "View Snapshots"
|
||
msgstr "Ver Instantaneas"
|
||
|
||
#: lazarusidestrconsts.histdlgcolumnloc
|
||
msgid "Location"
|
||
msgstr "Ubicación"
|
||
|
||
#: lazarusidestrconsts.histdlgcolumntime
|
||
msgid "Time"
|
||
msgstr "Tiempo"
|
||
|
||
#: lazarusidestrconsts.histdlgformname
|
||
msgctxt "lazarusidestrconsts.histdlgformname"
|
||
msgid "History"
|
||
msgstr "Historial"
|
||
|
||
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
||
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
||
msgstr "0 = no, 1 = dibujar líneas divisorias solo para el nivel superior, 2 = dibujar líneas para los dos primeros niveles, ..."
|
||
|
||
#: lazarusidestrconsts.lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "Añadir Archivos"
|
||
|
||
#: lazarusidestrconsts.lisa2paddfilestopackage
|
||
#, fuzzy
|
||
#| msgid "Add files to package"
|
||
msgid "Add Files to Package"
|
||
msgstr "Añadir Archivos al paquete"
|
||
|
||
#: lazarusidestrconsts.lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "Añadir a paquete"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr "Tipo del ancestro ambiguo"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr "Nombre de Clase Ambiguo"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr "Nombre de Unidad ambiguo"
|
||
|
||
#: lazarusidestrconsts.lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "Tipo del ancestro"
|
||
|
||
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
||
#, fuzzy
|
||
#| msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
||
msgid "A Pascal unit must have the extension .pp or .pas"
|
||
msgstr "Una unidad pascal debe tener la extensión .pp o .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr "Dependencias rotas"
|
||
|
||
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr "Ya existe ese nombre de Clase"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
||
msgid "Create New Component"
|
||
msgstr "Crear Nuevo Componente"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewfile
|
||
#, fuzzy
|
||
#| msgid "Create new file"
|
||
msgid "Create New File"
|
||
msgstr "Crear Nuevo Archivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewreq
|
||
msgid "Create New Requirement"
|
||
msgstr "Crear Nuevo Requisito"
|
||
|
||
#: lazarusidestrconsts.lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr "Dependencia"
|
||
|
||
#: lazarusidestrconsts.lisa2pexistingfile2
|
||
msgid "Existing file: %s%s%s"
|
||
msgstr "Archivo existente: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr "Ya existe el archivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
||
msgid "File %s%s%s already exists in the package."
|
||
msgstr "El archivo %s%s%s ya existe en el paquete."
|
||
|
||
#: lazarusidestrconsts.lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr "El archivo está usado."
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr "Nombre de archivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr "El archivo no es una unidad"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr "Tipo del Ancestro no válido"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
||
msgid "Invalid Circular Dependency"
|
||
msgstr "Dependencia circular invalida"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr "Nombre de Clase no válido"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr "Archivo no válido"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Nombre de archivo no válido"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr "Nombre de Unidad no válido"
|
||
|
||
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
||
msgid "%s%s%s is not a valid unit name."
|
||
msgstr "%s%s%s no es un nombre válido de unidad."
|
||
|
||
#: lazarusidestrconsts.lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr "Nuevo nombre de clase:"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewcomponent
|
||
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
|
||
msgid "New Component"
|
||
msgstr "Nuevo Componente"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr "Nuevo archivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
||
msgstr "No se ha encontrado un paquete para la dependencia %s%s%s.%sPor favor seleccione un paquete existente."
|
||
|
||
#: lazarusidestrconsts.lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr "Nombre de página demasiado largo"
|
||
|
||
#: lazarusidestrconsts.lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr "Página de paleta:"
|
||
|
||
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr "Las unidades de Pascal deben tener la extensión .pp or .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr "Guardar archivo de diálogo"
|
||
|
||
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr "Recortar o expandir nombre de archivo"
|
||
|
||
#: lazarusidestrconsts.lisa2pshowall
|
||
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
||
msgid "Show all"
|
||
msgstr "Mostar todo"
|
||
|
||
#: lazarusidestrconsts.lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr "Escoger Rutas"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "El tipo ancestro %s%s%s tiene el mismo nombre que %s la unidad %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
#, fuzzy
|
||
#| msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
||
msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
|
||
msgstr "El tipo ancestro %s%s%s no es un identificador de pascal válido."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
||
msgstr "El nombre de clase %s%s%s y su tipo ancestro %s%s%s son el mismo."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
||
msgstr "El nombre de clase %s%s%s ya existe en%sPaquete %s%sArchivo: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "El nombre de clase %s%s%s tiene el mismo nombre que%s la unidad %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
||
#, fuzzy
|
||
#| msgid "The class name %s%s%s is not a valid pascal identifier."
|
||
msgid "The class name %s%s%s is not a valid Pascal identifier."
|
||
msgstr "El nombre de clase %s%s%s no es un identificador de pascal válido."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr "El archivo %s%s%s es parte del proyecto actual.%sEs una mala idea compartir archivos entre proyectos y paquetes."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr "El nombre de archivo %s%s%s es ambiguo porque el paquete no tiene todavía un directorio predeterminado.%sPor favor, especifique un nombre de archivo con una ruta completa."
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "El número máximo de versión %s%s%s no es válido.%sPor Por favor, use el formato mayor.menor.release.build%sPor ejemplo: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "El número máximo de versión es menor que la versión mínima."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "El número de versión mínimo %s%s%s no es válido.%sPor favor, use el formato mayor.menor.release.build%sPor ejemplo: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
||
#, fuzzy
|
||
#| msgid "The package has already a dependency for the package %s%s%s."
|
||
msgid "The package already has a dependency on the package %s%s%s."
|
||
msgstr "El paquete ya tiene una dependencia para el paquete %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
|
||
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
||
msgstr "El nombre de paquete %s%s%s no es válido.%sPor favor escoja un paquete existente."
|
||
|
||
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name %s%s%s is too long (max 100 chars)."
|
||
msgstr "El nombre de página %s%s%s es demasiado largo (max 100 car)."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
||
msgstr "El nombre de unidad %s%s%s ya existe en el paquete:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname %s%s%s already exists in this package."
|
||
msgstr "El nombre de unidad %s%s%s ya existe en este paquete."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
||
msgstr "El nombre de unidad %s%s%s%sy el nombre de fichero %s%s%s son diferentes."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name %s%s%s does not correspond to the filename."
|
||
msgstr "El nombre de unidad %s%s%s no se corresponde con el nombre de archivo."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
#, fuzzy
|
||
#| msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
||
msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
|
||
msgstr "El nombre de unidad %s%s%s es el mismo que el de un componente registrado.%sUsar este puede causar mensajes de error extraños."
|
||
|
||
#: lazarusidestrconsts.lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr "Nombre de archivo de la unidad:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr "Nombre de Unidad:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr "Ya existe el nombre de unidad"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr "Nombre de unidad no válido"
|
||
|
||
#: lazarusidestrconsts.lisabandonchanges
|
||
msgid "Abandon changes?"
|
||
msgstr "¿Abandonar cambios?"
|
||
|
||
#: lazarusidestrconsts.lisabortall
|
||
msgid "Abort all"
|
||
msgstr "Abortar todo"
|
||
|
||
#: lazarusidestrconsts.lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "Abortar toda la carga"
|
||
|
||
#: lazarusidestrconsts.lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "Abortar la carga del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisabortwholeloading
|
||
msgid "Abort whole loading"
|
||
msgstr "Abortar toda la carga"
|
||
|
||
#: lazarusidestrconsts.lisaboutdocumentation
|
||
msgid "Documentation:"
|
||
msgstr "Documentación:"
|
||
|
||
#: lazarusidestrconsts.lisaboutide
|
||
msgid "About IDE"
|
||
msgstr "Acerca del IDE"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "Acerca de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarusmsg
|
||
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgstr "Licencia: GPL/LGPL. Vea las fuentes de Lazarus y Free Pascal para detalles sobre la licencia.%sLazarus es un IDE para crear aplicaciones gráficas y de consola con Free Pascal. Free Pascal es un compilador Pascal y Object Pascal que corre en Windows, Linux, Mac OS X, FreeBSD y otros.%sLazarus es la parte del puzzle que faltaba para permitirle desarrollar programas para todas las plataformas anteriores en un entorno parecido a Delphi. El IDE es una herramienta RAD que incluye un diseñador de formularios.%sComo Lazarus está creciendo, necesitamos más desarrolladores."
|
||
|
||
#: lazarusidestrconsts.lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr "No puedo encontrar la lista de Colaboradores"
|
||
|
||
#: lazarusidestrconsts.lisaboutofficial
|
||
msgid "Official:"
|
||
msgstr "Oficial:"
|
||
|
||
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
#, fuzzy
|
||
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
||
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
|
||
msgstr "Un %s no puede contener TControls.%sSólo puede colocar componentes no visuales en él."
|
||
|
||
#: lazarusidestrconsts.lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr "Reconocimientos"
|
||
|
||
#: lazarusidestrconsts.lisaction
|
||
msgid "Action:"
|
||
msgstr "Acción:"
|
||
|
||
#: lazarusidestrconsts.lisactions
|
||
msgid "Actions:"
|
||
msgstr "Acciones:"
|
||
|
||
#: lazarusidestrconsts.lisactivate
|
||
msgid "Activate"
|
||
msgstr "Activar"
|
||
|
||
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr "Activa sintaxis de expresión regular para texto y reemplazo (parecido a perl)"
|
||
|
||
#: lazarusidestrconsts.lisactivateselected
|
||
msgid "Activate Selected"
|
||
msgstr "Activar Selecionado"
|
||
|
||
#: lazarusidestrconsts.lisactive
|
||
msgid "Active"
|
||
msgstr "Activo"
|
||
|
||
#: lazarusidestrconsts.lisactivefilter
|
||
msgid "Active Filter"
|
||
msgstr "Filtro activo:"
|
||
|
||
#: lazarusidestrconsts.lisadd
|
||
msgctxt "lazarusidestrconsts.lisadd"
|
||
msgid "Add"
|
||
msgstr "Añadir"
|
||
|
||
#: lazarusidestrconsts.lisadddelphidefine
|
||
msgid "Add defines simulating Delphi7"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisadddelphidefinehint
|
||
msgid "Useful when the code has checks for supported compiler versions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
||
msgid "Added missing object \"%s\" to pascal source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddedpropertysfors
|
||
msgid "Added property \"%s\" for %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddfilesindirectory
|
||
msgid "Add Files in Directory"
|
||
msgstr "Añadir Archivos en Directorio"
|
||
|
||
#: lazarusidestrconsts.lisaddkeyworddo
|
||
msgid "Add keyword \"do\""
|
||
msgstr "Añadir palabra clave \"do\""
|
||
|
||
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
||
msgid "Add new build mode, copying settings from \"%s\""
|
||
msgstr "Añadir un modo nuevo de construcción, copiando los ajustes de \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisaddnewmacro
|
||
msgid "Add new macro"
|
||
msgstr "Añadir una macro nueva"
|
||
|
||
#: lazarusidestrconsts.lisaddnewset
|
||
msgid "Add new set"
|
||
msgstr "Añadir conjunto nuevo"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagerequirement
|
||
msgid "Add package requirement?"
|
||
msgstr "¿Añadir el requerimiento del paquete?"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
||
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
||
msgstr "agregar paquete(s) a la lista de los paquetes instalados (combinar con --build-ide para reconstruir IDE)."
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject
|
||
msgid "Add package %s to project?"
|
||
msgstr "¿Añadir el paquete %s al proyecto?"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject2
|
||
msgid "Add package to project"
|
||
msgstr "Añadir paquete al proyecto"
|
||
|
||
#: lazarusidestrconsts.lisaddparameterbrackets
|
||
msgid "Add parameter brackets"
|
||
msgstr "Añadir los parentesis del parámetro"
|
||
|
||
#: lazarusidestrconsts.lisaddress
|
||
msgid "Address:"
|
||
msgstr "Dirección:"
|
||
|
||
#: lazarusidestrconsts.lisaddressbreakpoint
|
||
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
|
||
msgid "&Address Breakpoint ..."
|
||
msgstr "Direcciones de punto de interupción ..."
|
||
|
||
#: lazarusidestrconsts.lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "¿Añadir %s al proyecto?"
|
||
|
||
#: lazarusidestrconsts.lisaddunitinterfaces
|
||
msgid "Add unit interfaces"
|
||
msgstr "Añadir la interfaz de la unidad"
|
||
|
||
#: lazarusidestrconsts.lisaddunitnotrecommended
|
||
msgid "Add unit (not recommended)"
|
||
msgstr "Añadir unidad (no recomendado)"
|
||
|
||
#: lazarusidestrconsts.lisaddvaluetomacro
|
||
msgid "Add value to macro %s"
|
||
msgstr "Añadir valor a macro %s"
|
||
|
||
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
||
#, fuzzy
|
||
#| msgid "Add file to a package"
|
||
msgid "Add File to Package"
|
||
msgstr "Añadir Archivo a un Paquete"
|
||
|
||
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
||
#, fuzzy
|
||
#| msgid "Destination Package"
|
||
msgid "Destination package"
|
||
msgstr "Paquete destino"
|
||
|
||
#: lazarusidestrconsts.lisaf2pfiletype
|
||
#, fuzzy
|
||
#| msgid "File Type"
|
||
msgid "File type"
|
||
msgstr "Tipo de Archivo"
|
||
|
||
#: lazarusidestrconsts.lisaf2phasregisterprocedure
|
||
msgid "Has Register procedure"
|
||
msgstr "Tiene procedimiento de registro"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr "Paquete no válido"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: %s%s%s"
|
||
msgstr "ID del paquete no válido: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr "El paquete es de sólo-lectura"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
||
msgid "Package %s%s%s not found."
|
||
msgstr "No se ha encontrado el paquete %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisaf2pshowall
|
||
#, fuzzy
|
||
#| msgid "Show All"
|
||
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
||
msgid "Show all"
|
||
msgstr "Mostrar Todo"
|
||
|
||
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "El archivo %s%s%s%sya esta en el paquete %s."
|
||
|
||
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr "El paquete %s es de sólo-lectura."
|
||
|
||
#: lazarusidestrconsts.lisaf2punitname
|
||
#, fuzzy
|
||
#| msgid "Unit Name: "
|
||
msgid "Unit name: "
|
||
msgstr "Nombre de Unidad: "
|
||
|
||
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
||
msgid "A file %s%s%s already exists.%sReplace it?"
|
||
msgstr "Ya existe el archivo %s%s%s.%s¿Reemplazarlo?"
|
||
|
||
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
||
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
||
msgstr "Después de la limpieza (limpiar todo o limpiar los archivos comunes), cambie a limpiar automáticamente"
|
||
|
||
#: lazarusidestrconsts.lisalignment
|
||
msgid "Alignment"
|
||
msgstr "Alineación"
|
||
|
||
#: lazarusidestrconsts.lisallblockslooksok
|
||
#, fuzzy
|
||
#| msgid "All blocks looks ok."
|
||
msgid "All blocks look ok."
|
||
msgstr "Todos los bloques parecen correctos."
|
||
|
||
#: lazarusidestrconsts.lisallbuildmodes
|
||
msgid "<All build modes>"
|
||
msgstr "<Todos los modos de construcción>"
|
||
|
||
#: lazarusidestrconsts.lisallfiles
|
||
msgid "All Files"
|
||
msgstr "Todos los Archivos"
|
||
|
||
#: lazarusidestrconsts.lisallinheritedoptions
|
||
msgid "All inherited options"
|
||
msgstr "Todas la opciones heredadas"
|
||
|
||
#: lazarusidestrconsts.lisalloptions
|
||
msgid "All Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallowfunctio
|
||
msgid "Allow Function Calls"
|
||
msgstr "Permitir Llamadas de Función"
|
||
|
||
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr "Permitir búsqueda para múltiples líneas"
|
||
|
||
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
||
msgid "All parameters of this function are already set at this call. Nothing to add."
|
||
msgstr "Todos los parámetros de esta función ya están establecidas en esta llamada. Nada que añadir."
|
||
|
||
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
||
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
||
msgstr "Todas sus modificaciones a %s%s%s%sse perderan y el archivo será re abierto."
|
||
|
||
#: lazarusidestrconsts.lisalpha
|
||
msgid "Alpha"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalternativekey
|
||
msgid "Alternative key"
|
||
msgstr "Tecla alternativa"
|
||
|
||
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
||
msgid "Alternative key (or 2 key sequence)"
|
||
msgstr "Tecla alternativa (o secuencía de 2 teclas)"
|
||
|
||
#: lazarusidestrconsts.lisalways
|
||
msgid "Always"
|
||
msgstr "Siempre"
|
||
|
||
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
||
msgid "Always convert suggested default file name to lowercase"
|
||
msgstr "Siempre convertir el nombre sugerido por defecto a minúsculas"
|
||
|
||
#: lazarusidestrconsts.lisalwaysignore
|
||
msgid "Always ignore"
|
||
msgstr "Siempre ignorar"
|
||
|
||
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
||
msgid "A macro with this name already exists."
|
||
msgstr "Una macro con ese nombre ya existe."
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr "Encontrado archivo ambiguo"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
||
msgstr "Encontrado archivo ambiguo: %s%s%s%sEste archivo puede confundirse con %s%s%s%s%s¿Borrar el archivo ambiguo?"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr "Encontrados archivos ambiguos"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound
|
||
msgid "Ambiguous Unit found"
|
||
msgstr "Se encontró Unidad Ambigua"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound2
|
||
msgid "Ambiguous unit found"
|
||
msgstr "Encontrada unidad ambigua"
|
||
|
||
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
||
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr "Anclaje parte inferior a la parte inferior de los hermanos. Utilice BorderSpacing para establecer la distancia. BorderSpacing de hermano se ignora."
|
||
|
||
#: lazarusidestrconsts.lisanchorbottomtotopside
|
||
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr "Anclaje parte inferior a la parte superior de los hermanos. La distancia se define mantenido por ambas propiedades BorderSpacing de este y el hermano."
|
||
|
||
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr "Editor de anclaje - ningún control seleccionado"
|
||
|
||
#: lazarusidestrconsts.lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr "Activado = Incluir %s en Anclaje"
|
||
|
||
#: lazarusidestrconsts.lisanchorlefttoleftside
|
||
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr "Anclaje de lado izquierdo a lado izquierdo de hermanos. Utilice BorderSpacing para establecer la distancia. BorderSpacing de hermano se ignora."
|
||
|
||
#: lazarusidestrconsts.lisanchorlefttorightside
|
||
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr "Anclaje del lado izquierdo al lado derecho del hermano. La distancia se define mantenido por ambas propiedades BorderSpacing de este y el hermano."
|
||
|
||
#: lazarusidestrconsts.lisanchorrighttoleftside
|
||
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr "Anclaje lado derecho al lado izquierdo de los hermanos. La distancia se define mantenido por ambas propiedades BorderSpacing de este y el hermano."
|
||
|
||
#: lazarusidestrconsts.lisanchorrighttorightside
|
||
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr "Anclaje lado derecho al lado derecho de los hermanos. Utilice BorderSpacing para establecer la distancia. BorderSpacing de hermano se ignora."
|
||
|
||
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr "Anclajes de los controles seleccionados"
|
||
|
||
#: lazarusidestrconsts.lisanchortoptobottomside
|
||
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr "Anclaje parte superior a la parte inferior de los hermanos. La distancia se define mantenido por ambas propiedades BorderSpacing de este y el hermano."
|
||
|
||
#: lazarusidestrconsts.lisanchortoptotopside
|
||
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr "Anclaje parte superior al lado de la parte superior de los hermanos. Utilice BorderSpacing para establecer la distancia. BorderSpacing de hermano se ignora."
|
||
|
||
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
||
msgstr "¡Ocurrió un error en el último inicio mientras se cargaba %s!%s%s¿Cargar este proyecto otra vez?"
|
||
|
||
#: lazarusidestrconsts.lisapplicationclassname
|
||
msgid "&Application class name"
|
||
msgstr "Nombre de clase de la &aplicación"
|
||
|
||
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
||
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
||
msgstr "Una aplicación gráfica Free Pascal utilizando la biblioteca multiplataforma LCL para su GUI."
|
||
|
||
#: lazarusidestrconsts.lisapply
|
||
msgctxt "lazarusidestrconsts.lisapply"
|
||
msgid "Apply"
|
||
msgstr "Aplicar"
|
||
|
||
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
||
msgid "apply build flags (-B) to dependencies too"
|
||
msgstr "Aplicar también las opciones de Construcción (-B) a las dependencias"
|
||
|
||
#: lazarusidestrconsts.lisapplyconventions
|
||
msgid "Apply conventions"
|
||
msgstr "Aplicar convenciones"
|
||
|
||
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
||
msgid "A project unit can not be used by other packages/projects"
|
||
msgstr "La unidad del proyecto no puede usarse en otros paquetes/proyectos"
|
||
|
||
#: lazarusidestrconsts.lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr "Espacio de borde alrededor del control. Los otros cuatro espacios se añaden a este valor."
|
||
|
||
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr "Preguntar antes de reemplazar cada coincidencia"
|
||
|
||
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
||
msgid "Ask before saving project's session"
|
||
msgstr "Preguntar antes del salvado de la sesión del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
||
msgid "Ask for component name after putting it on a designer form"
|
||
msgstr "Preguntar por el nombre del componente despues de ponerlo en el diseñador de formularios"
|
||
|
||
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
||
msgid "Ask for file name on new file"
|
||
msgstr "Preguntar por el nombre de archivo al crear uno nuevo"
|
||
|
||
#: lazarusidestrconsts.lisasknameoncreate
|
||
msgid "Ask name on create"
|
||
msgstr "Preguntar nombre al crear"
|
||
|
||
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
|
||
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
||
msgstr "Una opción útil en sistemas Windows es la siguiente: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
||
|
||
#: lazarusidestrconsts.lisautocompletionoff
|
||
msgid "Auto completion: off"
|
||
msgstr "Completar Automáticamente: activado"
|
||
|
||
#: lazarusidestrconsts.lisautocompletionon
|
||
msgid "Auto completion: on"
|
||
msgstr "Completar Automáticamente: desactivado"
|
||
|
||
#: lazarusidestrconsts.lisautocontinueafter
|
||
msgid "Auto continue after:"
|
||
msgstr "Continuación Automática despues de:"
|
||
|
||
#: lazarusidestrconsts.lisautomarkup
|
||
msgid "Markup and Matches"
|
||
msgstr "Marcas y Coincidencias"
|
||
|
||
#: lazarusidestrconsts.lisautomatic
|
||
msgctxt "lazarusidestrconsts.lisautomatic"
|
||
msgid "Automatic"
|
||
msgstr "Automatico"
|
||
|
||
#: lazarusidestrconsts.lisautomatically
|
||
msgid "Automatically"
|
||
msgstr "Automaticamente"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
|
||
msgid "Automatically convert .lfm files to .lrs include files"
|
||
msgstr "Convierte automaticamente archivos .lfm a archivos de inclusión .lrs"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
||
msgid "do not complete selection"
|
||
msgstr "selección no completa"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
||
msgid "Automatically invoke after point"
|
||
msgstr "Invocar automáticamente despues del punto"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr "salto de línea"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr "espacio"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyontab
|
||
msgid "tab"
|
||
msgstr "tab"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr "fin de palabra"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr "No agregar carácter"
|
||
|
||
#: lazarusidestrconsts.lisautomaticfeatures
|
||
#| msgid "Automatic features"
|
||
msgid "Completion and Hints"
|
||
msgstr "Completado y Descripciones"
|
||
|
||
#: lazarusidestrconsts.lisautoshowobjectinspector
|
||
msgid "Auto show"
|
||
msgstr "Mostrar Automáticamente"
|
||
|
||
#: lazarusidestrconsts.lisavailableforinstallation
|
||
msgid "Available for installation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
||
msgid "Available project build modes:"
|
||
msgstr "Modos de Construccion del proyecto disponibles:"
|
||
|
||
#: lazarusidestrconsts.lisbackupchangedfiles
|
||
msgid "Make backup of changed files"
|
||
msgstr "Hacer una copia de seguridad de los archivos modificados"
|
||
|
||
#: lazarusidestrconsts.lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "Fallo al realizar la copia de seguridad del archivo"
|
||
|
||
#: lazarusidestrconsts.lisbackuphint
|
||
msgid "Creates a Backup directory under project directory"
|
||
msgstr "Hacer una copia de seguridad del directorio bajo el directorio del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr "Cambiar el nombre del paquete o la versión rompe las dependencias. ¿Se cambian también las dependencias?%sEscoge Si para cambiar todas las dependencias listadas.%sEscoge Ignorar para romper las dependencias y continuar."
|
||
|
||
#: lazarusidestrconsts.lisbegins
|
||
msgid "begins"
|
||
msgstr "empieza"
|
||
|
||
#: lazarusidestrconsts.lisbehindrelated
|
||
msgid "Behind related"
|
||
msgstr "Detrás de los relacionados"
|
||
|
||
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
||
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
||
msgstr "Se ve mejor con la instalación de un control HTML como turbopoweriprodsgn"
|
||
|
||
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
||
#, fuzzy
|
||
#| msgid "Always Build before Run"
|
||
msgid "Always build before run"
|
||
msgstr "Siempre construir antes de ejecutar"
|
||
|
||
#: lazarusidestrconsts.lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr "Construir comando"
|
||
|
||
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr "Al construir el proyecto ejecutar en su lugar el archivo de construcción"
|
||
|
||
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr "Al correr el proyecto, ejecutar el comando Correr Archivo en su lugar"
|
||
|
||
#: lazarusidestrconsts.lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr "Ejecutar comando"
|
||
|
||
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
||
#, fuzzy
|
||
#| msgid "When this file is active in source editor ..."
|
||
msgid "When this file is active in source editor"
|
||
msgstr "Cuando este archivo está activo en el editor de código"
|
||
|
||
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
||
#, fuzzy
|
||
#| msgid "Working directory (Leave empty for file path)"
|
||
msgid "Working directory (leave empty for file path)"
|
||
msgstr "Directorio de trabajo (deje en blanco para usar la ruta de archivo)"
|
||
|
||
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
||
msgid "Bold non default values"
|
||
msgstr "Poner en negritas valores no predeterminados"
|
||
|
||
#: lazarusidestrconsts.lisborderspace
|
||
#, fuzzy
|
||
#| msgid "BorderSpace"
|
||
msgid "Border space"
|
||
msgstr "Espacio de borde"
|
||
|
||
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr "Espacio de borde inferior. Este valor se añade al valor base de espacio de borde y es usado para el espacio bajo el control."
|
||
|
||
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr "Anclaje inferior"
|
||
|
||
#: lazarusidestrconsts.lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr "Inferiores"
|
||
|
||
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
||
msgstr "Este es el control hermano al cual el lado inferior está anclado. Déjelo vacío para que sea el padre."
|
||
|
||
#: lazarusidestrconsts.lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr "Igualar espaciado inferior"
|
||
|
||
#: lazarusidestrconsts.lisbreak
|
||
msgctxt "lazarusidestrconsts.lisbreak"
|
||
msgid "Break"
|
||
msgstr "Interrumpir"
|
||
|
||
#: lazarusidestrconsts.lisbreakpointproperties
|
||
msgid "Breakpoint Properties"
|
||
msgstr "Propiedades del punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.lisbtnadd
|
||
msgctxt "lazarusidestrconsts.lisbtnadd"
|
||
msgid "&Add"
|
||
msgstr "&Añadir"
|
||
|
||
#: lazarusidestrconsts.lisbtnclose
|
||
msgctxt "lazarusidestrconsts.lisbtnclose"
|
||
msgid "&Close"
|
||
msgstr "&Cerrar"
|
||
|
||
#: lazarusidestrconsts.lisbtndelete
|
||
msgctxt "lazarusidestrconsts.lisbtndelete"
|
||
msgid "&Delete"
|
||
msgstr "&Borrar"
|
||
|
||
#: lazarusidestrconsts.lisbtndlgadd
|
||
msgid "&Add ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbtndlgreplace
|
||
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
||
msgid "&Replace ..."
|
||
msgstr "&Reemplazar..."
|
||
|
||
#: lazarusidestrconsts.lisbtnenabled
|
||
msgctxt "lazarusidestrconsts.lisbtnenabled"
|
||
msgid "&Enabled"
|
||
msgstr "&Activado"
|
||
|
||
#: lazarusidestrconsts.lisbtnfind
|
||
msgid "&Find"
|
||
msgstr "&Buscar"
|
||
|
||
#: lazarusidestrconsts.lisbtnquit
|
||
msgctxt "lazarusidestrconsts.lisbtnquit"
|
||
msgid "&Quit"
|
||
msgstr "&Salir"
|
||
|
||
#: lazarusidestrconsts.lisbtnremove
|
||
msgctxt "lazarusidestrconsts.lisbtnremove"
|
||
msgid "&Remove"
|
||
msgstr "&Eliminar"
|
||
|
||
#: lazarusidestrconsts.lisbtnreplace
|
||
msgid "&Replace"
|
||
msgstr "&Reemplazar"
|
||
|
||
#: lazarusidestrconsts.lisbuild
|
||
msgctxt "lazarusidestrconsts.lisbuild"
|
||
msgid "Build"
|
||
msgstr "Construir"
|
||
|
||
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
||
msgid "build all files of project/package/IDE"
|
||
msgstr "Construir todos los archivos del proyecto/Paquete/IDE"
|
||
|
||
#: lazarusidestrconsts.lisbuildcaption
|
||
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
||
msgid "Build"
|
||
msgstr "Construir"
|
||
|
||
#: lazarusidestrconsts.lisbuildidewithpackages
|
||
msgid "build IDE with packages"
|
||
msgstr "Construir IDE con paquetes"
|
||
|
||
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
||
msgid "Building Lazarus failed"
|
||
msgstr "Ha fallado la construcción de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
||
msgid "Differences between build modes"
|
||
msgstr "Diferencias entre modos de construcción"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
||
#, fuzzy
|
||
#| msgid "Differences to other build modes"
|
||
msgid "Differences from other build modes"
|
||
msgstr "Diferencias de otros modos de construcción"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffmode
|
||
msgid "Mode:"
|
||
msgstr "Modo:"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodeintitleinexample
|
||
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildmodes
|
||
msgid "Build modes"
|
||
msgstr "Modos de construcción"
|
||
|
||
#: lazarusidestrconsts.lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "Construir nuevo proyecto"
|
||
|
||
#: lazarusidestrconsts.lisbuildnumber
|
||
#, fuzzy
|
||
#| msgid "Build Number"
|
||
msgid "Build number"
|
||
msgstr "Número de construcción"
|
||
|
||
#: lazarusidestrconsts.lisbuildstage
|
||
msgctxt "lazarusidestrconsts.lisbuildstage"
|
||
msgid "Build"
|
||
msgstr "Construir"
|
||
|
||
#: lazarusidestrconsts.lisbusy
|
||
msgid "Busy"
|
||
msgstr "Ocupado"
|
||
|
||
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
||
msgid "Calling %s to create Makefile from %s failed."
|
||
msgstr "Llamada a %s para crear Makefile desde %s falló."
|
||
|
||
#: lazarusidestrconsts.liscallstacknotevaluated
|
||
msgid "Stack not evaluated"
|
||
msgstr "Pila(stack) no evaluada"
|
||
|
||
#: lazarusidestrconsts.liscancel
|
||
msgctxt "lazarusidestrconsts.liscancel"
|
||
msgid "Cancel"
|
||
msgstr "Cancelar"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr "Cancelar carga de este componente"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr "Cancelar carga de la unidad"
|
||
|
||
#: lazarusidestrconsts.liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr "Cancelar renombrado"
|
||
|
||
#: lazarusidestrconsts.liscannotcompileproject
|
||
msgid "Cannot compile project"
|
||
msgstr "No se puede compilar el proyecto"
|
||
|
||
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
||
#, fuzzy
|
||
#| msgid "Can not copy top level component."
|
||
msgid "Cannot copy top level component."
|
||
msgstr "No puedo copiar un componente de nivel superior"
|
||
|
||
#: lazarusidestrconsts.liscannotcreatefile
|
||
#, fuzzy
|
||
#| msgid "Can not create file %s%s%s"
|
||
msgid "Cannot create file %s%s%s"
|
||
msgstr "No se puede crear el archivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
||
#, fuzzy
|
||
#| msgid "Cannot find lazarus starter:%s%s"
|
||
msgid "Cannot find Lazarus starter:%s%s"
|
||
msgstr "No puedo encontrar el iniciador de Lazarus:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
||
msgid "Cannot test the compiler while debugging or compiling."
|
||
msgstr "No puede probar el compilador mientras esta en depuración o compilación."
|
||
|
||
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr "Sólo se puede cambiar la clase de TComponents."
|
||
|
||
#: lazarusidestrconsts.liscaptiondiff
|
||
msgctxt "lazarusidestrconsts.liscaptiondiff"
|
||
msgid "Diff"
|
||
msgstr "Difrencias"
|
||
|
||
#: lazarusidestrconsts.liscbpfiles
|
||
msgid "%s (%s files)"
|
||
msgstr "%s (%s archivos)"
|
||
|
||
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
||
msgid "Really delete %s source files%s%s"
|
||
msgstr "¿Realmente desea borrar archivos %s de código fuente%s%s"
|
||
|
||
#: lazarusidestrconsts.lisccdchangeclassof
|
||
msgid "Change Class of %s"
|
||
msgstr "Cambiar Clase de %s"
|
||
|
||
#: lazarusidestrconsts.lisccdnoclass
|
||
msgid "no class"
|
||
msgstr "no clase"
|
||
|
||
#: lazarusidestrconsts.lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr "Compilador ambiguo"
|
||
|
||
#: lazarusidestrconsts.lisccochecktestdir
|
||
#, fuzzy
|
||
#| msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
||
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
||
msgstr "Por favor, compruebe el directorio de pruebas en %sHerramientas -> Opciones -> Archivos -> Directorio para construir proyectos de prueba"
|
||
|
||
#: lazarusidestrconsts.lisccocompilernotanexe
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr "El compilador \"%s\" no es un archivo ejecutable.%sDetalles: %s"
|
||
|
||
#: lazarusidestrconsts.lisccocontains
|
||
msgid "contains "
|
||
msgstr "contiene "
|
||
|
||
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr "Copiar salida al portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisccodatesdiffer
|
||
#, fuzzy
|
||
#| msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr "Las fechas de los archivos .ppu de FPC difieren en más de una hora.%sEsto puede significar que son de dos instalaciones diferentes.%sArchivo1: %s%sArchivo2: %s"
|
||
|
||
#: lazarusidestrconsts.lisccoerrorcaption
|
||
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
||
msgid "Error"
|
||
msgstr "Error"
|
||
|
||
#: lazarusidestrconsts.lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr "ERROR: "
|
||
|
||
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr "La ruta de unidad de FPC contienen un fuente: "
|
||
|
||
#: lazarusidestrconsts.lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr "símbolos de línea nuevos"
|
||
|
||
#: lazarusidestrconsts.lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr "SUGERENCIA: "
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr "Compilador no válido"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr "Ruta de búsqueda no válida"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr "Directorio de pruebas no válido"
|
||
|
||
#: lazarusidestrconsts.lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr "Unidad desaparecida"
|
||
|
||
#: lazarusidestrconsts.lisccomsgppunotfound
|
||
msgid "compiled FPC unit not found: %s.ppu"
|
||
msgstr "Unidad compilada FPC no encontrada: %s.ppu"
|
||
|
||
#: lazarusidestrconsts.lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr "múltiples configuraciones del compilador encontradas: "
|
||
|
||
#: lazarusidestrconsts.liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr "no se encontró fpc.cfg"
|
||
|
||
#: lazarusidestrconsts.lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr "no ASCII"
|
||
|
||
#: lazarusidestrconsts.lisccoppuexiststwice
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr "ppu existe dos veces: %s, %s"
|
||
|
||
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
||
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
||
msgstr "La unidad FPC %s.ppu compilada no ha sido encontrada.%sEsto normalmente significa que hay un error en su fichero fpc.cfg. O su instalación de FPC es incorrecta."
|
||
|
||
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr "Hay un archivo .ppu más antiguo que el compilador:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisccoseveralcompilers
|
||
#, fuzzy
|
||
#| msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr "Hay varios compiladores Free Pascal en su PATH.%s%s%sQuizas ¿Ha olvidado borrar un compilador anterior?"
|
||
|
||
#: lazarusidestrconsts.lisccoskip
|
||
msgid "Skip"
|
||
msgstr "Saltar"
|
||
|
||
#: lazarusidestrconsts.lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr "caracteres especiales"
|
||
|
||
#: lazarusidestrconsts.lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr "Todos los test correctos."
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr "No se puede crear el Archivo de texto"
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
||
#, fuzzy
|
||
#| msgid "Unable to create Test pascal file \"%s\"."
|
||
msgid "Unable to create Test Pascal file \"%s\"."
|
||
msgstr "No se puede crear el archivo de texto Pascal \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr "caracteres no usuales"
|
||
|
||
#: lazarusidestrconsts.lisccowarningcaption
|
||
msgid "Warning"
|
||
msgstr "Advertencia"
|
||
|
||
#: lazarusidestrconsts.lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr "ADVERTENCIA: "
|
||
|
||
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr "delimitador de ruta incorrecto"
|
||
|
||
#: lazarusidestrconsts.liscecategories
|
||
msgid "Categories"
|
||
msgstr "Categorías"
|
||
|
||
#: lazarusidestrconsts.liscecomplexitygroup
|
||
msgid "Complexity"
|
||
msgstr "Complejidad"
|
||
|
||
#: lazarusidestrconsts.lisceconstants
|
||
msgid "Constants"
|
||
msgstr "Constantes"
|
||
|
||
#: lazarusidestrconsts.lisceemptyblocks
|
||
msgid "Empty blocks"
|
||
msgstr "Bloques Vacios"
|
||
|
||
#: lazarusidestrconsts.lisceemptyclasssections
|
||
msgid "Empty class sections"
|
||
msgstr "Secciones vacias en clases"
|
||
|
||
#: lazarusidestrconsts.lisceemptygroup
|
||
msgid "Empty constructs"
|
||
msgstr "Elementos Vacios"
|
||
|
||
#: lazarusidestrconsts.lisceemptyprocedures
|
||
msgid "Empty procedures"
|
||
msgstr "Procedimientos Vacios"
|
||
|
||
#: lazarusidestrconsts.liscefilter
|
||
#, fuzzy
|
||
#| msgid "(Filter)"
|
||
msgid "(filter)"
|
||
msgstr "(filtro)"
|
||
|
||
#: lazarusidestrconsts.liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr "Seguir al cursor"
|
||
|
||
#: lazarusidestrconsts.liscein
|
||
msgctxt "lazarusidestrconsts.liscein"
|
||
msgid "%s in %s"
|
||
msgstr "%s en %s"
|
||
|
||
#: lazarusidestrconsts.lisceisarootcontrol
|
||
msgid "Is a root control"
|
||
msgstr "Es un control principal"
|
||
|
||
#: lazarusidestrconsts.liscelongparamlistcount
|
||
#, fuzzy
|
||
#| msgid "Parameters count treating as \"many\""
|
||
msgid "Parameters count treated as \"many\""
|
||
msgstr "Recuento de los parámetros considerado como \"muchos\""
|
||
|
||
#: lazarusidestrconsts.liscelongprocedures
|
||
msgid "Long procedures"
|
||
msgstr "Procedimientos grandes"
|
||
|
||
#: lazarusidestrconsts.liscelongproclinecount
|
||
msgid "Line count of procedure treated as \"long\""
|
||
msgstr "Total de líneas para ser contadas como \"grande\""
|
||
|
||
#: lazarusidestrconsts.liscemanynestedprocedures
|
||
msgid "Many nested procedures"
|
||
msgstr "Muchos procedimientos anidados"
|
||
|
||
#: lazarusidestrconsts.liscemanyparameters
|
||
msgid "Many parameters"
|
||
msgstr "Muchos parametros"
|
||
|
||
#: lazarusidestrconsts.liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr "Mostrar categorías"
|
||
|
||
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr "Mostrar nodos fuente"
|
||
|
||
#: lazarusidestrconsts.liscenestedproccount
|
||
#, fuzzy
|
||
#| msgid "Nested procedures count treating as \"many\""
|
||
msgid "Nested procedures count treated as \"many\""
|
||
msgstr "Total de procedimientos anidados contados como \"muchos\""
|
||
|
||
#: lazarusidestrconsts.liscenteralostwindow
|
||
msgid "Center a lost window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
||
#, fuzzy
|
||
#| msgid "Center control horizontally relative to the given sibling"
|
||
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
||
msgstr "Centrar el control horizontalmente relativo al hermano dado. BorderSpacing es ignorado."
|
||
|
||
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
||
#, fuzzy
|
||
#| msgid "Center control vertically relative to the given sibling"
|
||
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
||
msgstr "Centrar el control verticalmente relativo al hermano dado. BorderSpacing es ignorado."
|
||
|
||
#: lazarusidestrconsts.liscenterform
|
||
#, fuzzy
|
||
#| msgid "Center form"
|
||
msgid "Center Form"
|
||
msgstr "Centrar Formulario"
|
||
|
||
#: lazarusidestrconsts.liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "Centrar en ventana"
|
||
|
||
#: lazarusidestrconsts.liscenters
|
||
msgid "Centers"
|
||
msgstr "Centros"
|
||
|
||
#: lazarusidestrconsts.lisceomode
|
||
#, fuzzy
|
||
#| msgid "Preferred Exhibition Mode"
|
||
msgid "Preferred exhibition mode"
|
||
msgstr "Modo preferido de exposición"
|
||
|
||
#: lazarusidestrconsts.lisceomodecategory
|
||
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
||
msgid "Category"
|
||
msgstr "Categoría"
|
||
|
||
#: lazarusidestrconsts.lisceomodesource
|
||
msgctxt "lazarusidestrconsts.lisceomodesource"
|
||
msgid "Source"
|
||
msgstr "Fuente"
|
||
|
||
#: lazarusidestrconsts.lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr "Nunca, solo manualmente"
|
||
|
||
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr "Usado sólo en modo categoría"
|
||
|
||
#: lazarusidestrconsts.lisceoonidle
|
||
msgid "On idle"
|
||
msgstr "Cuando esté inactivo"
|
||
|
||
#: lazarusidestrconsts.lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr "Refrescar automáticamente"
|
||
|
||
#: lazarusidestrconsts.lisceothergroup
|
||
msgctxt "lazarusidestrconsts.lisceothergroup"
|
||
msgid "Other"
|
||
msgstr "Otros"
|
||
|
||
#: lazarusidestrconsts.lisceoupdate
|
||
msgid "Update"
|
||
msgstr "Actualizar"
|
||
|
||
#: lazarusidestrconsts.lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr "Al cambiar de archivo en el editor de código"
|
||
|
||
#: lazarusidestrconsts.lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr "Procedimientos"
|
||
|
||
#: lazarusidestrconsts.lisceproperties
|
||
msgctxt "lazarusidestrconsts.lisceproperties"
|
||
msgid "Properties"
|
||
msgstr "Propiedades"
|
||
|
||
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
||
msgid "Published properties without default"
|
||
msgstr "Propiedades Published sin calificador default"
|
||
|
||
#: lazarusidestrconsts.lisceshowcodeobserver
|
||
#, fuzzy
|
||
#| msgid "Show observerations about"
|
||
msgid "Show observations about"
|
||
msgstr "Mostrar observaciones acerca de"
|
||
|
||
#: lazarusidestrconsts.liscestylegroup
|
||
msgctxt "lazarusidestrconsts.liscestylegroup"
|
||
msgid "Style"
|
||
msgstr "Estilo"
|
||
|
||
#: lazarusidestrconsts.liscesurrounding
|
||
msgid "Surrounding"
|
||
msgstr "Circundante"
|
||
|
||
#: lazarusidestrconsts.liscetodos
|
||
msgid "ToDos"
|
||
msgstr "Lista por hacer"
|
||
|
||
#: lazarusidestrconsts.liscetypes
|
||
msgid "Types"
|
||
msgstr "Tipos"
|
||
|
||
#: lazarusidestrconsts.lisceunnamedconstants
|
||
msgid "Unnamed constants"
|
||
msgstr "constantes sin nombre"
|
||
|
||
#: lazarusidestrconsts.lisceunsortedmembers
|
||
msgid "Unsorted members"
|
||
msgstr "Miembros no ordenados"
|
||
|
||
#: lazarusidestrconsts.lisceunsortedvisibility
|
||
msgid "Unsorted visibility"
|
||
msgstr "Visibilidad desordenada"
|
||
|
||
#: lazarusidestrconsts.lisceuses
|
||
msgctxt "lazarusidestrconsts.lisceuses"
|
||
msgid "Uses"
|
||
msgstr "Uses"
|
||
|
||
#: lazarusidestrconsts.liscevariables
|
||
msgid "Variables"
|
||
msgstr "Variables"
|
||
|
||
#: lazarusidestrconsts.liscewrongindentation
|
||
msgid "Wrong indentation"
|
||
msgstr "Sangrado erróneo"
|
||
|
||
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
|
||
msgid "An exception occured during deletion of%s\"%s:%s\"%s%s"
|
||
msgstr "Se produjo una excepción durante la eliminación de%s\"%s:%s\"%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfecancelloadingthisresource
|
||
msgid "Cancel loading this resource"
|
||
msgstr "Cancelar la carga de este recurso"
|
||
|
||
#: lazarusidestrconsts.liscfeclassnotfound
|
||
msgid "%s%sClass \"%s\" not found."
|
||
msgstr "%s%sClase \"%s\" no encontrada."
|
||
|
||
#: lazarusidestrconsts.liscfecomponent
|
||
msgid "%s%sComponent: %s:%s"
|
||
msgstr "%s%sComponente: %s:%s"
|
||
|
||
#: lazarusidestrconsts.liscfecomponentclass
|
||
msgid "%s%sComponent Class: %s"
|
||
msgstr "%s%sComponente de Clase: %s"
|
||
|
||
#: lazarusidestrconsts.liscfecontinueloading
|
||
msgid "Continue loading"
|
||
msgstr "Continuar carga"
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
||
msgid "Do not know how to copy this form editing selection"
|
||
msgstr "No se sabe cómo copiar esta selección de edición del formulario"
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
||
msgid "Do not know how to cut this form editing selection"
|
||
msgstr "No se sabe cómo cortar esta selección de edición del formulario"
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
||
msgid "Do not know how to delete this form editing selection"
|
||
msgstr "No se sabe cómo borrar esta selección de edición del formulario"
|
||
|
||
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
||
msgid "Error creating component"
|
||
msgstr "Error al crear el componente"
|
||
|
||
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
||
msgid "Error creating component: %s%s%s"
|
||
msgstr "Error al crear el componente: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
||
msgid "Error destroying component"
|
||
msgstr "Error al destruir el componente"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
||
msgid "Error destroying component of type %s of unit %s:%s%s"
|
||
msgstr "Error al destruir el componente de tipo %s de la unidad %s:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
||
msgid "Error destroying mediator"
|
||
msgstr "Error al destruir el mediador"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
||
msgid "Error destroying mediator %s of unit %s:%s%s"
|
||
msgstr "Error al destruir el mediador %s de la unidad %s:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeerrorreading
|
||
msgid "Error reading %s"
|
||
msgstr "Error al leer %s"
|
||
|
||
#: lazarusidestrconsts.liscfeinfile
|
||
msgid "%sIn file %s%s"
|
||
msgstr "%sEn archivo %s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
||
msgid "Invalid component owner"
|
||
msgstr "Propietario del componente no válido"
|
||
|
||
#: lazarusidestrconsts.liscferoot
|
||
msgid "%sRoot=%s:%s"
|
||
msgstr "%sRaíz=%s:%s"
|
||
|
||
#: lazarusidestrconsts.liscfestopallloading
|
||
msgid "Stop all loading"
|
||
msgstr "Detener todas las cargas"
|
||
|
||
#: lazarusidestrconsts.liscfestream
|
||
msgid "%sStream=%s"
|
||
msgstr "%sStream=%s"
|
||
|
||
#: lazarusidestrconsts.liscfestreamposition
|
||
msgid "%s%sStream position: %s"
|
||
msgstr "%s%sPosición del stream: %s"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
||
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
||
msgstr "TCustomFormEditor.CreateNonFormForm ya existe"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
||
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
||
msgstr "TCustomFormEditor.CreateNonFormForm Tipo desconocido %s"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
||
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
||
msgstr "TCustomFormEditor.DeleteComponent Donde está el TCustomNonFormDesignerForm? %s"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
||
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
||
msgstr "TCustomFormEditor.RegisterDesignerMediator ya registrado: %s"
|
||
|
||
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
||
msgstr "El editor de componentes de la clase \"%s\"ha creado el error:%s\"%s\""
|
||
|
||
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
||
msgid "The component of type %s failed to set its owner to %s:%s"
|
||
msgstr "El componente de tipo %s no ha podido establecer su propietario a %s:%s"
|
||
|
||
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
||
msgid "Unable to clear the form editing selection%s%s"
|
||
msgstr "No se puede borrar la selección de edición del formulario%s%s"
|
||
|
||
#: lazarusidestrconsts.lischange
|
||
msgctxt "lazarusidestrconsts.lischange"
|
||
msgid "Change"
|
||
msgstr "Cambiar"
|
||
|
||
#: lazarusidestrconsts.lischangebuildmode
|
||
msgid "Change build mode"
|
||
msgstr "Cambiar modo de construcción"
|
||
|
||
#: lazarusidestrconsts.lischangeclass
|
||
msgid "Change Class"
|
||
msgstr "Cambiar Clase"
|
||
|
||
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
||
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangeencoding
|
||
msgid "Change Encoding"
|
||
msgstr "Cambiar codificación"
|
||
|
||
#: lazarusidestrconsts.lischangefile
|
||
msgid "Change file"
|
||
msgstr "Modificar archivo"
|
||
|
||
#: lazarusidestrconsts.lischangeparent
|
||
#, fuzzy
|
||
#| msgid "Change Parent..."
|
||
msgid "Change Parent"
|
||
msgstr "Cambiar Padre ..."
|
||
|
||
#: lazarusidestrconsts.lischangeswerenotsaved
|
||
msgid "Changes were not saved"
|
||
msgstr "Los cambios no seran salvados"
|
||
|
||
#: lazarusidestrconsts.lischangetounix
|
||
msgid "Change to Unix /"
|
||
msgstr "Cambio a Unix /"
|
||
|
||
#: lazarusidestrconsts.lischangetowindows
|
||
msgid "Change to Windows \\"
|
||
msgstr "Cambia a Windows \\"
|
||
|
||
#: lazarusidestrconsts.lischaracter
|
||
msgid "Character"
|
||
msgstr "Carácter"
|
||
|
||
#: lazarusidestrconsts.lischaractermap
|
||
msgid "Character Map"
|
||
msgstr "Mapa de caracteres"
|
||
|
||
#: lazarusidestrconsts.lischeckall
|
||
msgid "Check All"
|
||
msgstr "Chequea Todo"
|
||
|
||
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontentratherthantimesta
|
||
msgid "Check for disk file changes via content rather than timestamp"
|
||
msgstr "Compruebe si hay cambios en los archivos del disco a través de contenido en lugar de timestamp"
|
||
|
||
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
||
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
|
||
msgstr "Verificar si el siguiente elemento en el fuente esta al final y si no regresa findelínea + end; + findelínea"
|
||
|
||
#: lazarusidestrconsts.lischeckoptions
|
||
msgid "Check options"
|
||
msgstr "Comprobar opciones"
|
||
|
||
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
||
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
||
msgstr "%s Comprobar el objetivo (SO, CPU, tipo de widget LCL). Tal vez tenga que recompilar el paquete para este objetivo o establecer otro objetivo para el proyecto."
|
||
|
||
#: lazarusidestrconsts.lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr "Escoja un nombre distinto"
|
||
|
||
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
||
msgid "Choose a file with CodeTools templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseafpdoclink
|
||
msgid "Choose a FPDoc link"
|
||
msgstr "Seleccione un enlace FPCDoc"
|
||
|
||
#: lazarusidestrconsts.lischooseakey
|
||
msgid "Choose a key ..."
|
||
msgstr "Seleccione una tecla ..."
|
||
|
||
#: lazarusidestrconsts.lischooseanameforthenewcomponent
|
||
msgid "Choose a name for the new component"
|
||
msgstr "Elija un nombre para el nuevo componente"
|
||
|
||
#: lazarusidestrconsts.lischooseanexamplefile
|
||
msgid "Choose an example file"
|
||
msgstr "Escojer un archivo de ejemplo"
|
||
|
||
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
||
msgid "Choose an FPC message file"
|
||
msgstr "Escoger un archivo de mensaje FPC"
|
||
|
||
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
||
#, fuzzy
|
||
#| msgid "Choose a pascal file for indentation examples"
|
||
msgid "Choose a Pascal file for indentation examples"
|
||
msgstr "Elija un archivo pascal para ejemplos de sangrado"
|
||
|
||
#: lazarusidestrconsts.lischoosecompilermessages
|
||
msgid "Choose compiler messages file"
|
||
msgstr "Elija un archivo de mensajes del compilador"
|
||
|
||
#: lazarusidestrconsts.lischoosecompilerpath
|
||
msgid "Choose compiler filename (%s)"
|
||
msgstr "Escoja nombre del archivo del compilador (%s)"
|
||
|
||
#: lazarusidestrconsts.lischoosedebuggerpath
|
||
msgid "Choose debugger filename"
|
||
msgstr "Escoja nombre del archivo del depurador"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr "Seleccione un paquete Delphi (*.dpk)"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr "Seleccione un proyecto Delphi (*.dpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr "Escoja unidad Delphi (*.pas)"
|
||
|
||
#: lazarusidestrconsts.lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr "Escoja directorio"
|
||
|
||
#: lazarusidestrconsts.lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr "Escoja directorio fuente de FPC"
|
||
|
||
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr "Escoja Directorio de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lischoosemakepath
|
||
msgid "Choose make path"
|
||
msgstr "Escoja ruta de make"
|
||
|
||
#: lazarusidestrconsts.lischoosename
|
||
msgid "Choose name"
|
||
msgstr "Escoja un nombre"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr "Elija uno de estos elementos para crear un nuevo archivo"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr "Elija uno de estos elementos para crear un nuevo Paquete"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr "Elija uno de estos elementos para crear un nuevo Proyecto"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
||
msgid "Choose one of these items to inherit from an existing one"
|
||
msgstr "Seleccione uno de esos elementos para heredar de uno existente"
|
||
|
||
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr "Escoja archivo fuente del programa (*.pp,*.pas,*.lpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr "Elija estructura para encerrar la selección"
|
||
|
||
#: lazarusidestrconsts.lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr "Seleccione el directorio para pruebas"
|
||
|
||
#: lazarusidestrconsts.liscirculardependencydetected
|
||
msgid "Circular dependency detected"
|
||
msgstr "Dependencia circular detectada"
|
||
|
||
#: lazarusidestrconsts.lisclasscompletion
|
||
msgid "Class Completion"
|
||
msgstr "Completado de Clases"
|
||
|
||
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
||
msgid "Classes and properties exist. Values were not checked."
|
||
msgstr "Las clases y propiedades ya existen. Los valores no fueron verificados."
|
||
|
||
#: lazarusidestrconsts.lisclassesppunotfoundcheckyourfpccfg
|
||
msgid "classes.ppu not found. Check your fpc.cfg."
|
||
msgstr "classes.ppu no encontrada. Chequea tu fpc.cfg."
|
||
|
||
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
||
msgstr "La clase %s%s%s no es una clase de componente registrada.%sNo se ha podido pegar."
|
||
|
||
#: lazarusidestrconsts.lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr "Clase no encontrada"
|
||
|
||
#: lazarusidestrconsts.lisclassofmethodnotfound
|
||
msgid "Class %s%s%s of method %s%s%s not found."
|
||
msgstr "La clase %s%s%s del método %s%s%s no fue encontrada."
|
||
|
||
#: lazarusidestrconsts.liscldirclean
|
||
msgid "Clean"
|
||
msgstr "Limpiar"
|
||
|
||
#: lazarusidestrconsts.liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "Limpiar Directorio"
|
||
|
||
#: lazarusidestrconsts.liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "Limpiar subdirectorios"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr "Mantener todos los archivos de texto"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr "Mantener archivos según el criterio indicado"
|
||
|
||
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr "Eliminar archivos según el filtro determinado"
|
||
|
||
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr "sintaxis simple (e.j. * en vez de .*)"
|
||
|
||
#: lazarusidestrconsts.liscleanall
|
||
msgid "Clean all"
|
||
msgstr "Limpiar todo"
|
||
|
||
#: lazarusidestrconsts.liscleancommonfiles
|
||
msgid "Clean common files"
|
||
msgstr "Limpiar archivos comunes"
|
||
|
||
#: lazarusidestrconsts.liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr "Limpiar código fuente de Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscleanonlyonce
|
||
msgid "Switch after building to automatically"
|
||
msgstr "Cambia después de la construcción a automáticamente"
|
||
|
||
#: lazarusidestrconsts.liscleanup
|
||
msgid "Clean up"
|
||
msgstr "Limpiar"
|
||
|
||
#: lazarusidestrconsts.liscleanupandbuild
|
||
msgid "Clean up and build"
|
||
msgstr "Limpiar y construir"
|
||
|
||
#: lazarusidestrconsts.liscleanupandbuildproject
|
||
msgid "Clean up and build project"
|
||
msgstr "Limpiar y construir proyecto"
|
||
|
||
#: lazarusidestrconsts.liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr "¿Limpiar ruta de la unidad?"
|
||
|
||
#: lazarusidestrconsts.lisclear
|
||
msgctxt "lazarusidestrconsts.lisclear"
|
||
msgid "Clear"
|
||
msgstr "Limpiar"
|
||
|
||
#: lazarusidestrconsts.liscleardirectory
|
||
msgid "Clear Directory?"
|
||
msgstr "¿Limpiar Directorio?"
|
||
|
||
#: lazarusidestrconsts.lisclearthefilterforoptions
|
||
msgid "Clear the filter for options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr "Pulse aquí para explorar el archivo"
|
||
|
||
#: lazarusidestrconsts.lisclicktoseethepossibleuses
|
||
msgid "Click to see the possible uses"
|
||
msgstr "Clic para ver los usos posibles"
|
||
|
||
#: lazarusidestrconsts.lisclone
|
||
msgid "Clone"
|
||
msgstr "Clonar"
|
||
|
||
#: lazarusidestrconsts.lisclose
|
||
#, fuzzy
|
||
#| msgid "&Close"
|
||
msgctxt "lazarusidestrconsts.lisclose"
|
||
msgid "Close"
|
||
msgstr "&Cerrar"
|
||
|
||
#: lazarusidestrconsts.liscloseall
|
||
msgctxt "lazarusidestrconsts.liscloseall"
|
||
msgid "Close All"
|
||
msgstr "Cerrar todo"
|
||
|
||
#: lazarusidestrconsts.liscloseallchecked
|
||
msgid "Close All Checked"
|
||
msgstr "Cerrar Todos los Chequeados"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsclose
|
||
msgid "Close files"
|
||
msgstr "Cerrar archivos"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabshide
|
||
msgid "Hide window"
|
||
msgstr "Ocultar ventana"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsquestion
|
||
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
||
msgstr "Cerrando una Ventana del Editor de Código. ¿Quiere cerrar todos los archivos u ocultar la ventana?"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabstitle
|
||
msgid "Close Source Editor Window"
|
||
msgstr "Cerrar Ventana del Editor de Código"
|
||
|
||
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr "Opciones específicas de la interfaz LCL:"
|
||
|
||
#: lazarusidestrconsts.liscmparameter
|
||
msgid "Parameter"
|
||
msgstr "Parámetros"
|
||
|
||
#: lazarusidestrconsts.liscmplstcomponents
|
||
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
||
msgid "Components"
|
||
msgstr "Componentes"
|
||
|
||
#: lazarusidestrconsts.liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr "Herencia"
|
||
|
||
#: lazarusidestrconsts.liscmplstlist
|
||
msgid "List"
|
||
msgstr "Lista"
|
||
|
||
#: lazarusidestrconsts.liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr "Paleta"
|
||
|
||
#: lazarusidestrconsts.liscmppages
|
||
msgid "Pages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmprestoredefaults
|
||
msgid "&Restore defaults"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr "Archivo de configuración adicional del compilador ambiguo"
|
||
|
||
#: lazarusidestrconsts.liscocallon
|
||
msgid "Call on:"
|
||
msgstr "Llamar a:"
|
||
|
||
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
||
#, fuzzy
|
||
#| msgid "%s%sClick OK if you are sure to do that."
|
||
msgid "%s%sClick OK if you definitely want to do that."
|
||
msgstr "%s%s Pulse Aceptar si estás seguro de hacer eso."
|
||
|
||
#: lazarusidestrconsts.liscocommand
|
||
msgctxt "lazarusidestrconsts.liscocommand"
|
||
msgid "Command:"
|
||
msgstr "Comando:"
|
||
|
||
#: lazarusidestrconsts.liscode
|
||
msgid "Code"
|
||
msgstr "Código"
|
||
|
||
#: lazarusidestrconsts.liscodebrowser
|
||
#, fuzzy
|
||
#| msgid "Code browser"
|
||
msgctxt "lazarusidestrconsts.liscodebrowser"
|
||
msgid "Code Browser"
|
||
msgstr "Navegador de Código"
|
||
|
||
#: lazarusidestrconsts.liscodeexplorer
|
||
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorador de Código"
|
||
|
||
#: lazarusidestrconsts.liscodegenerationoptions
|
||
msgid "Code generation options"
|
||
msgstr "Opciones de generación de código"
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "Añadir ruta"
|
||
|
||
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
||
msgid "Browse"
|
||
msgstr "Explorar"
|
||
|
||
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr "Confirmar reemplazar"
|
||
|
||
#: lazarusidestrconsts.liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr "Crear un elemento de ayuda"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "Eliminar ruta"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdescrtag
|
||
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
||
msgid "Description"
|
||
msgstr "Descripción"
|
||
|
||
#: lazarusidestrconsts.liscodehelperrorstag
|
||
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
||
msgid "Errors"
|
||
msgstr "Errores"
|
||
|
||
#: lazarusidestrconsts.liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "Ejemplo"
|
||
|
||
#: lazarusidestrconsts.liscodehelpgroupbox
|
||
msgid "FPDoc settings"
|
||
msgstr "Ajustes FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr "Insertar etiqueta de formateo en negritas"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr "Insertar etiqueta de formato de código"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr "Insertar etiqueta de formato cursiva"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr "Insertar etiqueta de formato de remarcado"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr "Insertar etiqueta de formato subrayado"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr "Insertar etiqueta de formato variable"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinherited
|
||
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
||
msgid "Inherited"
|
||
msgstr "Heredado"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr "Insertar un enlace ..."
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr "Insertar etiqueta de formato de párrafo"
|
||
|
||
#: lazarusidestrconsts.liscodehelpmainformcaption
|
||
#, fuzzy
|
||
#| msgid "FPDoc editor"
|
||
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
||
msgid "FPDoc Editor"
|
||
msgstr "Editor FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
||
msgid "(no inherited description found)"
|
||
msgstr "(no se encontró descripción heredada)"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<NINGUNO>"
|
||
|
||
#: lazarusidestrconsts.liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr "Ver también"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr "Descripción corta de"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr "Corta"
|
||
|
||
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
||
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
||
msgid "Ignore constants in next functions"
|
||
msgstr "Ignorar constantes en las siguientes funciones"
|
||
|
||
#: lazarusidestrconsts.liscodeobscharconst
|
||
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
||
msgid "Search for unnamed char constants"
|
||
msgstr "Buscar constantes char sin nombre"
|
||
|
||
#: lazarusidestrconsts.liscodeobserver
|
||
msgid "Code Observer"
|
||
msgstr "Observador de código"
|
||
|
||
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
||
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
||
msgid "Ignore next unnamed constants"
|
||
msgstr "Ignorar las siguientes constantes sin nombre"
|
||
|
||
#: lazarusidestrconsts.liscodetempladd
|
||
#, fuzzy
|
||
#| msgid "Add"
|
||
msgctxt "lazarusidestrconsts.liscodetempladd"
|
||
msgid "Add template"
|
||
msgstr "Añadir plantilla"
|
||
|
||
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "Añadir plantilla de código"
|
||
|
||
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
||
msgid " A token %s%s%s already exists! "
|
||
msgstr "¡Ya existe un token %s%s%s! "
|
||
|
||
#: lazarusidestrconsts.liscodetemplautocompleteon
|
||
#, fuzzy
|
||
#| msgid "Auto complete on ..."
|
||
msgid "Auto complete on"
|
||
msgstr "Autocompletar en"
|
||
|
||
#: lazarusidestrconsts.liscodetemplchange
|
||
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
||
msgid "Change"
|
||
msgstr "Cambiar"
|
||
|
||
#: lazarusidestrconsts.liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "Comentar:"
|
||
|
||
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr "Editar plantilla de código"
|
||
|
||
#: lazarusidestrconsts.liscodetemplerror
|
||
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
||
msgid "Error"
|
||
msgstr "Error"
|
||
|
||
#: lazarusidestrconsts.liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr "Token:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "Acción: %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
||
#, fuzzy
|
||
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
||
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
||
msgstr "Los nodos creados automáticamente no se pueden editar,%saunque no tengan nodos hijos que no hayan sido creados automáticamente."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "%s, autogenerado"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
||
#, fuzzy
|
||
#| msgid "Auto generated nodes can not be edited."
|
||
msgid "Auto generated nodes cannot be edited."
|
||
msgstr "Los nodos generados automáticamente no pueden editarse."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "Bloquear"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr "Editor de Defines de CodeTools"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
||
#, fuzzy
|
||
#| msgid "compiler path"
|
||
msgid "Compiler path"
|
||
msgstr "Ruta del compilador"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "Convertir nodo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr "Crear Defines para %s el directorio"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr "Crear Defines para el Compilador de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr "Crear Defines para las fuentes SVN de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr "Crear Defines para el Proyecto %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr "Crear Macros FPC y rutas para un directorio de proyecto de fpc"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr "Define"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr "Define Recursivo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "Borrar nodo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "El %s directorio principal,%s donde Borland ha instalado todos %s los fuentes.%sPor ejemplo: c:/Archivos de Programa/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "El %s directorio principal,%s donde Borland ha instalado todos %s los fuentes,%sque son usados por este %s proyecto.%sPor ejemplo: c:/Archivos de Programa/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr "Descripción:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "%s directorio"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr "Else"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr "ElseIf"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr "Salir sin Guardar"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr "Directorios de las fuentes SVN de FPC"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr "If"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr "IfNDef"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr "Directorio"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr "Insertar Plantilla de Compilador de Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr "Insertar Plantilla de Directorio de Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr "Insertar Plantilla de Proyecto de Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr "Insertar Plantilla de Compilador de Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr "Insertar Plantilla de Directorio de Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Insertar Plantilla de Proyecto de Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr "Insertar Plantilla de Compilador de Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr "Insertar Plantilla de Directorio de Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr "Insertar Plantilla de Proyecto de Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr "Insertar Plantilla de Compilador de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr "Insertar Plantilla de Proyecto Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr "Insertar plantilla de código de SVN de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr "Insertar Plantilla de Compilador de Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr "Insertar Plantilla de Directorio de Kylix3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr "Insertar Plantilla de Proyecto de Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr "Insertar nodo como hijo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr "Insertar nodo debajo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr "Insertar Plantilla"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr "Padre no válido"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr "Nodo padre no válido"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr "Nodo previo no válido"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr "El %s directorio principal,%s donde Borland ha instalado todos %s los fuentes.%sPor ejemplo: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr "El %s directorio principal,%sdonde Borland ha instalado todos %s los fuentes,%sque son usados por este %s proyecto.%sPor ejemplo: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr "Mover nodo abajo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr "Mover nodo un nivel abajo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr "Mover nodo un nivel arriba"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr "Mover nodo arriba"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsname
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
||
msgid "Name:"
|
||
msgstr "Nombre:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr "Nuevo Nodo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr "El nodo es de sólo-lectura"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "nada seleccionado"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
||
#, fuzzy
|
||
#| msgid "Parent node can not contain child nodes."
|
||
msgid "Parent node cannot contain child nodes."
|
||
msgstr "El nodo padre no puede contener nodos hijo."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr "El nodo previo no puede contener nodos hijo."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Directorio del proyecto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "%s directorio de proyecto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr "Error de lectura"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr "Guardar y salir"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "Seleccionar Nodo:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
#, fuzzy
|
||
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
|
||
msgstr "El directorio de fuentes SVN de Free PAscal. No requerido. Esto mejorará la depuración y la posibilidad de encontrar declaraciónes."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr "Directorio de proyecto de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr "El directorio SVN de fuentes de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
#, fuzzy
|
||
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr "La ruta al compilador Free Pascal.%s Por ejemplo %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
#, fuzzy
|
||
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr "La ruta al compilador Free Pascal para este proyecto. Sólo es necesario si activa fuente FPC SVN abajo. Se usa para autocrear macros."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
||
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
||
msgstr "El path para el compilador Free Pascal para esta fuente.%sUtilizado para autocrear macros."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr "El %s directorio de proyecto,%sque contiene el archivo .dpr, dpk"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr "Undefine"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr "Undefine Todo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr "Undefine Recursivo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr "Valor como Rutas de Archivo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr "Valor como texto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
||
msgid "%s:%svalue \"%s\" is invalid."
|
||
msgstr "%s:%svalor \"%s\" es invalido."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr "Variable:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr "Error de escritura"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "En"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
||
msgid "Bracket"
|
||
msgstr "Paréntesis"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr "Dos puntos"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr "Coma"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Identificador"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr "Palabra Clave"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr "Nueva línea"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnone
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
||
msgid "None"
|
||
msgstr "Nada"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr "Número"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr "Punto"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr "Punto y coma"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsspace
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
||
msgid "Space"
|
||
msgstr "Espacio"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr "Constante de cadena"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr "Símbolo"
|
||
|
||
#: lazarusidestrconsts.liscodetoolstemplatefile
|
||
msgid "CodeTools template file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr "Ejecutar después de"
|
||
|
||
#: lazarusidestrconsts.liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr "Ejecutar antes de"
|
||
|
||
#: lazarusidestrconsts.liscoladdress
|
||
msgid "Address"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscolclass
|
||
msgid "Class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscollapseall
|
||
msgid "Collapse All (/)"
|
||
msgstr "Colapsar Todo (/)"
|
||
|
||
#: lazarusidestrconsts.liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr "Colapsar todas las clases"
|
||
|
||
#: lazarusidestrconsts.liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr "Colapsar todos los paquetes"
|
||
|
||
#: lazarusidestrconsts.liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr "Colapsar todas las unidades"
|
||
|
||
#: lazarusidestrconsts.liscolreturns
|
||
msgid "Returns"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscolvisibility
|
||
msgid "Visibility"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscommandafter
|
||
msgid "Command after"
|
||
msgstr "Comando después"
|
||
|
||
#: lazarusidestrconsts.liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr "Comando después de inválido"
|
||
|
||
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr "Comando después de módulo de publicación"
|
||
|
||
#: lazarusidestrconsts.liscommandlineparameters
|
||
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
||
msgid "Command line parameters"
|
||
msgstr "Parámetros de la línea de comando"
|
||
|
||
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr "Parámetros de la línea de comandos del programa"
|
||
|
||
#: lazarusidestrconsts.liscompile
|
||
msgctxt "lazarusidestrconsts.liscompile"
|
||
msgid "Compile"
|
||
msgstr "Compilar"
|
||
|
||
#: lazarusidestrconsts.liscompiler
|
||
msgid "Compiler"
|
||
msgstr "Compilador"
|
||
|
||
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
||
msgid "Compiler \"%s\" does not support target %s-%s"
|
||
msgstr "El compilador \"%s\" no soporta el objetivo %s-%s"
|
||
|
||
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr "Error: compilador no válido: %s"
|
||
|
||
#: lazarusidestrconsts.liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr "Nombre de archivo del compilador"
|
||
|
||
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
||
#, fuzzy
|
||
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
||
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
||
msgstr "Sugerencia: puede establecer la ruta del compilador en Herramientas -> Opciones-> Archivos -> Ruta del compilador"
|
||
|
||
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr "NOTA: No se ha encontrado el archivo de configuración de las CodeTools - usando valores predeterminados"
|
||
|
||
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr "NOTA: Cargando archivo antiguo de opciones de CodeTools: "
|
||
|
||
#: lazarusidestrconsts.liscompilestage
|
||
msgctxt "lazarusidestrconsts.liscompilestage"
|
||
msgid "Compile"
|
||
msgstr "Compilar"
|
||
|
||
#: lazarusidestrconsts.liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%s (compilando ...)"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
||
msgid "Show long line hints"
|
||
msgstr "Mostrar descripciones largas"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
||
msgid "Extend far left"
|
||
msgstr "Extender mucho a la izquierda"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
||
msgid "Extend some left"
|
||
msgstr "Extender un poco a la izquierda"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
||
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
||
msgid "Never"
|
||
msgstr "Nunca"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
||
msgid "Extend right only"
|
||
msgstr "Extender unicamente a la derecha"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
||
#, fuzzy
|
||
#| msgid "Component name \"%s\" is a pascal keyword."
|
||
msgid "Component name \"%s\" is a Pascal keyword."
|
||
msgstr "El nombre del componente \"%s\" es una palabra clave pascal"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameiskeyword
|
||
msgid "Component name %s%s%s is keyword"
|
||
msgstr "El nombre del componente %s%s%s es una palabra"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
||
msgid "Component name %s%s%s is not a valid identifier"
|
||
msgstr "El nombre del Componente %s%s%s no es un identificador válido"
|
||
|
||
#: lazarusidestrconsts.liscomppalcomponentlist
|
||
msgid "View All"
|
||
msgstr "Ver Todos"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr "Abrir paquete"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr "Abrir unidad"
|
||
|
||
#: lazarusidestrconsts.liscomptest
|
||
#| msgid "Test"
|
||
msgctxt "lazarusidestrconsts.liscomptest"
|
||
msgid "&Test"
|
||
msgstr "&Probar"
|
||
|
||
#: lazarusidestrconsts.liscondition
|
||
msgid "Condition"
|
||
msgstr "Condición"
|
||
|
||
#: lazarusidestrconsts.lisconditionals
|
||
#, fuzzy
|
||
#| msgid "Conditionals:"
|
||
msgctxt "lazarusidestrconsts.lisconditionals"
|
||
msgid "Conditionals"
|
||
msgstr "Condicionales"
|
||
|
||
#: lazarusidestrconsts.lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr "Directorio de configuración de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuild
|
||
msgid "Configure Build %s"
|
||
msgstr "Configurar Construcción %s"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
||
msgid "Configure %sBuild Lazarus%s"
|
||
msgstr "Configurar %sConstruir Lazarus%s"
|
||
|
||
#: lazarusidestrconsts.lisconfigurelazaruside
|
||
msgid "Configure Lazarus IDE"
|
||
msgstr "Configurar IDE Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisconfirm
|
||
msgid "Confirm"
|
||
msgstr "Confirmar"
|
||
|
||
#: lazarusidestrconsts.lisconfirmation
|
||
msgid "Confirmation"
|
||
msgstr "Confirmación"
|
||
|
||
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
||
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
||
msgstr "Lazarus será reconstruido con los perfiles siguientes:%s¿Continuar?"
|
||
|
||
#: lazarusidestrconsts.lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr "Confirmar cambios"
|
||
|
||
#: lazarusidestrconsts.lisconfirmdelete
|
||
msgid "Confirm delete"
|
||
msgstr "Confirmar eliminación"
|
||
|
||
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
||
#, fuzzy
|
||
#| msgid "Do you want to rebuild Lazarus with profile: %s ?"
|
||
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
||
msgstr "¿Quiere reconstruir Lazarus con el perfil: %s ?"
|
||
|
||
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr "Confirmar nuevo conjunto de paquetes para el IDE"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageaction
|
||
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
||
msgid "Action"
|
||
msgstr "Acción"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
||
msgid "New package set"
|
||
msgstr "Conjunto de paquetes nuevo"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
||
msgid "Old package set"
|
||
msgstr "Conjunto de paquetes antiguo"
|
||
|
||
#: lazarusidestrconsts.lisconflict
|
||
msgid "Conflict"
|
||
msgstr "Conflicto"
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr "Aplicación de consola"
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
||
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
||
msgstr "Un programa de linea de comando de Free Pascal utilizando TCustomApplication para comprobar fácilmente las opciones de línea de comandos, control de excepciones, etc."
|
||
|
||
#: lazarusidestrconsts.lisconstructorcode
|
||
msgid "Constructor code"
|
||
msgstr "Código de Constructor"
|
||
|
||
#: lazarusidestrconsts.liscontains
|
||
msgid "contains"
|
||
msgstr "contiene"
|
||
|
||
#: lazarusidestrconsts.liscontextsensitive
|
||
msgid "Context sensitive"
|
||
msgstr "Sensible al contexto"
|
||
|
||
#: lazarusidestrconsts.liscontinue
|
||
msgctxt "lazarusidestrconsts.liscontinue"
|
||
msgid "Continue"
|
||
msgstr "Continuar"
|
||
|
||
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
||
msgid "Continue and do not ask again"
|
||
msgstr "Continuar y no volver a preguntar"
|
||
|
||
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr "Continuar sin cargar el formulario"
|
||
|
||
#: lazarusidestrconsts.liscontributors
|
||
msgid "Contributors"
|
||
msgstr "Colaboradores"
|
||
|
||
#: lazarusidestrconsts.liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr "El control necesita un padre"
|
||
|
||
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
||
msgid "Add comment after replacement"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvcoordhint
|
||
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
||
msgstr "Un desplazamiento es añadido a la coordenada superior de los controles dentro de los contenedores visuales"
|
||
|
||
#: lazarusidestrconsts.lisconvcoordoffs
|
||
msgid "Coordinate offsets"
|
||
msgstr "Coordinar desplazamientos"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
||
msgid "Added defines %s in custom options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
||
msgid "Added Package %s as a dependency."
|
||
msgstr "Añadido paquete %s como una dependencia."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
||
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
||
msgid "All sub-directories will be scanned for unit files"
|
||
msgstr "Todos los subdirectorios serán escaneados buscando archivos de unidades"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
||
msgid "BeginCodeTools failed!"
|
||
msgstr "¡BeginCodeTools falló!"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphicategories
|
||
msgid "Categories:"
|
||
msgstr "Categorias:"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
||
msgid "Changed encoding from %s to UTF-8"
|
||
msgstr "Cambiada la codificación para %s a UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
||
msgid "Conversion Aborted."
|
||
msgstr "Conversión Abortada."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversionready
|
||
msgid "Conversion Ready."
|
||
msgstr "Conversion Preparada."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
||
msgid "Conversion took: %s"
|
||
msgstr "Conversión tuvo: %s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
||
msgid "Convert Delphi package"
|
||
msgstr "Convertir paquete de Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
||
msgid "Convert Delphi project"
|
||
msgstr "Convertir proyecto de Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
||
msgid "Convert Delphi unit"
|
||
msgstr "Convertir unidad de Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingfile
|
||
msgid "* Converting file %s *"
|
||
msgstr "* Convirtiendo archivo %s *"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
||
msgid "*** Converting unit files found during conversion ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
||
msgid "*** Converting unit files belonging to project/package ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphierror
|
||
msgid "Error=\"%s\""
|
||
msgstr "Error=\"%s\""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
||
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
||
msgid "Failed converting unit"
|
||
msgstr "Falló convirtiendo unidad"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
||
msgid "Failed to convert unit%s%s%s"
|
||
msgstr "Falló convirtiendo unidad%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
||
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
||
msgstr "Arregladas las mayúsculas o minúsculas de la unidad \"%s\" a \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifixingusedunits
|
||
msgid "* Fixing used units for file %s *"
|
||
msgstr "* Arreglando las unidades usadas para el archivo %s *"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
||
msgid "Found all unit files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifunc
|
||
msgid "Delphi Function"
|
||
msgstr "Función Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
||
msgid "%s(%s,%s) missing include file"
|
||
msgstr "%s(%s,%s) archivo de inclusión no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiname
|
||
msgid "Delphi Name"
|
||
msgstr "Nombre Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
||
msgid "Package name exists"
|
||
msgstr "El nombre del paquete existe"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
||
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
||
msgstr "Paquete %s es necesario pero no esta instalado en Lazarus! Instalarlo más tarde."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
||
msgid "Omitted unit %s from project"
|
||
msgstr "Se omite la unidad %s del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
|
||
msgid "Removed unit \"%s\" in uses section."
|
||
msgstr "Eliminada unidad \"%s\" de la sección uses."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphirepairingformfile
|
||
#| msgid "Repairing form file %s"
|
||
msgid "* Repairing form file %s *"
|
||
msgstr "* Reparando archivo de formulario %s *"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
||
#, fuzzy
|
||
#| msgid "*** Repairing form files ... ***"
|
||
msgid "*** Fixing used units and Repairing form files ***"
|
||
msgstr "*** Reparando archivos de formularios ... ***"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
||
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
||
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
||
msgstr "Reemplazada unidad \"%s\" con \"%s\" en sección 'uses'."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
||
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
||
msgstr "Ya existe un paquete con el nombre \"%s\"%sPor favor, cierre este paquete primero."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
||
msgid "Unitname exists in LCL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
||
msgid "Units to replace in %s"
|
||
msgstr "Unidades para reemplazar en %s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
||
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr "Error de conversión"
|
||
|
||
#: lazarusidestrconsts.lisconvert
|
||
msgid "Convert"
|
||
msgstr "Convertir"
|
||
|
||
#: lazarusidestrconsts.lisconvertencoding
|
||
#, fuzzy
|
||
#| msgid "Convert encoding"
|
||
msgid "Convert Encoding"
|
||
msgstr "Convertir Codificación de Página"
|
||
|
||
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
||
msgid "Convert encoding of projects/packages"
|
||
msgstr "Convertir codificación de página de proyectos/paquetes"
|
||
|
||
#: lazarusidestrconsts.lisconvertprojectorpackage
|
||
msgid "Convert project or package"
|
||
msgstr "Convertir proyecto o paquete"
|
||
|
||
#: lazarusidestrconsts.lisconverttarget
|
||
msgid "Target"
|
||
msgstr "Objetivo"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
||
msgid "Cross-platform"
|
||
msgstr "Multiplataforma"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
||
msgid "Cross-platform versus Windows-only"
|
||
msgstr "Multiplataforma contra Solo-Windows"
|
||
|
||
#: lazarusidestrconsts.lisconverttargethint
|
||
msgid "Converter adds conditional compilation to support different targets"
|
||
msgstr "El convertidor añade compilación condicional para soportar diferentes objetivos"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
||
msgid "Use the same DFM form file"
|
||
msgstr "Usar el mismo archivo de formulario DFM"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
||
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
||
msgstr "Mismo archivo DMF para Lazarus y Delphi en lugar de copiarlo a LFM"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
||
msgid "Support Delphi"
|
||
msgstr "Soportar Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
||
msgid "Use conditional compilation to support Delphi"
|
||
msgstr "Usar compilación condicional para soportar Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvfuncreplacements
|
||
msgid "Function Replacements"
|
||
msgstr "Reemplazo de Funciones"
|
||
|
||
#: lazarusidestrconsts.lisconvfuncreplhint
|
||
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
||
msgid "Some Delphi functions can be replaced with LCL function"
|
||
msgstr "Algunas funciones Delphi pueden ser sustituidas por funciones del LCL"
|
||
|
||
#: lazarusidestrconsts.lisconvfuncstoreplace
|
||
msgid "Functions / procedures to replace"
|
||
msgstr "Funciones / procedimientos a reemplazar"
|
||
|
||
#: lazarusidestrconsts.lisconvleftoff
|
||
msgid "Left offset"
|
||
msgstr "Desplazamiento a la izquierda"
|
||
|
||
#: lazarusidestrconsts.lisconvnewname
|
||
msgid "New Name"
|
||
msgstr "Nombre Nuevo"
|
||
|
||
#: lazarusidestrconsts.lisconvparentcontainer
|
||
msgid "Parent Container"
|
||
msgstr "Contenedor Primario"
|
||
|
||
#: lazarusidestrconsts.lisconvtopoff
|
||
msgid "Top offset"
|
||
msgstr "Desplazamiento superior"
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplacements
|
||
msgid "Type Replacements"
|
||
msgstr "Reemplazo de Tipos"
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplhint
|
||
msgid "Unknown types in form file (DFM/LFM)"
|
||
msgstr "Tipos desconocidos en el archivo del formulario (DFM/LFM)"
|
||
|
||
#: lazarusidestrconsts.lisconvtypestoreplace
|
||
msgid "Types to replace"
|
||
msgstr "Tipos a reemplazar"
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplacements
|
||
msgid "Unit Replacements"
|
||
msgstr "Reemplazo de Unidades"
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplhint
|
||
msgid "Unit names in uses section of a source unit"
|
||
msgstr "Nombres de unidad en la sección uses de la unidad fuente"
|
||
|
||
#: lazarusidestrconsts.lisconvunitstoreplace
|
||
msgid "Units to replace"
|
||
msgstr "Unidades a reemplazar"
|
||
|
||
#: lazarusidestrconsts.lisconvunknownprops
|
||
msgid "Unknown properties"
|
||
msgstr "Propiedades desconocidas"
|
||
|
||
#: lazarusidestrconsts.liscopy
|
||
msgctxt "lazarusidestrconsts.liscopy"
|
||
msgid "Copy"
|
||
msgstr "Copiar"
|
||
|
||
#: lazarusidestrconsts.liscopyall
|
||
msgid "Copy All"
|
||
msgstr "Copiar Todo"
|
||
|
||
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy all items to clipboard"
|
||
msgid "Copy All Items to Clipboard"
|
||
msgstr "Copiar Todos los Elementos al Portapapeles "
|
||
|
||
#: lazarusidestrconsts.liscopyalloutputclipboard
|
||
msgid "Copy all output to clipboard"
|
||
msgstr "Copiar toda la salida al portapapeles"
|
||
|
||
#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy all shown and hidden messages to clipboard"
|
||
msgid "Copy All Shown and Hidden Messages to Clipboard"
|
||
msgstr "Copiar Todos los Mensajes Mostrados y Ocultos al Portapapeles"
|
||
|
||
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy all shown messages to clipboard"
|
||
msgid "Copy All Shown Messages to Clipboard"
|
||
msgstr "Copiar Todos los Mensajes Mostrados al Portapapeles"
|
||
|
||
#: lazarusidestrconsts.liscopydescription
|
||
msgid "Copy description to clipboard"
|
||
msgstr "Copiar descripción al portapapeles"
|
||
|
||
#: lazarusidestrconsts.liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr "Error de Copia"
|
||
|
||
#: lazarusidestrconsts.liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "Copiar error"
|
||
|
||
#: lazarusidestrconsts.liscopyidentifier
|
||
msgid "Copy %s%s%s to clipboard"
|
||
msgstr "Copiar %s%s%s al portapapeles"
|
||
|
||
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr "Copiar un formulario completo no está implementado."
|
||
|
||
#: lazarusidestrconsts.liscopyitemtoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy item to clipboard"
|
||
msgid "Copy Item to Clipboard"
|
||
msgstr "Copiar elemento al Portapapeles"
|
||
|
||
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy selected items to clipboard"
|
||
msgid "Copy Selected Items to Clipboard"
|
||
msgstr "Copiar los elementos seleccionados al Portapapeles"
|
||
|
||
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy selected messages to clipboard"
|
||
msgid "Copy Selected Messages to Clipboard"
|
||
msgstr "Copiar Mensajes Seleccionados al Portapapeles"
|
||
|
||
#: lazarusidestrconsts.liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr "Escanear mensajes FPC"
|
||
|
||
#: lazarusidestrconsts.liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr "Escanear mensajes de Make"
|
||
|
||
#: lazarusidestrconsts.liscoscanformessages
|
||
msgid "Scan for messages:"
|
||
msgstr "Analizar en busca de mensajes:"
|
||
|
||
#: lazarusidestrconsts.liscoskipcallingcompiler
|
||
#, fuzzy
|
||
#| msgid "Skip calling Compiler"
|
||
msgid "Skip calling compiler"
|
||
msgstr "Saltar llamada de compilador"
|
||
|
||
#: lazarusidestrconsts.liscouldnotadditomainsource
|
||
msgid "Could not add %s{$I %s%s} to main source!"
|
||
msgstr "¡No se pudo añadir %s{$I %s%s} al código principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
||
msgid "Could not add %s{$R %s%s} to main source!"
|
||
msgstr "¡No se pudo añadir %s{$R %s%s} al código principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
||
msgid "Could not add %s%s%s to main source!"
|
||
msgstr "¡No se pudo añadir %s%s%s al código principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
||
msgid "Could not remove %s%s%s from main source!"
|
||
msgstr "¡No se pudo eliminar %s%s%s del código principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
||
msgid "Could not remove %s{$I %s%s} from main source!"
|
||
msgstr "¡No se pudo eliminar %s{$I %s%s} del código principal!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
||
msgid "Could not remove %s{$R %s%s} from main source!"
|
||
msgstr "¡No se pudo eliminar %s{$R %s%s} del código principal!"
|
||
|
||
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
#, fuzzy
|
||
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr "Advertencia: El archivo de configuración adicional de compilador tiene el mismo nombre que uno de los estándar que el compilador FreePascal está buscando. Esto puede provocar que SÓLO se interprete el archivo adicional de configuración y se ignore la configuración estándar."
|
||
|
||
#: lazarusidestrconsts.liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr "Abrir paquete %s"
|
||
|
||
#: lazarusidestrconsts.liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr "Abrir unidad %s"
|
||
|
||
#: lazarusidestrconsts.liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr "¡Cree un proyecto primero!"
|
||
|
||
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
||
msgid "Create Debug and Release modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatedirectory
|
||
msgid "Create directory?"
|
||
msgstr "¿Crear directorio?"
|
||
|
||
#: lazarusidestrconsts.liscreatefunction
|
||
msgid "Create function"
|
||
msgstr "Crear función"
|
||
|
||
#: lazarusidestrconsts.liscreatehelpnode
|
||
msgid "Create Help node"
|
||
msgstr "Crear nodo de Ayuda"
|
||
|
||
#: lazarusidestrconsts.liscreateit
|
||
msgid "Create it"
|
||
msgstr "Crearlo"
|
||
|
||
#: lazarusidestrconsts.liscreatenewpackage
|
||
msgid "(Create new package)"
|
||
msgstr "(Crear nuevo paquete)"
|
||
|
||
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
||
msgid "Create new package component"
|
||
msgstr "Crear nuevo componente paquete"
|
||
|
||
#: lazarusidestrconsts.liscreateproject
|
||
msgid "Create project"
|
||
msgstr "Crear proyecto"
|
||
|
||
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
||
msgid "Create/update .po file when saving a lfm file"
|
||
msgstr "Crear/actualizar archivo .po cuando se guarde un archivo .lfm"
|
||
|
||
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
||
msgid "Creating file index of FPC sources %s ..."
|
||
msgstr "Creando un índice de las fuentes FPC %s ..."
|
||
|
||
#: lazarusidestrconsts.liscsbottom
|
||
msgctxt "lazarusidestrconsts.liscsbottom"
|
||
msgid "Bottom"
|
||
msgstr "Abajo"
|
||
|
||
#: lazarusidestrconsts.liscstop
|
||
msgctxt "lazarusidestrconsts.liscstop"
|
||
msgid "Top"
|
||
msgstr "Arriba"
|
||
|
||
#: lazarusidestrconsts.lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr "Escoja Directorio"
|
||
|
||
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr "Directorio de valores de CodeTools"
|
||
|
||
#: lazarusidestrconsts.lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr "Plantillas de Defines"
|
||
|
||
#: lazarusidestrconsts.lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<no se ha seleccionado una variable>"
|
||
|
||
#: lazarusidestrconsts.lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr "Abrir vista previa"
|
||
|
||
#: lazarusidestrconsts.lisctdefstools
|
||
msgid "Tools"
|
||
msgstr "Herramientas"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr "Variable: %s"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr "Nombre de Variable"
|
||
|
||
#: lazarusidestrconsts.lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr "Plantillas"
|
||
|
||
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
||
msgid "Update all method signatures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
||
msgid "Update multiple procedure signatures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr "por favor, elija una macro"
|
||
|
||
#: lazarusidestrconsts.lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr "Seleccionar código de macro"
|
||
|
||
#: lazarusidestrconsts.liscurrent
|
||
msgctxt "lazarusidestrconsts.liscurrent"
|
||
msgid "Current"
|
||
msgstr "Actual"
|
||
|
||
#: lazarusidestrconsts.liscurrentstate
|
||
msgid "Current state: "
|
||
msgstr "Estado actual: "
|
||
|
||
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr "Columna del cursor en el editor actual"
|
||
|
||
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr "Línea del cursor en el editor actual"
|
||
|
||
#: lazarusidestrconsts.liscustomopthint
|
||
#, fuzzy
|
||
#| msgid "These options are passed directly to the compiler. Macros are replaced, line breaks are replaced with single spaces."
|
||
msgid "These options are passed to the compiler after comments are deleted and macros are replaced."
|
||
msgstr "Estas opciones se pasan directamente al compilador. Las macros son reemplazadas, los saltos de línea se sustituyen por espacios."
|
||
|
||
#: lazarusidestrconsts.liscustomoptions
|
||
msgid "custom options"
|
||
msgstr "opciones personalizadas"
|
||
|
||
#: lazarusidestrconsts.liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr "Opciones personalizadas"
|
||
|
||
#: lazarusidestrconsts.liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr "Programa personalizado"
|
||
|
||
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
||
msgid "A Custom Free Pascal program."
|
||
msgstr "Un programa personalizado Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscut
|
||
msgctxt "lazarusidestrconsts.liscut"
|
||
msgid "Cut"
|
||
msgstr "Cortar"
|
||
|
||
#: lazarusidestrconsts.lisdadattach
|
||
msgid "Attach"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdadimagename
|
||
msgid "Image Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdadpid
|
||
msgid "PID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdadrunningprocesses
|
||
msgid "Running Processes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdatamodule
|
||
msgid "Data Module"
|
||
msgstr "Módulo de Datos"
|
||
|
||
#: lazarusidestrconsts.lisdate
|
||
msgid "Date"
|
||
msgstr "Fecha"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdelete
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
|
||
msgid "Delete all"
|
||
msgstr "Borrar todos"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdeletehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
|
||
msgid "Delete all"
|
||
msgstr "Borrar todos"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdisable
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
|
||
msgid "Disable all"
|
||
msgstr "Desactivar todos"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdisablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
|
||
msgid "Disable all"
|
||
msgstr "Desactivar todos"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemenable
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
|
||
msgid "Enable all"
|
||
msgstr "Activar todos"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemenablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
|
||
msgid "Enable all"
|
||
msgstr "Activar todos"
|
||
|
||
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy to clipboard"
|
||
msgid "Copy to Clipboard"
|
||
msgstr "Copiar al Portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
|
||
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
|
||
msgid "Breakpoint Properties ..."
|
||
msgstr "Propiedades de Punto de interrupción ..."
|
||
|
||
#: lazarusidestrconsts.lisdbgemexpression
|
||
msgid "&Expression:"
|
||
msgstr "&Expresión:"
|
||
|
||
#: lazarusidestrconsts.lisdbgemnewvalue
|
||
msgid "&New value:"
|
||
msgstr "&Nuevo valor:"
|
||
|
||
#: lazarusidestrconsts.lisdbgemresult
|
||
msgid "&Result:"
|
||
msgstr "&Resultado:"
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
||
msgid "Breakpoint Evaluation"
|
||
msgstr "Evaluación de Punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
||
msgid "Breakpoint Hit"
|
||
msgstr "Salto(Hit) de Punto de interrupción "
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
||
msgid "Breakpoint Message"
|
||
msgstr "Mensaje de Punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
||
msgid "Breakpoint Stack Dump"
|
||
msgstr "Volcado de Pila(stack) de Punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.lisdbgendefaultcolor
|
||
msgid "Default Color"
|
||
msgstr "Color por defecto"
|
||
|
||
#: lazarusidestrconsts.lisdbgenexceptionraised
|
||
msgid "Exception Raised"
|
||
msgstr "Excepcción Lanzada"
|
||
|
||
#: lazarusidestrconsts.lisdbgenmoduleload
|
||
msgid "Module Load"
|
||
msgstr "Carga Modulo"
|
||
|
||
#: lazarusidestrconsts.lisdbgenmoduleunload
|
||
msgid "Module Unload"
|
||
msgstr "Descarga Modulo"
|
||
|
||
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
||
msgid "Output Debug String"
|
||
msgstr "Salida de cadena de depuración"
|
||
|
||
#: lazarusidestrconsts.lisdbgenprocessexit
|
||
msgid "Process Exit"
|
||
msgstr "Salida Proceso"
|
||
|
||
#: lazarusidestrconsts.lisdbgenprocessstart
|
||
msgid "Process Start"
|
||
msgstr "Comienzo Proceso"
|
||
|
||
#: lazarusidestrconsts.lisdbgenthreadexit
|
||
msgid "Thread Exit"
|
||
msgstr "Salida Hilo(Thread)"
|
||
|
||
#: lazarusidestrconsts.lisdbgenthreadstart
|
||
msgid "Thread Start"
|
||
msgstr "Comienzo Hilo(Thread)"
|
||
|
||
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
||
msgid "Windows Message Posted"
|
||
msgstr "Mensajes de ventana publicado"
|
||
|
||
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
||
msgid "Windows Message Sent"
|
||
msgstr "Mensajes de ventana enviado"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdeletehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
||
msgid "Delete"
|
||
msgstr "Borrar"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdisable
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
|
||
msgid "Disable"
|
||
msgstr "Desactivar"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdisablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
|
||
msgid "Disable"
|
||
msgstr "Desactivar"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemenable
|
||
msgctxt "lazarusidestrconsts.lisdbgitemenable"
|
||
msgid "Enable"
|
||
msgstr "Activar"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemenablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
|
||
msgid "Enable"
|
||
msgstr "Activar"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "No se ha especificado un depurador"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr "Establecer el punto de interrupción de todas maneras"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
#, fuzzy
|
||
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
||
msgstr "No se ha especificado un depurador.%sEstablecer puntos de interrupción no tendrá efecto hasta que defina un depurador en el diálogo de opciones del depurador en el menú."
|
||
|
||
#: lazarusidestrconsts.lisdbgwinpower
|
||
msgid "On/Off"
|
||
msgstr "Encendido/Apagado"
|
||
|
||
#: lazarusidestrconsts.lisdbgwinpowerhint
|
||
msgid "Disable/Enable updates for the entire window"
|
||
msgstr "Desactivar/Activar actualiza toda la ventana"
|
||
|
||
#: lazarusidestrconsts.lisdebugger
|
||
msgctxt "lazarusidestrconsts.lisdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr "Error del Depurador%sUuups, el depurador entró en el estado de error%s¡Guarda tu trabajo ahora!%sPulsa Stop y espera lo mejor."
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackerror
|
||
msgid "Debugger Error"
|
||
msgstr "Error de Depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
|
||
msgid "Debugger Information"
|
||
msgstr "Información de Depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
|
||
msgid "Debugger Warning"
|
||
msgstr "Advertencia de Depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr "Depurador no válido"
|
||
|
||
#: lazarusidestrconsts.lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%s (depurando ...)"
|
||
|
||
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
||
#, fuzzy
|
||
#| msgid "Automatic type-cast for objects"
|
||
msgid "Automatic typecast for objects"
|
||
msgstr "Automática conversión de tipos para los objetos"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
||
msgid "Add Exception"
|
||
msgstr "Agregar Excepción"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr "Ruta adicional de búsqueda"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr "Punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr "Limpiar log en la ejecución"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr "Opciones generales del depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr "Opciones específicas del depurador (depende del tipo de depurador)"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
||
msgid "Duplicate Exception name"
|
||
msgstr "Nombre de Excepción duplicado"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
||
msgid "Enter the name of the exception"
|
||
msgstr "Introducir el nombre de la Excepción"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
||
msgid "Event Log"
|
||
msgstr "Log de eventos"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr "Gestionado por"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr "Gestionado por el depurador"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr "Gestionado por programa"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr "Ignorar estas extensiones"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr "Excepciones del lenguaje"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
||
#, fuzzy
|
||
#| msgid "Limit linecount to"
|
||
msgid "Limit line count to"
|
||
msgstr "Limitar contador de líneas a"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
||
msgid "Module"
|
||
msgstr "Módulo"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
||
msgid "Notify on Lazarus Exceptions"
|
||
msgstr "Notificar en excepciones de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr "Excepciones del Sistema Operativo"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr "Salida"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr "Proceso"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
||
msgid "Reset Debugger after each run"
|
||
msgstr "Resetear depurador después de cada ejecución"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr "Continuar"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr "Continuar controlado"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr "Continuar sin controlar"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr "Mostrar mensaje al parar"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr "Señales"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr "Hilo"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
||
msgid "Use event log colors"
|
||
msgstr "Usar colores en el registro de eventos"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
||
msgid "Windows"
|
||
msgstr "Ventanas"
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr "No se ha podido cargar el archivo"
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
||
msgid "Unable to load file %s%s%s."
|
||
msgstr "No se ha podido cargar el archivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisdecimal
|
||
msgctxt "lazarusidestrconsts.lisdecimal"
|
||
msgid "Decimal"
|
||
msgstr "Decimal"
|
||
|
||
#: lazarusidestrconsts.lisdefault
|
||
msgctxt "lazarusidestrconsts.lisdefault"
|
||
msgid "Default"
|
||
msgstr "Preterminada"
|
||
|
||
#: lazarusidestrconsts.lisdefaultplaceholder
|
||
msgid "(default)"
|
||
msgstr "(por defecto)"
|
||
|
||
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
||
msgid "Delay for long line hints in completion box"
|
||
msgstr "Retraso para descripciones largas en la ventana de auto-completar"
|
||
|
||
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
|
||
msgid "Delay for hints and completion box"
|
||
msgstr "Retraso para descripciones y ventana de auto-completar"
|
||
|
||
#: lazarusidestrconsts.lisdelete
|
||
msgctxt "lazarusidestrconsts.lisdelete"
|
||
msgid "Delete"
|
||
msgstr "Borrar"
|
||
|
||
#: lazarusidestrconsts.lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr "&Eliminar todo"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
||
msgid "Delete all breakpoints?"
|
||
msgstr "¿Eliminar todos los puntos de interrupción?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
||
msgid "Delete all breakpoints in file %s%s%s?"
|
||
msgstr "¿Eliminar todos los puntos de interrupción en el archivo %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallinsamesource
|
||
msgid "Delete All in same source"
|
||
msgstr "Eliminar Todo en la misma fuente"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
||
msgid "Delete all selected breakpoints?"
|
||
msgstr "¿Eliminar todos los puntos de interrupción seleccionados?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr "¿Borrar todos estos archivos?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr "¿Borrar archivo ambiguo?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpoint
|
||
msgid "Delete Breakpoint"
|
||
msgstr "Eliminar Punto de Interrupción"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointatline
|
||
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
||
msgstr "¿Eliminar punto de interrupción en%s\"%s\" línea %d?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointforaddress
|
||
msgid "Delete breakpoint for address %s?"
|
||
msgstr "Borrar punto de interrupción para la dirección %s?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointforwatch
|
||
msgid "Delete watchpoint for \"%s\"?"
|
||
msgstr "Borrar punto de observación para \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr "Fallo al borrar el archivo"
|
||
|
||
#: lazarusidestrconsts.lisdeletemacro
|
||
#, fuzzy
|
||
#| msgid "Delete macro %s"
|
||
msgid "Delete macro %s%s%s?"
|
||
msgstr "Borrar macro %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeletemode
|
||
msgid "Delete mode \"%s\""
|
||
msgstr "Borrar modo \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile
|
||
msgid "Delete old file %s%s%s?"
|
||
msgstr "¿Borrar archivo viejo: %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile2
|
||
msgid "Delete old file?"
|
||
msgstr "¿Eliminar archivo anterior?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteselectedfiles
|
||
msgid "Delete selected files"
|
||
msgstr "Eliminar los archivos seleccionados"
|
||
|
||
#: lazarusidestrconsts.lisdeleteselectedmacro
|
||
msgid "Delete selected macro?"
|
||
msgstr "Borrar macro seleccionada?"
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue
|
||
msgid "Delete value %s%s%s"
|
||
msgstr "Eliminar valor %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue2
|
||
msgid "Delete value %s"
|
||
msgstr "Borrar valor %s"
|
||
|
||
#: lazarusidestrconsts.lisdeletingoffilefailed
|
||
msgid "Deleting of file %s%s%s failed."
|
||
msgstr "Falló el borrado del archivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisdelphi
|
||
msgid "Delphi"
|
||
msgstr "Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphipackage
|
||
msgid "Delphi package"
|
||
msgstr "Paquete Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphiproject
|
||
msgid "Delphi project"
|
||
msgstr "Proyecto Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphiunit
|
||
msgid "Delphi unit"
|
||
msgstr "Unidad Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
||
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
||
msgstr "Los paquetes \"Tiempo diseño\" pueden agregar componentes y elementos de menú del IDE. Puede ser utilizados por proyectos, pero no se compilan en el proyecto. El compilador no encontrará unidades de este paquete al compilar el proyecto."
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr "Directorio de destino"
|
||
|
||
#: lazarusidestrconsts.lisdestructorcode
|
||
msgid "Destructor code"
|
||
msgstr "Código del Destructor"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr "Insensible a mayus/mins"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr "Ignorar si se han añadido o eliminado líneas vacías"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr "Ignorar las diferencias a final de línea (e.j. #10 = #13#10)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr "Ignorar la totalidad de caracteres de espacio"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr "Ignorar espacios (caracteres de nueva línea no incluídos)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr "Ignorar espacios al final de línea"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr "Ignorar espacios a principio de línea"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "Sólo selección"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
||
msgid "Open Diff in editor"
|
||
msgstr "Abrir Difrencias en editor"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgtext1
|
||
msgid "Text1"
|
||
msgstr "Texto1"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgtext2
|
||
msgid "Text2"
|
||
msgstr "Texto2"
|
||
|
||
#: lazarusidestrconsts.lisdigits
|
||
msgid "Digits:"
|
||
msgstr "Dígitos:"
|
||
|
||
#: lazarusidestrconsts.lisdirectives
|
||
msgid "Directives"
|
||
msgstr "Directivas"
|
||
|
||
#: lazarusidestrconsts.lisdirectivesfornewunit
|
||
msgid "Directives for new unit"
|
||
msgstr "Directivas para la unidad nueva"
|
||
|
||
#: lazarusidestrconsts.lisdirectory
|
||
msgid "Directory: "
|
||
msgstr "Directorio: "
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound
|
||
msgid "Directory %s%s%s not found."
|
||
msgstr "Directorio %s%s%s no encontrado."
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound2
|
||
msgid "directory %s not found"
|
||
msgstr "directorio %s no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotwritable
|
||
msgid "Directory not writable"
|
||
msgstr "Directorio no escribible"
|
||
|
||
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
||
msgid "Directory where the IDE puts the .po files"
|
||
msgstr "Directorio donde el IDE pone los archivos .po"
|
||
|
||
#: lazarusidestrconsts.lisdisableallinsamesource
|
||
msgid "Disable All in same source"
|
||
msgstr "Desactivar todo en la misma fuente"
|
||
|
||
#: lazarusidestrconsts.lisdisablebreakpoint
|
||
msgid "Disable Breakpoint"
|
||
msgstr "Desactivar Punto de Interrupción"
|
||
|
||
#: lazarusidestrconsts.lisdisabled
|
||
msgid "Disabled"
|
||
msgstr "Desactivado"
|
||
|
||
#: lazarusidestrconsts.lisdisablegroups
|
||
msgid "Disable Groups"
|
||
msgstr "Desactivar Grupos"
|
||
|
||
#: lazarusidestrconsts.lisdisablei18nforlfm
|
||
msgid "Disable I18N for LFM"
|
||
msgstr "Desactivar I18N para LFM"
|
||
|
||
#: lazarusidestrconsts.lisdisassassembler
|
||
msgctxt "lazarusidestrconsts.lisdisassassembler"
|
||
msgid "Assembler"
|
||
msgstr "Ensamblador"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotoaddress
|
||
#, fuzzy
|
||
#| msgid "Goto address"
|
||
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
|
||
msgid "Goto Address"
|
||
msgstr "Ir a la Dirección"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotoaddresshint
|
||
#, fuzzy
|
||
#| msgid "Goto address"
|
||
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
|
||
msgid "Goto Address"
|
||
msgstr "Ir a la Dirección"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotocurrentaddress
|
||
#, fuzzy
|
||
#| msgid "Goto current address"
|
||
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
|
||
msgid "Goto Current Address"
|
||
msgstr "Ir a la Dirección Actual"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
|
||
#, fuzzy
|
||
#| msgid "Goto current address"
|
||
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
|
||
msgid "Goto Current Address"
|
||
msgstr "Ir a la Dirección Actual"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr "Descartar cambios"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesall
|
||
msgid "Discard all changes"
|
||
msgstr "Descartar todos los cambios"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
||
msgid "Discard changes and open project"
|
||
msgstr "Descartar cambios y abrir proyecto"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesandquit
|
||
msgid "Discard changes and quit"
|
||
msgstr "Descartar cambios y salir"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
||
msgid "Discard changes, create new project"
|
||
msgstr "Descartar cambios, crear nuevo proyecto"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr "Haga clic en uno de los elementos de abajo para ver la diferencia"
|
||
|
||
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr "Error leyendo archivo: %s"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
|
||
msgid "Ignore disk changes"
|
||
msgstr "Ignorar cambios de disco"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffrevertall
|
||
msgid "Reload from disk"
|
||
msgstr "Recargar desde el disco"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr "Algunos archivos han cambiado en el disco:"
|
||
|
||
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr "Distingue entre mayúsculas y minúsculas, ejemplo A y a"
|
||
|
||
#: lazarusidestrconsts.lisdlgalloptions
|
||
msgid "All options ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgchangeclass
|
||
msgid "Change Class ..."
|
||
msgstr "Cambiar Clase ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgdefines
|
||
msgid "Defines ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdlgexport
|
||
msgctxt "lazarusidestrconsts.lisdlgexport"
|
||
msgid "Export ..."
|
||
msgstr "Exportar ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgimport
|
||
msgctxt "lazarusidestrconsts.lisdlgimport"
|
||
msgid "Import ..."
|
||
msgstr "Importar ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgopen
|
||
msgctxt "lazarusidestrconsts.lisdlgopen"
|
||
msgid "Open ..."
|
||
msgstr "Abrir ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgsave
|
||
msgctxt "lazarusidestrconsts.lisdlgsave"
|
||
msgid "Save ..."
|
||
msgstr "Guardar ..."
|
||
|
||
#: lazarusidestrconsts.lisdoesnotexists
|
||
#, fuzzy
|
||
#| msgid "%s does not exists: %s"
|
||
msgid "%s does not exist: %s"
|
||
msgstr "%s no existe: %s"
|
||
|
||
#: lazarusidestrconsts.lisdonotchange
|
||
msgid "Do not change"
|
||
msgstr "No cambiar"
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "No cerrar el proyecto"
|
||
|
||
#: lazarusidestrconsts.lisdonotcompiledependencies
|
||
msgid "do not compile dependencies"
|
||
msgstr "no compilar dependencias"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr "No mostrar la pantalla de inicio"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
||
msgid "Do not show this dialog for this project"
|
||
msgstr "No mostrar este dialogo para este proyecto"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
||
msgid "Do not show this message again"
|
||
msgstr "No volver a mostrar este mensaje"
|
||
|
||
#: lazarusidestrconsts.lisdown
|
||
msgctxt "lazarusidestrconsts.lisdown"
|
||
msgid "Down"
|
||
msgstr "Abajo"
|
||
|
||
#: lazarusidestrconsts.lisdowngrade
|
||
msgid "Downgrade"
|
||
msgstr "Degradar"
|
||
|
||
#: lazarusidestrconsts.lisdowngradeconfiguration
|
||
msgid "Downgrade configuration"
|
||
msgstr "Degradar configuración"
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
||
msgid "Do you still want to create the new project?"
|
||
msgstr "¿Todavía desea crear el nuevo proyecto?"
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
||
msgid "Do you still want to open another project?"
|
||
msgstr "¿Todavía quiere abrir otro proyecto?"
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
||
msgid "Do you still want to quit?"
|
||
msgstr "¿Todavía quieres salir?"
|
||
|
||
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
||
msgid "Draw grid lines"
|
||
msgstr "Dibujar lineas de cuadrícula"
|
||
|
||
#: lazarusidestrconsts.lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr "Copiar los componentes seleccionados al portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr "Cortar componentes seleccionados al portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr "Mover componente uno atrás"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr "Mover componente uno adelante"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr "Mover componente al fondo"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr "Mover componente al frente"
|
||
|
||
#: lazarusidestrconsts.lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr "Pegar componentes seleccionados desde el portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr "Seleccionar componente padre"
|
||
|
||
#: lazarusidestrconsts.lisduplicate
|
||
msgid "Duplicate"
|
||
msgstr "Duplicar"
|
||
|
||
#: lazarusidestrconsts.lisduplicateentry
|
||
msgid "Duplicate entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
||
msgid "Duplicate found of value %s%s%s."
|
||
msgstr "Se encontró duplicado del valor %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisduplicatename
|
||
msgid "Duplicate Name"
|
||
msgstr "Duplicar Nombre"
|
||
|
||
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
||
msgstr "Nombre duplicado: Un componente llamado %s%s%s ya existe en el componente heredado %s"
|
||
|
||
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
||
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
||
msgstr "Archivos ppu duplicados. Elimine uno o asegúrese de que todas las rutas de búsqueda están en el orden correcto (Indicación: FPC usa primero la última ruta)."
|
||
|
||
#: lazarusidestrconsts.lisduplicatesearchpath
|
||
msgid "Duplicate search path"
|
||
msgstr "Ruta de búsqueda duplicada"
|
||
|
||
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
||
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
||
msgstr "Fuentes duplicadas. Elimine una o asegúrese de que todas las rutas de búsqueda están en el orden correcto (Indicación: FPC usa primero la última ruta)."
|
||
|
||
#: lazarusidestrconsts.lisedit
|
||
msgctxt "lazarusidestrconsts.lisedit"
|
||
msgid "Edit"
|
||
msgstr "Editar"
|
||
|
||
#: lazarusidestrconsts.liseditcontexthelp
|
||
msgid "Edit context help"
|
||
msgstr "Editar ayuda contextual"
|
||
|
||
#: lazarusidestrconsts.lisedithelp
|
||
msgid "Edit help"
|
||
msgstr "Editar ayuda"
|
||
|
||
#: lazarusidestrconsts.liseditkey
|
||
msgid "Edit Key"
|
||
msgstr "Editar llave(key)"
|
||
|
||
#: lazarusidestrconsts.liseditorfiletypes
|
||
msgid "Editor file types"
|
||
msgstr "Tipos de archivo del editor"
|
||
|
||
#: lazarusidestrconsts.liseditormacros
|
||
msgid "Editor macros"
|
||
msgstr "Editor macros"
|
||
|
||
#: lazarusidestrconsts.lisedoptsloadascheme
|
||
msgid "Load a scheme"
|
||
msgstr "Cargar un esquema"
|
||
|
||
#: lazarusidestrconsts.lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "Todos los paquetes"
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr "Proyecto Actual"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr "Todos los proyectos"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr "establecer modo FPC a DELPHI"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
||
msgid "set FPC mode to FPC"
|
||
msgstr "Cambiar modo FPC a FPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr "establecer modo FPC a GPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
||
msgid "set FPC mode to MacPas"
|
||
msgstr "Cambiar modo FPC a MacPas"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr "establecer modo FPC a TP"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr "activar IOCHECKS"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr "activar OVERFLOWCHECKS"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr "activar RANGECHECKS"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr "usar la unidad HeapTrc"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr "usar unidad LineInfo"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr "Una herramienta válida necesita como mínimo un título y un nombre de archivo."
|
||
|
||
#: lazarusidestrconsts.lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "Editar herramienta"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolhidemainform
|
||
msgid "Hide main form"
|
||
msgstr "Ocultar formulario principal"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolkey
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
||
msgid "Key"
|
||
msgstr "Tecla"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolmacros
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
||
msgid "Macros"
|
||
msgstr "Macros"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr "Parámetros:"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
||
msgid "Program Filename:"
|
||
msgstr "Nombre de archivo del programa:"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for Free Pascal Compiler messages"
|
||
msgstr "Escanear salida de mensajes del Compilador Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for make messages"
|
||
msgstr "Escanear salida de mensajes de make"
|
||
|
||
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr "Título y Nombre de archivo requerido"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr "Directorio de Trabajo:"
|
||
|
||
#: lazarusidestrconsts.lisemdall
|
||
msgctxt "lazarusidestrconsts.lisemdall"
|
||
msgid "All"
|
||
msgstr "Todo"
|
||
|
||
#: lazarusidestrconsts.lisemdemptymethods
|
||
#, fuzzy
|
||
#| msgid "Emtpy Methods"
|
||
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
||
msgid "Empty Methods"
|
||
msgstr "Métodos Vacios"
|
||
|
||
#: lazarusidestrconsts.lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr "Métodos vacios encontrados:"
|
||
|
||
#: lazarusidestrconsts.lisemdnoclass
|
||
msgid "No class"
|
||
msgstr "Sin clase"
|
||
|
||
#: lazarusidestrconsts.lisemdnoclassat
|
||
msgid "No class at %s(%s,%s)"
|
||
msgstr "Sin clase en %s(%s,%s)"
|
||
|
||
#: lazarusidestrconsts.lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr "Solo published"
|
||
|
||
#: lazarusidestrconsts.lisemdpublic
|
||
msgid "Public"
|
||
msgstr "Public"
|
||
|
||
#: lazarusidestrconsts.lisemdpublished
|
||
msgid "Published"
|
||
msgstr "Published"
|
||
|
||
#: lazarusidestrconsts.lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr "Eliminar métodos"
|
||
|
||
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr "Buscar en esas secciones de clase:"
|
||
|
||
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
||
msgid "Unable to show empty methods of the current class, because%s%s"
|
||
msgstr "No se puede mostrar métodos vacíos de la clase actual, porque%s%s"
|
||
|
||
#: lazarusidestrconsts.lisempty
|
||
msgid "Empty"
|
||
msgstr "Vacío"
|
||
|
||
#: lazarusidestrconsts.lisenableall
|
||
msgid "&Enable All"
|
||
msgstr "&Activar Todo"
|
||
|
||
#: lazarusidestrconsts.lisenableallinsamesource
|
||
msgid "Enable All in same source"
|
||
msgstr "Activar todo en la misma fuente"
|
||
|
||
#: lazarusidestrconsts.lisenablebreakpoint
|
||
msgid "Enable Breakpoint"
|
||
msgstr "Activar Punto de Interrupción"
|
||
|
||
#: lazarusidestrconsts.lisenabled
|
||
msgctxt "lazarusidestrconsts.lisenabled"
|
||
msgid "Enabled"
|
||
msgstr "Activo"
|
||
|
||
#: lazarusidestrconsts.lisenablegroups
|
||
msgid "Enable Groups"
|
||
msgstr "Activar Grupos"
|
||
|
||
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
||
msgid "Enable internationalization and translation support"
|
||
msgstr "Activar soporte de internacionalización y traducción"
|
||
|
||
#: lazarusidestrconsts.lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr "Activar Macros"
|
||
|
||
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
||
msgid "Enable = replace whole identifier, Disable = replace prefix"
|
||
msgstr "Activar = reemplazar identificador entero, Desactivar = reemplazar prefijo"
|
||
|
||
#: lazarusidestrconsts.lisenclose
|
||
msgid "Enclose"
|
||
msgstr "Encerrar"
|
||
|
||
#: lazarusidestrconsts.lisencloseinifdef
|
||
msgid "Enclose in $IFDEF"
|
||
msgstr "Encerrar en $IFDEF"
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr "La codificación de página del archivo %s%s%s%sen disco es %s. La nueva codificación es %s."
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr "La codificación de página del archivo %s%s%s%sen disco es %s. La nueva codificación es %s."
|
||
|
||
#: lazarusidestrconsts.lisendlessloopinmacros
|
||
msgid "Endless loop in macros"
|
||
msgstr "Bucle sin fin en macros"
|
||
|
||
#: lazarusidestrconsts.lisenternewnameformacros
|
||
msgid "Enter new name for Macro \"%s\""
|
||
msgstr "Entrar nuevo nombre para Macro \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
||
msgid "Environment variable, name as parameter"
|
||
msgstr "Variable de Entorno, nombre como parámetro"
|
||
|
||
#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
|
||
msgid "Jump from message to source line on double click (otherwise: single click)"
|
||
msgstr "Saltar del mensaje a la línea de codigo con doble clic (si no: un solo clic)"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr "Directorio no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr "Nombre de archivo del depurador no válido"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr "El archivo de depurador \"%s\" no es un ejecutable."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr "Directorio de prueba \"%s\" no encontrado."
|
||
|
||
#: lazarusidestrconsts.liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr "Opción no válida en la posición %d: \"%s\""
|
||
|
||
#: lazarusidestrconsts.liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr "La opción en la posición %d no admite un argumento: %s"
|
||
|
||
#: lazarusidestrconsts.liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr "La opción en la posición %d necesita un argumento: %s"
|
||
|
||
#: lazarusidestrconsts.liserror
|
||
msgid "Error: "
|
||
msgstr "Error: "
|
||
|
||
#: lazarusidestrconsts.liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr "Error creando archivo"
|
||
|
||
#: lazarusidestrconsts.liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr "Error borrando archivo"
|
||
|
||
#: lazarusidestrconsts.liserrorin
|
||
msgid "Error in %s"
|
||
msgstr "Error en %s"
|
||
|
||
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
||
msgid "Error in the compiler file name:"
|
||
msgstr "Error en el nombre de archivo del compilador:"
|
||
|
||
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
||
msgid "Error in the custom compiler options (Other):"
|
||
msgstr "Error en las opciones personalizadas del compilador (Otro):"
|
||
|
||
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
||
msgid "Error in the custom linker options (Linking / Pass options to linker):"
|
||
msgstr "Error en las opciones personalizadas del enlazador (Enlazando / Pasando opciones al enlazador):"
|
||
|
||
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
||
msgid "Error in the \"Debugger path addition\":"
|
||
msgstr "Error en las \"Adiciones a la ruta del depurador\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
||
msgid "Error in the search path for \"Include files\":"
|
||
msgstr "Error en la ruta de búsqueda de \"Archivos de inclusión\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
||
msgid "Error in the search path for \"Libraries\":"
|
||
msgstr "Error en la ruta de búsqueda de \"Librerías\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
||
msgid "Error in the search path for \"Object files\":"
|
||
msgstr "Error en la ruta de búsqueda de \"Archivos objeto\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
||
msgid "Error in the search path for \"Other sources\":"
|
||
msgstr "Error en la ruta de búsqueda de \"Otras fuentes\""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
||
msgid "Error in the search path for \"Other unit files\":"
|
||
msgstr "Error en la ruta de búsqueda de \"Otros archivos de unidad\":"
|
||
|
||
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
||
msgid "Error in the \"unit output directory\":"
|
||
msgstr "Error en el \"Directorio de salida de la unidad\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
||
msgid "ERROR: invalid build mode \"%s\""
|
||
msgstr "ERROR: modo de construcción invalido \"%s\""
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr "Error cargando archivo"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile2
|
||
msgid "Error loading file \"%s\":%s%s"
|
||
msgstr "Error cargando archivo \"%s\":%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfrom
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr "Error cargando %s desde%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr "Error al mover componente"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr "Error al mover componente %s:%s"
|
||
|
||
#: lazarusidestrconsts.liserrornamingcomponent
|
||
msgid "Error naming component"
|
||
msgstr "Error al nombrar el componente"
|
||
|
||
#: lazarusidestrconsts.liserroropeningcomponent
|
||
msgid "Error opening component"
|
||
msgstr "Error al abrir componente"
|
||
|
||
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr "Error analizando la flujo lfm del componente"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr "Error al leer lista de paquetes del archivo%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxml
|
||
msgid "Error reading XML"
|
||
msgstr "Error al leer XML"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxmlfile
|
||
msgid "Error reading xml file %s%s%s%s%s"
|
||
msgstr "Error al leer el archivo xml %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr "Error renombrando archivo"
|
||
|
||
#: lazarusidestrconsts.liserrors
|
||
msgctxt "lazarusidestrconsts.liserrors"
|
||
msgid "Errors"
|
||
msgstr "Errores"
|
||
|
||
#: lazarusidestrconsts.liserrorsavingto
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr "Error guardando %s a%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
||
msgid "Error setting the name of a component %s to %s"
|
||
msgstr "Error al cambiar el nombre del componente de %s a %s"
|
||
|
||
#: lazarusidestrconsts.liserrorwritingfile
|
||
msgid "Error writing file \"%s\""
|
||
msgstr "Error escribiendo archivo \"%s\""
|
||
|
||
#: lazarusidestrconsts.liserrorwritingfile2
|
||
msgid "Error writing file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr "Error al escribir lista de paquetes al archivo%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liseteditcustomscanners
|
||
msgid "Edit custom scanners (%s)"
|
||
msgstr "Editar escaneadores personalizados (%s)"
|
||
|
||
#: lazarusidestrconsts.lisevalexpression
|
||
msgctxt "lazarusidestrconsts.lisevalexpression"
|
||
msgid "Eval expression"
|
||
msgstr "Evaluar expresión"
|
||
|
||
#: lazarusidestrconsts.lisevaluate
|
||
msgid "E&valuate"
|
||
msgstr "E&valuar"
|
||
|
||
#: lazarusidestrconsts.lisevaluatemodify
|
||
msgid "&Evaluate/Modify"
|
||
msgstr "&Evaluar/Modificar"
|
||
|
||
#: lazarusidestrconsts.liseventlogclear
|
||
msgid "Clear Events"
|
||
msgstr "Limpiar Eventos"
|
||
|
||
#: lazarusidestrconsts.liseventlogoptions
|
||
msgid "Event Log Options ..."
|
||
msgstr "Opciones Log Eventos ..."
|
||
|
||
#: lazarusidestrconsts.liseventlogsavetofile
|
||
msgid "Save Events to File"
|
||
msgstr "Guardar Eventos a Archivo"
|
||
|
||
#: lazarusidestrconsts.liseventslogaddcomment
|
||
msgid "Add Comment ..."
|
||
msgstr "Añadir Comentario ..."
|
||
|
||
#: lazarusidestrconsts.liseventslogaddcomment2
|
||
msgid "Add Comment"
|
||
msgstr "Añadir Comentario"
|
||
|
||
#: lazarusidestrconsts.liseverynthlinenumber
|
||
#, fuzzy
|
||
#| msgid "Every n-th line number:"
|
||
msgid "Every n-th line number"
|
||
msgstr "Cada n-ésimo número de línea"
|
||
|
||
#: lazarusidestrconsts.lisexamplefile
|
||
msgid "Example file:"
|
||
msgstr "Archivo de ejemplo:"
|
||
|
||
#: lazarusidestrconsts.lisexamplesbuildallselected
|
||
msgid "Build all selected"
|
||
msgstr "Construir todos los seleccionados"
|
||
|
||
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
||
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
msgstr "Ejemplos:%sIdentificador%sTMyEnum.Enum%sNombreUnidad.Identificador%s#NombrePaquete.NombreUnidad.Identificador"
|
||
|
||
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
||
msgid "Open first selected"
|
||
msgstr "Abrir primero seleccionado"
|
||
|
||
#: lazarusidestrconsts.lisexceptiondialog
|
||
msgid "Debugger Exception Notification"
|
||
msgstr "Notificación de Excepciones del Depurador"
|
||
|
||
#: lazarusidestrconsts.lisexcludedatruntime
|
||
msgid "%s excluded at run time"
|
||
msgstr "%s excluido en tiempo de ejecución"
|
||
|
||
#: lazarusidestrconsts.lisexcludefilter
|
||
#, fuzzy
|
||
#| msgid "Exclude Filter"
|
||
msgid "Exclude filter"
|
||
msgstr "Excluir filtro"
|
||
|
||
#: lazarusidestrconsts.lisexecutable
|
||
msgid "Executable"
|
||
msgstr "Ejecutable"
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr "Ejecutando comando después"
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr "Ejecutando comando antes"
|
||
|
||
#: lazarusidestrconsts.lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr "Ejecución detenida"
|
||
|
||
#: lazarusidestrconsts.lisexeprograms
|
||
msgid "Programs"
|
||
msgstr "Programas"
|
||
|
||
#: lazarusidestrconsts.lisexit
|
||
msgctxt "lazarusidestrconsts.lisexit"
|
||
msgid "Exit"
|
||
msgstr "Salir"
|
||
|
||
#: lazarusidestrconsts.lisexpandall
|
||
msgid "Expand All (*)"
|
||
msgstr "Expandir Todo (*)"
|
||
|
||
#: lazarusidestrconsts.lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr "Expandir todas las clases"
|
||
|
||
#: lazarusidestrconsts.lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr "Expandir todos los paquetes"
|
||
|
||
#: lazarusidestrconsts.lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr "Expandir todas las unidades"
|
||
|
||
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr "Expandir nombre de archivo del archivo actual del editor"
|
||
|
||
#: lazarusidestrconsts.lisexport
|
||
#, fuzzy
|
||
#| msgid "Export ..."
|
||
msgctxt "lazarusidestrconsts.lisexport"
|
||
msgid "Export"
|
||
msgstr "Exportar ..."
|
||
|
||
#: lazarusidestrconsts.lisexporthtml
|
||
msgid "Export as HTML"
|
||
msgstr "Exportar a HTML"
|
||
|
||
#: lazarusidestrconsts.lisexportlist
|
||
msgid "Export list"
|
||
msgstr "Exportar lista"
|
||
|
||
#: lazarusidestrconsts.lisexportpackagelistxml
|
||
msgid "Export package list (*.xml)"
|
||
msgstr "Exportar lista de paquete (*.xml)"
|
||
|
||
#: lazarusidestrconsts.lisexpression
|
||
msgid "Expression:"
|
||
msgstr "Expresión:"
|
||
|
||
#: lazarusidestrconsts.lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr "¿Extender ruta de la unidad?"
|
||
|
||
#: lazarusidestrconsts.lisextract
|
||
msgid "Extract"
|
||
msgstr "Extraer"
|
||
|
||
#: lazarusidestrconsts.lisextractprocedure
|
||
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
||
msgid "Extract Procedure"
|
||
msgstr "Extraer Procedimiento"
|
||
|
||
#: lazarusidestrconsts.lisexttoolexternaltools
|
||
#, fuzzy
|
||
#| msgid "External tools"
|
||
msgid "External Tools"
|
||
msgstr "Herramientas Externas"
|
||
|
||
#: lazarusidestrconsts.lisexttoolfailedtoruntool
|
||
msgid "Failed to run tool"
|
||
msgstr "Se produjo un fallo al ejecutar la herramienta"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr "Nº máximo de herramientas alcanzadas"
|
||
|
||
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr "Hay un máximo de %s herramientas"
|
||
|
||
#: lazarusidestrconsts.lisexttooltitlecompleted
|
||
msgid "\"%s\" completed"
|
||
msgstr "\"%s\" completado"
|
||
|
||
#: lazarusidestrconsts.lisexttoolunabletorunthetool
|
||
msgid "Unable to run the tool %s%s%s:%s%s"
|
||
msgstr "No se ha podido ejecutar la herramienta %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
||
msgid "Failed to create Application Bundle for \"%s\""
|
||
msgstr "Falló al crear el envoltorio de la aplicación para \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
||
msgid "Failed to load fold state"
|
||
msgstr "Ha fallado La carga del estado de plegado de código"
|
||
|
||
#: lazarusidestrconsts.lisfailedtosavefile
|
||
msgid "Failed to save file."
|
||
msgstr "Fallo al guardar archivo."
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr "Reducir pintado del diseñador"
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr "Dibujar elementos del diseñador cuando se esté inactivo (reduce la sobrecarga en máquinas lentas)"
|
||
|
||
#: lazarusidestrconsts.lisfile
|
||
msgctxt "lazarusidestrconsts.lisfile"
|
||
msgid "File"
|
||
msgstr "Archivo"
|
||
|
||
#: lazarusidestrconsts.lisfile2
|
||
msgid "File: "
|
||
msgstr "Archivo: "
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "El archivo %s%s%s%sno parece ser un archivo de texto.%s¿Abrirlo de todas maneras?"
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "El archivo %s%s%s%sno parece ser un archivo de texto.%s¿Abrirlo de todas maneras?"
|
||
|
||
#: lazarusidestrconsts.lisfileextensionofprograms
|
||
msgid "File extension of programs"
|
||
msgstr "Extensión de archivo de programas"
|
||
|
||
#: lazarusidestrconsts.lisfilefilter
|
||
msgid "File filter"
|
||
msgstr "Filtro de archivos"
|
||
|
||
#: lazarusidestrconsts.lisfilefilters
|
||
msgid "File Filters"
|
||
msgstr "Filtros Archivo"
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersaddrow
|
||
msgid "Add Row"
|
||
msgstr "Añadir Fila"
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
||
msgid "Delete Row"
|
||
msgstr "Borrar Fila"
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
||
msgid "Insert Row"
|
||
msgstr "Insertar Fila"
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersmask
|
||
msgid "File mask"
|
||
msgstr "Marcara archivo"
|
||
|
||
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
||
msgid "Set defaults"
|
||
msgstr "Establecer por defecto"
|
||
|
||
#: lazarusidestrconsts.lisfilefilterstitle
|
||
msgid "These are file filters that will appear in all File Open dialogs"
|
||
msgstr "Estos son filtros de archivos que van a aparecer en todos los cuadros de diálogo de Apertura de Archivos"
|
||
|
||
#: lazarusidestrconsts.lisfilehaschangedsave
|
||
msgid "File %s%s%s has changed. Save?"
|
||
msgstr "El archivo %s%s%s ha cambiado. ¿Guardar?"
|
||
|
||
#: lazarusidestrconsts.lisfilehasnoproject
|
||
msgid "File has no project"
|
||
msgstr "El archivo no tiene proyecto"
|
||
|
||
#: lazarusidestrconsts.lisfileisdirectory
|
||
msgid "File is directory"
|
||
msgstr "Archivo es directorio"
|
||
|
||
#: lazarusidestrconsts.lisfileisnotanexecutable
|
||
msgid "File is not an executable"
|
||
msgstr "Archivo no es un ejecutable"
|
||
|
||
#: lazarusidestrconsts.lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr "No se puede escribir en el archivo"
|
||
|
||
#: lazarusidestrconsts.lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr "El archivo es un enlace simbólico"
|
||
|
||
#: lazarusidestrconsts.lisfileisvirtual
|
||
msgid "File %s%s%s is virtual."
|
||
msgstr "El archivo %s%s%s es virtual."
|
||
|
||
#: lazarusidestrconsts.lisfilelinkerror
|
||
msgid "File link error"
|
||
msgstr "Error en el enlace al archivo"
|
||
|
||
#: lazarusidestrconsts.lisfilenameaddress
|
||
msgid "Filename/Address"
|
||
msgstr "Nombre de archivo/Dirección"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr "Archivo no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound2
|
||
msgid "File %s%s%s not found.%s"
|
||
msgstr "No se encontró el archivo %s%s%s.%s"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound3
|
||
msgid "file %s not found"
|
||
msgstr "archivo %s no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound4
|
||
msgid "file not found"
|
||
msgstr "archivo no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
||
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
||
msgstr "No se encontró el archivo %s%s%s.%s¿Desea crearlo?%s"
|
||
|
||
#: lazarusidestrconsts.lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr "El archivo no está en minúsculas"
|
||
|
||
#: lazarusidestrconsts.lisfilenottext
|
||
msgid "File not text"
|
||
msgstr "El archivo no es de texto"
|
||
|
||
#: lazarusidestrconsts.lisfilesettings
|
||
#, fuzzy
|
||
#| msgid "File Settings ..."
|
||
msgid "File Settings"
|
||
msgstr "Ajustes de archivo"
|
||
|
||
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
||
msgid "File %s has incorrect syntax."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileshaverightencoding
|
||
msgid "*** All found files already have the right encoding ***"
|
||
msgstr "*** Todos los archivos que se encuentran ya tiene la codificación correcta ***"
|
||
|
||
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
||
msgid "Files in ASCII or UTF-8 encoding"
|
||
msgstr "Archivos con codificación ASCII o UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
||
msgid "File %s is converted to text format."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
||
msgid "Files not in ASCII nor UTF-8 encoding"
|
||
msgstr "Archivos sin codificación ASCII o UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr "archivo, donde la salida de depuración se escribe. Si no se especifica la salida de depuración será a la consola."
|
||
|
||
#: lazarusidestrconsts.lisfilter
|
||
msgid "Filter"
|
||
msgstr "Filtro"
|
||
|
||
#: lazarusidestrconsts.lisfilter3
|
||
msgid "Filter: %s"
|
||
msgstr "Filtro: %s"
|
||
|
||
#: lazarusidestrconsts.lisfiltersets
|
||
msgid "Filter Sets"
|
||
msgstr "Conjuntos de filtros"
|
||
|
||
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
||
msgid "Filter the available options list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfiledirectory
|
||
msgid "D&irectory"
|
||
msgstr "D&irectorio"
|
||
|
||
#: lazarusidestrconsts.lisfindfiledirectoryoptions
|
||
msgid "Directory options"
|
||
msgstr "Opciones del directorio"
|
||
|
||
#: lazarusidestrconsts.lisfindfilefilemask
|
||
msgid "Fi&le mask"
|
||
msgstr "Mascara archivo"
|
||
|
||
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
||
#, fuzzy
|
||
#| msgid "Include sub directories"
|
||
msgid "Include &sub directories"
|
||
msgstr "Incluir &subdirectorios"
|
||
|
||
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr "Patrón &Multilínea"
|
||
|
||
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr "Sólo archivos de texto"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
||
msgid "search all files in &project"
|
||
msgstr "buscar todos los archivos del &proyecto"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
||
msgid "search all &open files"
|
||
msgstr "Buscar en t&odos los archivos abiertos"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
||
msgid "search in &active file"
|
||
msgstr "buscar en archivo &activo"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
||
msgid "search in &directories"
|
||
msgstr "buscar en &directorios"
|
||
|
||
#: lazarusidestrconsts.lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr "Donde"
|
||
|
||
#: lazarusidestrconsts.lisfindkeycombination
|
||
msgid "Find key combination"
|
||
msgstr "Buscar combinación de teclas"
|
||
|
||
#: lazarusidestrconsts.lisfindmissingunit
|
||
msgid "Find missing unit"
|
||
msgstr "Encontrar unidad faltante"
|
||
|
||
#: lazarusidestrconsts.lisfirst
|
||
msgid "First"
|
||
msgstr "En primer lugar"
|
||
|
||
#: lazarusidestrconsts.lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr "Corregir fichero LFM"
|
||
|
||
#: lazarusidestrconsts.lisfloatingpoin
|
||
msgid "Floating Point"
|
||
msgstr "Punto Flotante"
|
||
|
||
#: lazarusidestrconsts.lisfocushint
|
||
msgid "Focus hint"
|
||
msgstr "Enfoque pista"
|
||
|
||
#: lazarusidestrconsts.lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr "Forzar renombrado"
|
||
|
||
#: lazarusidestrconsts.lisform
|
||
msgid "Form"
|
||
msgstr "Formulario"
|
||
|
||
#: lazarusidestrconsts.lisformaterror
|
||
msgid "Format error"
|
||
msgstr "Error de formato"
|
||
|
||
#: lazarusidestrconsts.lisfoundversionexpected
|
||
msgid "Found version %s, expected %s"
|
||
msgstr "Encontrada version %s, esperada %s"
|
||
|
||
#: lazarusidestrconsts.lisfpccfgismissing
|
||
msgid "fpc.cfg is missing."
|
||
msgstr "fpc.cfg falta"
|
||
|
||
#: lazarusidestrconsts.lisfpcmakefailed
|
||
msgid "fpcmake failed"
|
||
msgstr "Falló fpcmake"
|
||
|
||
#: lazarusidestrconsts.lisfpcmessagefile
|
||
msgid "FPC message file"
|
||
msgstr "Archivo mensaje FPC"
|
||
|
||
#: lazarusidestrconsts.lisfpcresources
|
||
msgid "FPC resources"
|
||
msgstr "Recursos FPC"
|
||
|
||
#: lazarusidestrconsts.lisfpcsources
|
||
msgid "FPC sources"
|
||
msgstr "Fuentes FPC"
|
||
|
||
#: lazarusidestrconsts.lisfpctooold
|
||
msgid "FPC too old"
|
||
msgstr "FPC muy antiguo"
|
||
|
||
#: lazarusidestrconsts.lisfpcversion
|
||
msgid "FPC Version: "
|
||
msgstr "Versión FPC:"
|
||
|
||
#: lazarusidestrconsts.lisfpcversioneg222
|
||
msgid "FPC Version (e.g. 2.2.2)"
|
||
msgstr "Versión FPC (ej. 2.2.2)"
|
||
|
||
#: lazarusidestrconsts.lisfpdoceditor
|
||
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
||
msgid "FPDoc Editor"
|
||
msgstr "Editor FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisfpdocerrorwriting
|
||
msgid "Error writing \"%s\"%s%s"
|
||
msgstr "Error escribiendo \"%s\"%s%s"
|
||
|
||
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
||
msgid "FPDoc syntax error"
|
||
msgstr "Error de sintaxis de FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisfpdocpackagename
|
||
msgid "FPDoc package name:"
|
||
msgstr "Nombre paquete FPDoc:"
|
||
|
||
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
||
msgid "FPDoc package name. Default is project file name."
|
||
msgstr "Nombre del paquete FPDoc. El valor predeterminado es el nombre del archivo de proyecto."
|
||
|
||
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
||
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
||
msgstr "Hay un error de sintaxis en el elemento fpdoc \"%s\":%s%s"
|
||
|
||
#: lazarusidestrconsts.lisframe
|
||
msgid "Frame"
|
||
msgstr "Frame"
|
||
|
||
#: lazarusidestrconsts.lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr "&Buscar hacia atrás"
|
||
|
||
#: lazarusidestrconsts.lisfreepascal
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
||
msgid "Free Pascal Compiler messages"
|
||
msgstr "Mensajes del Compilador Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
||
#, fuzzy
|
||
#| msgid "Freepascal source directory"
|
||
msgid "Free Pascal source directory"
|
||
msgstr "Directorio de las fuentes de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr "Bús&queda hacia delante"
|
||
|
||
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr "Archivos adicionales a buscar (e.g. /path/*.pas;/path2/*.pp)"
|
||
|
||
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr "Buscar o Renombrar Identificador"
|
||
|
||
#: lazarusidestrconsts.lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr "Buscar Referencias"
|
||
|
||
#: lazarusidestrconsts.lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr "Identificador: %s"
|
||
|
||
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr "en todos los paquetes y proyectos abiertos"
|
||
|
||
#: lazarusidestrconsts.lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr "en la unidad actual"
|
||
|
||
#: lazarusidestrconsts.lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr "en el proyecto principal"
|
||
|
||
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr "en el proyecto/paquete que es propietario de la unidad actual"
|
||
|
||
#: lazarusidestrconsts.lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr "Identificador no válido"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr "Renombrar todas las referencias"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameto
|
||
msgid "Rename to"
|
||
msgstr "Renombrar a"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr "Buscar también en los comentarios"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchwhere
|
||
msgid "Search where"
|
||
msgstr "Buscar dónde"
|
||
|
||
#: lazarusidestrconsts.lisfunction
|
||
msgctxt "lazarusidestrconsts.lisfunction"
|
||
msgid "Function"
|
||
msgstr "Función"
|
||
|
||
#: lazarusidestrconsts.lisgeneral
|
||
msgctxt "lazarusidestrconsts.lisgeneral"
|
||
msgid "General"
|
||
msgstr "General"
|
||
|
||
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
||
msgid "get word at current cursor position"
|
||
msgstr "Obtener la palabra actual en la posición del cursor"
|
||
|
||
#: lazarusidestrconsts.lisgotoline
|
||
#, fuzzy
|
||
#| msgid "Goto line"
|
||
msgid "Goto Line"
|
||
msgstr "Ir a la Línea"
|
||
|
||
#: lazarusidestrconsts.lisgotoselectedsourceline
|
||
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
|
||
msgid "Goto selected source line"
|
||
msgstr "Ir a la línea de código seleccionada"
|
||
|
||
#: lazarusidestrconsts.lisgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEsta código es software libre; usted puede redistribuirlo y/o modificarlo bajo los términos de la GNU General Public License publicada por la Free Software Foundation; sea versión 2 de la licencia, o (a su opción) cualquier posterior versión. %sEste código se distribuye con la esperanza de que sea útil, pero SIN NINGUNA GARANTÍA, ni siquiera la garantía implícita de COMERCIABILIDAD o IDONEIDAD PARA UN DETERMINADO FIN. Consulte la GNU General Public License para obtener más detalles. %sUna copia de la Licencia Pública General de GNU está disponible en la World Wide Web en <http://www.gnu.org/copyleft/gpl.html>. También puede obtenerlo por escrito a la Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lisgroup
|
||
msgid "Group"
|
||
msgstr "Grupo"
|
||
|
||
#: lazarusidestrconsts.lisgroupassignexisting
|
||
msgid "Assign to existing \"%s\" group?"
|
||
msgstr "Asignar al grupo existente \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisgroupemptydelete
|
||
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
|
||
msgstr "No hay mas puntos de interrupción asignados al grupo \"%s\", borrarlo?"
|
||
|
||
#: lazarusidestrconsts.lisgroupemptydeletemore
|
||
msgid "%sThere are %d more empty groups, delete all?"
|
||
msgstr "%sHay %d grupos más vacíos, borrarlos todos?"
|
||
|
||
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
|
||
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
|
||
msgstr "El nombre del grupo no puede estar vacío. Limpiar los grupo(s) de puntos de interrupción?"
|
||
|
||
#: lazarusidestrconsts.lisgroupnameinput
|
||
msgid "Group name:"
|
||
msgstr "Nombre grupo:"
|
||
|
||
#: lazarusidestrconsts.lisgroupnameinvalid
|
||
msgid "BreakpointGroup name must be a valid Pascal identifier name."
|
||
msgstr "BreakpointGroup nombre debe ser un nombre válido de identificador de Pascal."
|
||
|
||
#: lazarusidestrconsts.lisgroupsetnew
|
||
msgid "Set new group ..."
|
||
msgstr "Establecer nuevo grupo ..."
|
||
|
||
#: lazarusidestrconsts.lisgroupsetnone
|
||
msgid "Clear group(s)"
|
||
msgstr "Limpiar grupo(s)"
|
||
|
||
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
||
msgid "Enable or Disable groups of debug output. Valid Options are:"
|
||
msgstr "Activar o desactivar los grupos de salida de depuración. Las opciones válidas son:"
|
||
|
||
#: lazarusidestrconsts.lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr "Crecer hacia el más largo"
|
||
|
||
#: lazarusidestrconsts.lishashelp
|
||
msgid "Has Help"
|
||
msgstr "Tiene Ayuda"
|
||
|
||
#: lazarusidestrconsts.lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr "Comentario de cabecera para la clase"
|
||
|
||
#: lazarusidestrconsts.lishelp
|
||
msgctxt "lazarusidestrconsts.lishelp"
|
||
msgid "Help"
|
||
msgstr "Ayuda"
|
||
|
||
#: lazarusidestrconsts.lishelpentries
|
||
msgid "Help entries"
|
||
msgstr "Elementos de Ayuda"
|
||
|
||
#: lazarusidestrconsts.lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "Selector de ayuda"
|
||
|
||
#: lazarusidestrconsts.lishexadecimal
|
||
msgid "Hexadecimal"
|
||
msgstr "Hexadecimal"
|
||
|
||
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
||
#, fuzzy
|
||
#| msgid "Help for FreePascal Compiler message"
|
||
msgid "Help for Free Pascal Compiler message"
|
||
msgstr "Ayuda para mensaje del Compilador de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lishidemessageviadirective
|
||
msgid "Hide message via directive"
|
||
msgstr "Ocultar mensaje via directiva"
|
||
|
||
#: lazarusidestrconsts.lishint
|
||
msgid "Hint"
|
||
msgstr "Indicación"
|
||
|
||
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
||
msgid "Hint: A default value can be defined in the conditionals."
|
||
msgstr "Sugerencia: Un valor predeterminado puede ser definido en los condicionales."
|
||
|
||
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr "Sugerencia: Compruebe si dos paquetes contienen una unidad con el mismo nombre."
|
||
|
||
#: lazarusidestrconsts.lishintsaveall
|
||
msgid "Save all"
|
||
msgstr "Guardar todo"
|
||
|
||
#: lazarusidestrconsts.lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr "Paso a paso por instrucciones"
|
||
|
||
#: lazarusidestrconsts.lishintstepout
|
||
msgid "Run until function returns"
|
||
msgstr "Ejecutar hasta el retorno de la función"
|
||
|
||
#: lazarusidestrconsts.lishintstepover
|
||
msgid "Step Over"
|
||
msgstr "Paso a paso por funciones"
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr "Sugerencia: La función \"Crear Resourcestring\" espera una constante de cadena.%sPor favor seleccione únicamente una expresión de cadena y pruebe otra vez."
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
||
msgstr "Sugerencia: La función \"Crear Resourcestring\" espera una constante de cadena.%sPor favor seleccione únicamente una expresión de cadena y pruebe otra vez."
|
||
|
||
#: lazarusidestrconsts.lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr "Cambiar Formulario/Unidad"
|
||
|
||
#: lazarusidestrconsts.lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr "Ver Formularios"
|
||
|
||
#: lazarusidestrconsts.lishintviewunits
|
||
msgid "View Units"
|
||
msgstr "Ver Unidades"
|
||
|
||
#: lazarusidestrconsts.lishitcount
|
||
msgid "Hitcount"
|
||
msgstr "Contador"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr "Bases de Datos"
|
||
|
||
#: lazarusidestrconsts.lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "Opciones de ayuda"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr "Propiedades:"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr "Visores"
|
||
|
||
#: lazarusidestrconsts.lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr "Ruta a la documentación en HTML de FPC"
|
||
|
||
#: lazarusidestrconsts.lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr "Horizontal"
|
||
|
||
#: lazarusidestrconsts.lisid
|
||
msgctxt "lazarusidestrconsts.lisid"
|
||
msgid "ID"
|
||
msgstr "ID"
|
||
|
||
#: lazarusidestrconsts.liside
|
||
msgid "IDE"
|
||
msgstr "IDE"
|
||
|
||
#: lazarusidestrconsts.lisidebuildoptions
|
||
msgid "IDE build options"
|
||
msgstr "Opciones de construcción del IDE"
|
||
|
||
#: lazarusidestrconsts.lisidecompileandrestart
|
||
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
||
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
||
msgid "Creating Makefile for package %s"
|
||
msgstr "Creando Makefile para el paquete %s"
|
||
|
||
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
|
||
msgid "Error: running 'compile after' tool failed for package %s"
|
||
msgstr "Error: Falló al ejecutar herramienta 'compilar después de' para el paquete %s "
|
||
|
||
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
||
msgid "Information about the IDE"
|
||
msgstr "Información acerca del IDE"
|
||
|
||
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
|
||
msgid "WARNING: unit name invalid %s, package=%s"
|
||
msgstr "ADVERTENCIA: nombre de unidad no válido %s, paquete=%s"
|
||
|
||
#: lazarusidestrconsts.lisidemacros
|
||
msgid "IDE Macros"
|
||
msgstr "Macros IDE"
|
||
|
||
#: lazarusidestrconsts.lisidentifier
|
||
msgid "identifier"
|
||
msgstr "identificador"
|
||
|
||
#: lazarusidestrconsts.lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr "El identificador comienza con ..."
|
||
|
||
#: lazarusidestrconsts.lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr "El identificador contiene ..."
|
||
|
||
#: lazarusidestrconsts.lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr "Opciones del IDE"
|
||
|
||
#: lazarusidestrconsts.lisidetitleshowsbuildmode
|
||
msgid "IDE title shows selected build mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidetitleshowsprojectdir
|
||
msgid "IDE title shows project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
||
msgid "IDE title starts with project name"
|
||
msgstr "El título del IDE empieza por el nombre del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroraccessingxml
|
||
msgid "Error accessing xml"
|
||
msgstr "Error accediendo a xml"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
|
||
msgid "Error accessing xml file %s%s%s:%s%s"
|
||
msgstr "Error accediendo al archivo xml %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoerrorloadingxml
|
||
msgid "Error loading xml"
|
||
msgstr "Error cargando xml"
|
||
|
||
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
|
||
msgid "Error loading xml file %s%s%s:%s%s"
|
||
msgstr "Error cargando archivo xml %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr "El archivo a exportar existe"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr "El archivo a exportar %s%s%s existe.%s¿Abrir el archivo y reemplazar sólo las opciones del compilador?%s(Las otras opciones se mantendrán.)"
|
||
|
||
#: lazarusidestrconsts.lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr "Cargar desde archivo"
|
||
|
||
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
|
||
msgid "Open or Load Compiler Options"
|
||
msgstr "Abrir o cargar opciones del compilador"
|
||
|
||
#: lazarusidestrconsts.lisiecoopenrecent
|
||
msgid "Open recent"
|
||
msgstr "Abrir reciente"
|
||
|
||
#: lazarusidestrconsts.lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr "Archivos recientes"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "Guardar al archivo"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetorecent
|
||
msgid "Save to recent"
|
||
msgstr "Guardar en reciente"
|
||
|
||
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
||
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%s%sFor example:%s"
|
||
msgstr "Si desea utilizar dos diferentes versiones de Lazarus debe iniciar el segundo Lazarus con la línea de comando parámetro primary-config-path o pcp.%s%sPor ejemplo:%s"
|
||
|
||
#: lazarusidestrconsts.lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr "Ignorar todo"
|
||
|
||
#: lazarusidestrconsts.lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr "Ignorar y continuar"
|
||
|
||
#: lazarusidestrconsts.lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr "Ignorar binarios"
|
||
|
||
#: lazarusidestrconsts.lisignoreexceptiontype
|
||
msgid "Ignore this exception type"
|
||
msgstr "Ignorar este tipo de excepción"
|
||
|
||
#: lazarusidestrconsts.lisignoreusetformasancestor
|
||
msgid "Ignore, use TForm as ancestor"
|
||
msgstr "Ignorar, usar TForm como ascendente"
|
||
|
||
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
||
msgid "Imitate indentation of current unit, project or package"
|
||
msgstr "Imitar sangría de la unidad, proyecto o paquete actual"
|
||
|
||
#: lazarusidestrconsts.lisimplementationcommentforclass
|
||
msgid "Implementation comment for class"
|
||
msgstr "Comentario de implementación para la clase"
|
||
|
||
#: lazarusidestrconsts.lisimport
|
||
#, fuzzy
|
||
#| msgid "Import ..."
|
||
msgctxt "lazarusidestrconsts.lisimport"
|
||
msgid "Import"
|
||
msgstr "Importar ..."
|
||
|
||
#: lazarusidestrconsts.lisimportlist
|
||
msgid "Import list"
|
||
msgstr "Importar lista"
|
||
|
||
#: lazarusidestrconsts.lisimportpackagelistxml
|
||
msgid "Import package list (*.xml)"
|
||
msgstr "Importar lista paquete (*.xml)"
|
||
|
||
#: lazarusidestrconsts.lisimpossible
|
||
msgid "Impossible"
|
||
msgstr "Imposible"
|
||
|
||
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
||
msgid "In a source directory of the package \"%s\"."
|
||
msgstr "En un directorio de fuentes del paquete \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
||
msgid "In a source directory of the project. Check for duplicates."
|
||
msgstr "En un directorio de fuentes del proyecto. Comprobar si hay duplicados."
|
||
|
||
#: lazarusidestrconsts.lisincludeallsubdirectories
|
||
msgid "Include all subdirectories"
|
||
msgstr "Incluir todos los subdirectorios"
|
||
|
||
#: lazarusidestrconsts.lisincludefilter
|
||
#, fuzzy
|
||
#| msgid "Include Filter"
|
||
msgid "Include filter"
|
||
msgstr "Incluir filtro"
|
||
|
||
#: lazarusidestrconsts.lisincludepath
|
||
msgid "include path"
|
||
msgstr "ruta incluida"
|
||
|
||
#: lazarusidestrconsts.lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr "Rutas de archivos include"
|
||
|
||
#: lazarusidestrconsts.lisincludesubdirectories
|
||
msgid "Include subdirectories"
|
||
msgstr "Incluir subdirectorios"
|
||
|
||
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
||
msgid "Incorrect configuration directory found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisindentationforpascalsources
|
||
#, fuzzy
|
||
#| msgid "Indentation for pascal sources"
|
||
msgid "Indentation for Pascal sources"
|
||
msgstr "Sangría en fuentes pascal"
|
||
|
||
#: lazarusidestrconsts.lisindex
|
||
msgid "Index"
|
||
msgstr "Indice"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildabort
|
||
#, fuzzy
|
||
#| msgid "Aborted..."
|
||
msgid "Aborted ..."
|
||
msgstr "Abortado ..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuildcaption
|
||
msgid "Compile Project"
|
||
msgstr "Compilar Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildcompile
|
||
#, fuzzy
|
||
#| msgid "Compiling..."
|
||
msgctxt "lazarusidestrconsts.lisinfobuildcompile"
|
||
msgid "Compiling ..."
|
||
msgstr "Compilando ..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuilderror
|
||
#, fuzzy
|
||
#| msgid "Error..."
|
||
msgid "Error ..."
|
||
msgstr "Error ..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuilderrors
|
||
msgid "Errors:"
|
||
msgstr "Errores:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildhint
|
||
msgid "Hints:"
|
||
msgstr "Hints:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildlines
|
||
msgctxt "lazarusidestrconsts.lisinfobuildlines"
|
||
msgid "Lines:"
|
||
msgstr "Líneas:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildmakeabort
|
||
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
|
||
msgid "Abort"
|
||
msgstr "Abortar"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildnote
|
||
msgid "Notes:"
|
||
msgstr "Notas:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildproject
|
||
msgid "Project:"
|
||
msgstr "Proyecto:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildsuccess
|
||
#, fuzzy
|
||
#| msgid "Success..."
|
||
msgid "Success ..."
|
||
msgstr "Exito ..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuildwarning
|
||
msgid "Warnings:"
|
||
msgstr "Advertencias:"
|
||
|
||
#: lazarusidestrconsts.lisinformation
|
||
msgid "Information"
|
||
msgstr "Información"
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr "Información acerca de %s"
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
||
msgid "Information about used FPC"
|
||
msgstr "Información acerca del FPC en uso"
|
||
|
||
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
||
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
||
msgstr "En la ruta de búsqueda de unidades de FPC. Probablemente instalado por el paquete FPC. Comprobar si el compilador y el archivo ppu son de la misma instalación."
|
||
|
||
#: lazarusidestrconsts.lisinfrontofrelated
|
||
msgid "In front of related"
|
||
msgstr "Delante de los relacionados"
|
||
|
||
#: lazarusidestrconsts.lisinheriteditem
|
||
msgid "Inherited Item"
|
||
msgstr "Elemento heredado"
|
||
|
||
#: lazarusidestrconsts.lisinheritedparameters
|
||
msgid "Inherited parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
||
msgid "Inherited project component"
|
||
msgstr "Componente de proyecto heredado"
|
||
|
||
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
||
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
||
msgstr "Para crear una copia limpia del proyecto/paquete, todos los archivos en el siguiente directorio seran borrados y todo su contenido se habrá perdido.%s%s¿Borrar todos los archivos en %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisinsert
|
||
msgctxt "lazarusidestrconsts.lisinsert"
|
||
msgid "Insert"
|
||
msgstr "Insertar"
|
||
|
||
#: lazarusidestrconsts.lisinsertdate
|
||
msgid "insert date"
|
||
msgstr "insertar fecha"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtime
|
||
msgid "insert date and time"
|
||
msgstr "insertar fecha y hora"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
||
msgid "Insert date and time. Optional: format string"
|
||
msgstr "Insertar fecha y hora. Opcional: cadena de formato"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
||
msgid "Insert date. Optional: format string"
|
||
msgstr "Insertar fecha. Opcional: cadena de formato"
|
||
|
||
#: lazarusidestrconsts.lisinsertendifneeded
|
||
msgid "insert end if needed"
|
||
msgstr "insertar end si es necesario"
|
||
|
||
#: lazarusidestrconsts.lisinsertmacro
|
||
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
||
msgid "Insert Macro"
|
||
msgstr "Insertar Macro"
|
||
|
||
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
||
msgid "Insert name of current procedure"
|
||
msgstr "Insertar nombre del procedimiento actual"
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag
|
||
msgid "Insert PrintShort tag"
|
||
msgstr "Insertar etiqueta PrintShort"
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag2
|
||
msgid "Insert printshort tag"
|
||
msgstr "Insertar etiqueta printshort"
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurehead
|
||
msgid "insert procedure head"
|
||
msgstr "Insertar encabezado de procedimiento"
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurename
|
||
msgid "insert procedure name"
|
||
msgstr "Insertar nombre de procedimiento"
|
||
|
||
#: lazarusidestrconsts.lisinserttime
|
||
msgid "insert time"
|
||
msgstr "insertar hora"
|
||
|
||
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
||
msgid "Insert time. Optional: format string"
|
||
msgstr "Inserta hora. Opcional: cadena de formato"
|
||
|
||
#: lazarusidestrconsts.lisinserturltag
|
||
msgid "Insert url tag"
|
||
msgstr "Insertar etiqueta url"
|
||
|
||
#: lazarusidestrconsts.lisinsession
|
||
msgid "In session"
|
||
msgstr "En sesión"
|
||
|
||
#: lazarusidestrconsts.lisinspect
|
||
msgid "&Inspect"
|
||
msgstr "&Inspeccionar"
|
||
|
||
#: lazarusidestrconsts.lisinspectclassinherit
|
||
msgid "%s : Class %s inherits from %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectdata
|
||
msgid "Data"
|
||
msgstr "Datos"
|
||
|
||
#: lazarusidestrconsts.lisinspectdialog
|
||
msgid "Debug Inspector"
|
||
msgstr "Inspector de depuración"
|
||
|
||
#: lazarusidestrconsts.lisinspectmethods
|
||
msgid "Methods"
|
||
msgstr "Métodos"
|
||
|
||
#: lazarusidestrconsts.lisinspectpointerto
|
||
msgid "Pointer to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectproperties
|
||
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
||
msgid "Properties"
|
||
msgstr "Propiedades"
|
||
|
||
#: lazarusidestrconsts.lisinspectshowcolclass
|
||
msgid "Show class column"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectshowcoltype
|
||
msgid "Show type column"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectshowcolvisibility
|
||
msgid "Show visibility column"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectunavailable
|
||
msgid "%s : unavailable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectuseinstance
|
||
msgid "Instance"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectuseinstancehint
|
||
msgid "Use instance class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr "Falló la instalación"
|
||
|
||
#: lazarusidestrconsts.lisinstalled
|
||
msgid "installed"
|
||
msgstr "instalado"
|
||
|
||
#: lazarusidestrconsts.lisinstallitilikethefat
|
||
msgid "Install it, I like the fat"
|
||
msgstr "Instalalo, me gusta lo pesado"
|
||
|
||
#: lazarusidestrconsts.lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "Instalar selección"
|
||
|
||
#: lazarusidestrconsts.lisinstalluninstallpackages
|
||
#, fuzzy
|
||
#| msgid "Install/Uninstall packages"
|
||
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
||
msgid "Install/Uninstall Packages"
|
||
msgstr "Instalar/Desinstalar Paquetes"
|
||
|
||
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
||
msgid "Instead of compile package create a simple Makefile."
|
||
msgstr "En lugar de compilar el paquete crear un simple Makefile."
|
||
|
||
#: lazarusidestrconsts.lisinteractive
|
||
msgid "Interactive"
|
||
msgstr "Interactivo"
|
||
|
||
#: lazarusidestrconsts.lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr "comando no válido"
|
||
|
||
#: lazarusidestrconsts.lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr "Borrado no válido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpression
|
||
msgid "Invalid expression:%s%s%s%s"
|
||
msgstr "Expresión no válida:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr "Expresión no válida.%Sugerencia: La función \"Crear Resourcestring\" espera una constante de cadena en un único archivo. Por favor seleccione la expresión e inténtelo de nuevo."
|
||
|
||
#: lazarusidestrconsts.lisinvalidfilter
|
||
msgid "Invalid filter"
|
||
msgstr "Filtro no válido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
||
msgid "Invalid line, column in message%s%s"
|
||
msgstr "Línea no válida, columna en mensaje%s%s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
||
#, fuzzy
|
||
#| msgid "Invalid macro %s%s%s. The macro name must be a pascal identifier."
|
||
msgid "Invalid macro %s%s%s. The macro name must be a Pascal identifier."
|
||
msgstr "Macro invalida %s%s%s. El nombre de la macro debe ser un identificador pascal."
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
||
msgid "Invalid macro name \"%s\". The name is a keyword."
|
||
msgstr "Nombre no válido de la macro \"%s\". El nombre es una palabra clave."
|
||
|
||
#: lazarusidestrconsts.lisinvalidmask
|
||
msgid "Invalid Mask"
|
||
msgstr "Mascara Invalida"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmode
|
||
msgid "Invalid mode %s"
|
||
msgstr "Modo no válido %s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr "Selección múltiple no válida"
|
||
|
||
#: lazarusidestrconsts.lisinvalidoff
|
||
msgid "Invalid (Off)"
|
||
msgstr "Inválido (Desactivado)"
|
||
|
||
#: lazarusidestrconsts.lisinvalidon
|
||
msgid "Invalid (On)"
|
||
msgstr "Inválido (Activado)"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr "Identificador no válido de Pascal"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
||
#, fuzzy
|
||
#| msgid "The name \"%s\" is not a valid pascal identifier."
|
||
msgid "The name \"%s\" is not a valid Pascal identifier."
|
||
msgstr "El nombre \"%s\" no es un identificador válido de Pascal."
|
||
|
||
#: lazarusidestrconsts.lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr "Nombre de procedimiento no válido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr "Nombre de archivo de proyecto no válido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
||
msgid "Invalid publishing Directory"
|
||
msgstr "Directorio de publcación no válido"
|
||
|
||
#: lazarusidestrconsts.lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr "Selección no válida"
|
||
|
||
#: lazarusidestrconsts.lisinvalidversionin
|
||
msgid "invalid version in %s"
|
||
msgstr "versión invalida en %s"
|
||
|
||
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s ya forma parte del Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "%s%s%s es un nombre de proyecto no válido.%sPor favor escoja otro (e.j. proyecto1.lpi)"
|
||
|
||
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
||
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
||
msgstr "%s es a %s.%sEsta dependencia circular no está permitido."
|
||
|
||
#: lazarusidestrconsts.lisisddirectorynotfound
|
||
msgid "directory not found"
|
||
msgstr "directorio no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisissues
|
||
msgid "Issues"
|
||
msgstr "Incidencias"
|
||
|
||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
||
msgid "I wonder how you did that. Error in the %s:"
|
||
msgstr "Me pregunto como hizo eso. Error en el %s:"
|
||
|
||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
||
msgid "I wonder how you did that: Error in the base directory:"
|
||
msgstr "Me pregunto como hizo eso: Error en el directorio base:"
|
||
|
||
#: lazarusidestrconsts.lisjhjumphistory
|
||
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
||
msgid "Jump History"
|
||
msgstr "Historial de Saltos"
|
||
|
||
#: lazarusidestrconsts.liskeep2
|
||
msgid "Keep"
|
||
msgstr "Mantener"
|
||
|
||
#: lazarusidestrconsts.liskeepfileopen
|
||
msgid "Keep converted files open in editor"
|
||
msgstr "Mantener los archivos convertidos abiertos en el editor"
|
||
|
||
#: lazarusidestrconsts.liskeepfileopenhint
|
||
msgid "All project files will be open in editor after conversion"
|
||
msgstr "Todos los archivos del proyecto serán abiertos en el editor después de la conversión"
|
||
|
||
#: lazarusidestrconsts.liskeepininstalllist
|
||
msgid "Keep in install list"
|
||
msgstr "Mantener en la lista de instalación"
|
||
|
||
#: lazarusidestrconsts.liskeepname
|
||
msgid "Keep name"
|
||
msgstr "Mantener nombre"
|
||
|
||
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
||
msgid "Keep relative indentation of multi line template"
|
||
msgstr "Mantener sangrado en relación a la plantilla de múltiples líneas"
|
||
|
||
#: lazarusidestrconsts.liskeepsubindentation
|
||
msgid "Keep indentation"
|
||
msgstr "Mantener sangrado"
|
||
|
||
#: lazarusidestrconsts.liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr "Mantenerlos y continuar"
|
||
|
||
#: lazarusidestrconsts.liskey
|
||
msgctxt "lazarusidestrconsts.liskey"
|
||
msgid "Key"
|
||
msgstr "Tecla"
|
||
|
||
#: lazarusidestrconsts.liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr "Comandos personalizados"
|
||
|
||
#: lazarusidestrconsts.liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr "Comandos del diseñador"
|
||
|
||
#: lazarusidestrconsts.liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr "Comandos del Inspector de Objetos"
|
||
|
||
#: lazarusidestrconsts.liskeyor2keysequence
|
||
msgid "Key (or 2 key sequence)"
|
||
msgstr "Tecla (o 2 teclas en secuencia)"
|
||
|
||
#: lazarusidestrconsts.liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "Abortar construcción"
|
||
|
||
#: lazarusidestrconsts.liskmaddbpaddress
|
||
msgid "Add Address Breakpoint"
|
||
msgstr "Añadir direcciones de punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.liskmaddbpsource
|
||
msgid "Add Source Breakpoint"
|
||
msgstr "Añadir origen de punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
||
msgid "Add Data/WatchPoint"
|
||
msgstr "Añadir Dato/punto de observación"
|
||
|
||
#: lazarusidestrconsts.liskmaddwatch
|
||
msgid "Add watch"
|
||
msgstr "Añadir punto de observación"
|
||
|
||
#: lazarusidestrconsts.liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr "Construir proyecto/programa"
|
||
|
||
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr "Seleccionar esquema de teclas"
|
||
|
||
#: lazarusidestrconsts.liskmclassic
|
||
msgid "Classic"
|
||
msgstr "Clásico"
|
||
|
||
#: lazarusidestrconsts.liskmcleanupcompiled
|
||
msgid "Clean up build files"
|
||
msgstr "Limpiar archivo de construcción"
|
||
|
||
#: lazarusidestrconsts.liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "Cerrar proyecto"
|
||
|
||
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr "Edtor de defines de CodeTools"
|
||
|
||
#: lazarusidestrconsts.liskmcompileprojectprogram
|
||
msgid "Compile project/program"
|
||
msgstr "Compilar projecto/programa"
|
||
|
||
#: lazarusidestrconsts.liskmconfigbuildfile
|
||
msgid "Config %sBuild File%s"
|
||
msgstr "Configurar %sarchivo de construcción%s"
|
||
|
||
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
||
#, fuzzy
|
||
#| msgid "Configure custom components"
|
||
msgid "Configure Custom Components"
|
||
msgstr "Configurar Componentes Personalizados"
|
||
|
||
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr "Ayuda sensible al contexto"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr "Convertir paquete de Delphi a paquete de Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi project to Lazarus project"
|
||
msgid "Convert Delphi Project to Lazarus Project"
|
||
msgstr "Convertir Proyecto de Delphi a Proyecto de Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi unit to Lazarus unit"
|
||
msgid "Convert Delphi Unit to Lazarus Unit"
|
||
msgstr "Convertir Unidad de Delphi a Unidad de Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
||
#, fuzzy
|
||
#| msgid "Convert DFM file to LFM"
|
||
msgid "Convert DFM File to LFM"
|
||
msgstr "Convertir archivo DFM a LFM"
|
||
|
||
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
||
msgid "Copy selected Components to clipboard"
|
||
msgstr "Copiar Componentes seleccionados al portapapeles"
|
||
|
||
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
||
msgid "Cut selected Components to clipboard"
|
||
msgstr "Cortar componentes seleccionados al portapapeles"
|
||
|
||
#: lazarusidestrconsts.liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr "Borrar último caracter"
|
||
|
||
#: lazarusidestrconsts.liskmdiffeditorfiles
|
||
#, fuzzy
|
||
#| msgid "Diff editor files"
|
||
msgid "Diff Editor Files"
|
||
msgstr "Editor de Archivos Diff"
|
||
|
||
#: lazarusidestrconsts.liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr "Editar Plantillas de Código"
|
||
|
||
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr "Editar ayuda sensible al contexto"
|
||
|
||
#: lazarusidestrconsts.liskmencloseselection
|
||
#, fuzzy
|
||
#| msgid "Enclose selection"
|
||
msgid "Enclose Selection"
|
||
msgstr "Encerrar Selección"
|
||
|
||
#: lazarusidestrconsts.liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr "Evaluar/Modificar"
|
||
|
||
#: lazarusidestrconsts.liskmexampleprojects
|
||
msgid "Example Projects"
|
||
msgstr "Projectos Ejemplo"
|
||
|
||
#: lazarusidestrconsts.liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr "Opciones de herramientas externas"
|
||
|
||
#: lazarusidestrconsts.liskmfindincremental
|
||
#, fuzzy
|
||
#| msgid "Find incremental"
|
||
msgid "Find Incremental"
|
||
msgstr "Búsqueda Incremental"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker0
|
||
msgid "Go to marker 0"
|
||
msgstr "Ir a marca 0"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker1
|
||
msgid "Go to marker 1"
|
||
msgstr "Ir a marca 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker2
|
||
msgid "Go to marker 2"
|
||
msgstr "Ir a marca 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker3
|
||
msgid "Go to marker 3"
|
||
msgstr "Ir a marca 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker4
|
||
msgid "Go to marker 4"
|
||
msgstr "Ir a marca 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker5
|
||
msgid "Go to marker 5"
|
||
msgstr "Ir a marca 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker6
|
||
msgid "Go to marker 6"
|
||
msgstr "Ir a marca 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker7
|
||
msgid "Go to marker 7"
|
||
msgstr "Ir a marca 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker8
|
||
msgid "Go to marker 8"
|
||
msgstr "Ir a marca 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker9
|
||
msgid "Go to marker 9"
|
||
msgstr "Ir a marca 9"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr "Ir a editor de código 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr "Ir a editor de código 10"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr "Ir a editor de código 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr "Ir a editor de código 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr "Ir a editor de código 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr "Ir a editor de código 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr "Ir a editor de código 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr "Ir a editor de código 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr "Ir a editor de código 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr "Ir a editor de código 9"
|
||
|
||
#: lazarusidestrconsts.liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr "Insertar fecha y hora"
|
||
|
||
#: lazarusidestrconsts.liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr "Insertar nombre de usuario"
|
||
|
||
#: lazarusidestrconsts.liskminspect
|
||
msgid "Inspect"
|
||
msgstr "Inspeccionar"
|
||
|
||
#: lazarusidestrconsts.liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr "Esquema de teclado"
|
||
|
||
#: lazarusidestrconsts.liskmlazarusdefault
|
||
msgid "Lazarus (default)"
|
||
msgstr "Lazarus (predeterminado)"
|
||
|
||
#: lazarusidestrconsts.liskmmacosxapple
|
||
msgid "Mac OS X (Apple style)"
|
||
msgstr "Mac OS X (estilo Apple)"
|
||
|
||
#: lazarusidestrconsts.liskmmacosxlaz
|
||
msgid "Mac OS X (Lazarus style)"
|
||
msgstr "Mac OS X (estilo Lazarus)"
|
||
|
||
#: lazarusidestrconsts.liskmnewpackage
|
||
msgid "New package"
|
||
msgstr "Paquete Nuevo"
|
||
|
||
#: lazarusidestrconsts.liskmnewproject
|
||
msgid "New project"
|
||
msgstr "Nuevo proyecto"
|
||
|
||
#: lazarusidestrconsts.liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr "Nuevo proyecto desde archivo"
|
||
|
||
#: lazarusidestrconsts.liskmnewunit
|
||
msgctxt "lazarusidestrconsts.liskmnewunit"
|
||
msgid "New Unit"
|
||
msgstr "Unidad Nueva"
|
||
|
||
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
||
msgid "Note: All keys will be set to the values of the chosen scheme."
|
||
msgstr "Nota: Todas las teclas obtendrán los valores del esquema seleccionado."
|
||
|
||
#: lazarusidestrconsts.liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr "Abrir archivo de paquete"
|
||
|
||
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
||
msgid "Paste Components from clipboard"
|
||
msgstr "Pegar componentes desde el portapapeles"
|
||
|
||
#: lazarusidestrconsts.liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr "Pausar programa"
|
||
|
||
#: lazarusidestrconsts.liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr "Publicar proyecto"
|
||
|
||
#: lazarusidestrconsts.liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr "Compilación rápida, sin enlazar"
|
||
|
||
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
||
msgid "Remove Active File from Project"
|
||
msgstr "Remover Archivo Activo del Proyecto"
|
||
|
||
#: lazarusidestrconsts.liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr "Ejecutar programa"
|
||
|
||
#: lazarusidestrconsts.liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "Guardar todo"
|
||
|
||
#: lazarusidestrconsts.liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "Guardar Como"
|
||
|
||
#: lazarusidestrconsts.liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "Guardar proyecto"
|
||
|
||
#: lazarusidestrconsts.liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "Guardar proyecto como"
|
||
|
||
#: lazarusidestrconsts.liskmselectlineend
|
||
#, fuzzy
|
||
#| msgid "Select line end"
|
||
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
||
msgid "Select Line End"
|
||
msgstr "Seleccionar Fin de Línea"
|
||
|
||
#: lazarusidestrconsts.liskmselectlinestart
|
||
#, fuzzy
|
||
#| msgid "Select line start"
|
||
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
||
msgid "Select Line Start"
|
||
msgstr "Seleccionar Principio de Línea"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagebottom
|
||
#, fuzzy
|
||
#| msgid "Select page bottom"
|
||
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
||
msgid "Select Page Bottom"
|
||
msgstr "Seleccionar Final de Página"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagetop
|
||
#, fuzzy
|
||
#| msgid "Select page top"
|
||
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
||
msgid "Select Page Top"
|
||
msgstr "Seleccionar Principio de Página"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordleft
|
||
#, fuzzy
|
||
#| msgid "Select word left"
|
||
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
||
msgid "Select Word Left"
|
||
msgstr "Seleccionar Palabra Izquierda"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordright
|
||
#, fuzzy
|
||
#| msgid "Select word right"
|
||
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
||
msgid "Select Word Right"
|
||
msgstr "Seleccionar Palabra Derecha"
|
||
|
||
#: lazarusidestrconsts.liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr "Establecer Macador libre"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker0
|
||
msgid "Set marker 0"
|
||
msgstr "Establecer marca 0"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker1
|
||
msgid "Set marker 1"
|
||
msgstr "Establecer marca 1"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker2
|
||
msgid "Set marker 2"
|
||
msgstr "Establecer marca 2"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker3
|
||
msgid "Set marker 3"
|
||
msgstr "Establecer marca 3"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker4
|
||
msgid "Set marker 4"
|
||
msgstr "Establecer marca 4"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker5
|
||
msgid "Set marker 5"
|
||
msgstr "Establecer marca 5"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker6
|
||
msgid "Set marker 6"
|
||
msgstr "Establecer marca 6"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker7
|
||
msgid "Set marker 7"
|
||
msgstr "Establecer marca 7"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker8
|
||
msgid "Set marker 8"
|
||
msgstr "Establecer marca 8"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker9
|
||
msgid "Set marker 9"
|
||
msgstr "Establecer marca 9"
|
||
|
||
#: lazarusidestrconsts.liskmstopprogram
|
||
#, fuzzy
|
||
#| msgid "Stop program"
|
||
msgid "Stop Program"
|
||
msgstr "Parar Programa"
|
||
|
||
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr "Cambiar entre Unidad y Formulario"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker0
|
||
msgid "Toggle marker 0"
|
||
msgstr "Intercambiar marcador 0"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker1
|
||
msgid "Toggle marker 1"
|
||
msgstr "Intercambiar marcador 1"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker2
|
||
msgid "Toggle marker 2"
|
||
msgstr "Intercambiar marcador 2"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker3
|
||
msgid "Toggle marker 3"
|
||
msgstr "Intercambiar marcador 3"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker4
|
||
msgid "Toggle marker 4"
|
||
msgstr "Intercambiar marcador 4"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker5
|
||
msgid "Toggle marker 5"
|
||
msgstr "Intercambiar marcador 5"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker6
|
||
msgid "Toggle marker 6"
|
||
msgstr "Intercambiar marcador 6"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker7
|
||
msgid "Toggle marker 7"
|
||
msgstr "Intercambiar marcador 7"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker8
|
||
msgid "Toggle marker 8"
|
||
msgstr "Intercambiar marcador 8"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker9
|
||
msgid "Toggle marker 9"
|
||
msgstr "Intercambiar marcador 9"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewassembler
|
||
#, fuzzy
|
||
#| msgid "Toggle view Assembler"
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
||
msgid "View Assembler"
|
||
msgstr "Vista Ensamblador"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
||
#, fuzzy
|
||
#| msgid "Toggle view Breakpoints"
|
||
msgid "View Breakpoints"
|
||
msgstr "Vista Puntos de Interrupción"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
||
#, fuzzy
|
||
#| msgid "Toggle view Call Stack"
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
||
msgid "View Call Stack"
|
||
msgstr "Vista Pila(Stack) de llamadas"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
||
msgid "Toggle view Code Browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr "Cambiar vista a Explorador de código"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
||
#, fuzzy
|
||
#| msgid "Toggle view component palette"
|
||
msgid "Toggle View Component Palette"
|
||
msgstr "Cambiar a Vista Paleta de Componentes"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
||
#, fuzzy
|
||
#| msgid "Toggle view Debuger Event Log"
|
||
msgid "View Debuger Event Log"
|
||
msgstr "Cambiar Vista a Log de Eventos del Depurador"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
||
#, fuzzy
|
||
#| msgid "Toggle view Debugger Output"
|
||
msgid "View Debugger Output"
|
||
msgstr "Cambiar Vista a Salida del Depurador"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr "Cambiar vista a Editor de Documentación"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewhistory
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
||
msgid "View History"
|
||
msgstr "Ver Historial"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr "Cambiar vista de botnes de IDE"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
||
#, fuzzy
|
||
#| msgid "Toggle view Local Variables"
|
||
msgid "View Local Variables"
|
||
msgstr "Vista Variables locales"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr "Cambiar vista a Mensajes"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr "Cambiar vista a Inspector de objetos"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
||
msgid "View Terminal Output"
|
||
msgstr "Ver Terminal de Salida"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewregisters
|
||
#, fuzzy
|
||
#| msgid "Toggle view Registers"
|
||
msgid "View Registers"
|
||
msgstr "Vista Registros"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr "Cambiar vista a Resultados de la Búsqueda"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr "Cambiar vista a Editor de código"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewthreads
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
||
msgid "View Threads"
|
||
msgstr "Ver Hilos(Threads)"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewwatches
|
||
#, fuzzy
|
||
#| msgid "Toggle view Watches"
|
||
msgid "View Watches"
|
||
msgstr "Vista Puntos de observación"
|
||
|
||
#: lazarusidestrconsts.liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr "Ver historial de saltos"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr "Ver opciones del proyecto"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectsource
|
||
#, fuzzy
|
||
#| msgid "View project source"
|
||
msgid "View Project Source"
|
||
msgstr "Ver Fuente del Proyecto"
|
||
|
||
#: lazarusidestrconsts.liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr "Ver información de la unidad"
|
||
|
||
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr "Lanzador de aplicación no válido"
|
||
|
||
#: lazarusidestrconsts.lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr "Lanzando línea de comandos"
|
||
|
||
#: lazarusidestrconsts.lislazarus
|
||
msgctxt "lazarusidestrconsts.lislazarus"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdesktopsettings
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr "Opciones de Escritorio de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr "Directorio de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdiroverride
|
||
msgid "directory, to be used as a basedirectory"
|
||
msgstr "Directorio, para ser usado como directorio base"
|
||
|
||
#: lazarusidestrconsts.lislazaruseditorv
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr "IDE de Lazarus v%s"
|
||
|
||
#: lazarusidestrconsts.lislazarusfile
|
||
#| msgid "Lazarus File"
|
||
msgid "Lazarus file"
|
||
msgstr "Fichero de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusform
|
||
msgid "Lazarus form"
|
||
msgstr "Formulario de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr "IDE de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusinclude
|
||
msgid "Lazarus include file"
|
||
msgstr "Fichero include de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr "ID de idioma de Lazarus (por ejemplo: en, de, br, fi)"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr "Nombre de idioma de Lazarus (por ejemplo: inglés, holandés)"
|
||
|
||
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr "lazarus [opciones] <nombre-proyecto>"
|
||
|
||
#: lazarusidestrconsts.lislazarusotherfile
|
||
msgid "Lazarus other file"
|
||
msgstr "Lazarus otro archivo"
|
||
|
||
#: lazarusidestrconsts.lislazaruspackage
|
||
msgid "Lazarus package"
|
||
msgstr "Paquete de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusproject
|
||
msgid "Lazarus project"
|
||
msgstr "Proyecto de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusprojectinfofile
|
||
msgid "Lazarus Project Info file"
|
||
msgstr "Fichero de información de proyecto de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusprojectsource
|
||
msgid "Lazarus project source"
|
||
msgstr "Fuente de proyecto de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusunit
|
||
msgid "Lazarus unit"
|
||
msgstr "Unidad de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazbuildaboaction
|
||
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
||
msgid "Action"
|
||
msgstr "Acción"
|
||
|
||
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr "Elija el directorio de salida para el ejecutable del IDE"
|
||
|
||
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
||
msgid "Are you sure you want to delete this build profile?"
|
||
msgstr "¿Esta seguro de querer borrar este perfil de construcción?"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildmany
|
||
msgid "Build Many"
|
||
msgstr "Construir Muchas"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcommonsettings
|
||
msgid "Common Settings"
|
||
msgstr "Opciones Comunes"
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
||
#| msgid "Confirm before rebuilding Lazarus"
|
||
msgid "Confirm before build"
|
||
msgstr "Confirmar antes de construir"
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
||
msgid "Confirm deletion"
|
||
msgstr "Confirmar supresión"
|
||
|
||
#: lazarusidestrconsts.lislazbuilddebugide
|
||
msgid "Debug IDE"
|
||
msgstr "IDE Depurador"
|
||
|
||
#: lazarusidestrconsts.lislazbuilddefines
|
||
msgid "Defines"
|
||
msgstr "Defines"
|
||
|
||
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
||
msgid "Defines without -d"
|
||
msgstr "Defines sin -d"
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditdefines
|
||
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
||
msgid "Edit Defines"
|
||
msgstr "Editar Defines"
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
||
msgid "Edit list of defines which can be used by any profile"
|
||
msgstr "Editar la lista de defines que pueden ser usadas por cualquier perfil"
|
||
|
||
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Error escribiendo archivo"
|
||
|
||
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
||
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
||
msgstr "%s%s%s%slazbuild no es interactivo, abortando."
|
||
|
||
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
||
msgid "Manage Build Profiles"
|
||
msgstr "Gestionar Perfiles de Construcción"
|
||
|
||
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
||
msgid "Manage profiles"
|
||
msgstr "Gestionar perfiles"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
||
msgid "Name of the active profile"
|
||
msgstr "Nombre del perfil activo"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnewprof
|
||
msgid "Add New Profile"
|
||
msgstr "Añadir un Perfil Nuevo"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
||
msgid "Current build options will be associated with:"
|
||
msgstr "Las actuales opciones de construcción serán asociadas con:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnormalide
|
||
msgid "Normal IDE"
|
||
msgstr "IDE Normal"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptimizedide
|
||
msgid "Optimized IDE"
|
||
msgstr "IDE Optimizado"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr "Opciones:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
||
msgid "Options passed to compiler"
|
||
msgstr "Opciones pasadas al compilador"
|
||
|
||
#: lazarusidestrconsts.lislazbuildprofile
|
||
#, fuzzy
|
||
#| msgid "Profile to Build"
|
||
msgid "Profile to build"
|
||
msgstr "Perfil de construcción"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrenameprof
|
||
msgid "Rename Profile"
|
||
msgstr "Renombrar Perfil"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
||
msgid "New name for profile:"
|
||
msgstr "Nombre nuevo para el perfil:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
||
#| msgid "Restart after building the IDE"
|
||
msgid "Restart after building IDE"
|
||
msgstr "Reiniciar después de construir el IDE"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
||
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
||
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
||
msgstr "Reiniciar Lazarus automaticamente después de construir el IDE (no tiene efecto cuando se construyen otras partes)"
|
||
|
||
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
||
msgid "Select profiles to build"
|
||
msgstr "Seleccionar perfiles de construcción"
|
||
|
||
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
||
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
||
msgid "Show confirmation dialog when building directly from Tools menu"
|
||
msgstr "Mostrar dialogo de confirmación cuando se construya directamente desde el menu Herramientas"
|
||
|
||
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
||
msgid "Show options and defines for command line"
|
||
msgstr "Mostrar opciones y definiciones para línea de comandos"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr "CPU objetivo:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr "Directorio objetivo:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr "OS objetivo"
|
||
|
||
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr "No se ha podido escribir el archivo \"%s\":%s"
|
||
|
||
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
||
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
||
msgid "Update revision.inc"
|
||
msgstr "Actualizar revision.inc"
|
||
|
||
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
||
msgid "Update revision info in \"About Lazarus\" dialog"
|
||
msgstr "Actualizar la información de la revisión en el dialogo \"Acerca de Lazarus\""
|
||
|
||
#: lazarusidestrconsts.lislazcleanupbuildall
|
||
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
||
msgid "Clean Up + Build all"
|
||
msgstr "Limpiar + Construir todo"
|
||
|
||
#: lazarusidestrconsts.lislclwidgettype
|
||
#, fuzzy
|
||
#| msgid "LCL Widget Type"
|
||
msgid "LCL widget type"
|
||
msgstr "Tipo de Widget LCL"
|
||
|
||
#: lazarusidestrconsts.lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr "Añadir enlace a la herencia"
|
||
|
||
#: lazarusidestrconsts.lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr "Copiar desde heredado"
|
||
|
||
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
||
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr "%s no tiene ningún path FPDoc válido.%sNo se puede crear el archivo de fpdoc %s"
|
||
|
||
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr "Mover entradas a heredado"
|
||
|
||
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
||
msgid "No valid FPDoc path"
|
||
msgstr "Path no valido FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr "La unidad %s no es propiedad de ningún paquete o proyecto.%sPor favor, añada la la unidad a un paquete o proyecto.%sNo se pudo crear el archivo fpdoc."
|
||
|
||
#: lazarusidestrconsts.lisleft
|
||
msgctxt "lazarusidestrconsts.lisleft"
|
||
msgid "Left"
|
||
msgstr "Izquierda"
|
||
|
||
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr "Espaciado izquierdo. Este valor de añade al espaciado base y se usa para el espacio izquierdo del control."
|
||
|
||
#: lazarusidestrconsts.lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr "Anclaje izquierdo"
|
||
|
||
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
||
msgstr "Este es el control hermano al cual el lado izquierdo está anclado. Déjelo vacío para que sea el padre."
|
||
|
||
#: lazarusidestrconsts.lisleftsides
|
||
msgid "Left sides"
|
||
msgstr "Lados izquierdos"
|
||
|
||
#: lazarusidestrconsts.lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr "Igualar espacio a la izquierda"
|
||
|
||
#: lazarusidestrconsts.lisless
|
||
msgctxt "lazarusidestrconsts.lisless"
|
||
msgid "Less"
|
||
msgstr "Menos"
|
||
|
||
#: lazarusidestrconsts.lislevels
|
||
msgid "Levels"
|
||
msgstr "Niveles"
|
||
|
||
#: lazarusidestrconsts.lislfmfile
|
||
msgid "LFM file"
|
||
msgstr "archivo LFM"
|
||
|
||
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
||
#, fuzzy
|
||
#| msgid "The LFM file contains unknown properties/classes which do not exist in LCL. They can be replaced or removed."
|
||
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
||
msgstr "El archivo LFM contiene propiedades/clases desconocidas que no existen en LCL. Puede ser reemplazados o eliminados."
|
||
|
||
#: lazarusidestrconsts.lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr "Fichero LFM corrupto"
|
||
|
||
#: lazarusidestrconsts.lislfmisok
|
||
msgid "LFM is ok"
|
||
msgstr "LFM esta bien"
|
||
|
||
#: lazarusidestrconsts.lislgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEsta biblioteca es software libre; usted puede redistribuirlo y/o modificarlo bajo los términos de la GNU Library General Public License publicada por la Free Software Foundation; sea versión 2 de la licencia, o (a su opción) cualquier posterior versión. %sEste programa se distribuye con la esperanza de que sea útil, pero SIN NINGUNA GARANTÍA, ni siquiera la garantía implícita de COMERCIABILIDAD o IDONEIDAD PARA UN DETERMINADO FIN. Consulte la GNU Library General Public License para obtener más detalles. %sUsted debería haber recibido una copia de la GNU Library General Public License junto con esta biblioteca; Si no, escriba a la Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lislibrarypath
|
||
msgid "library path"
|
||
msgstr "ruta de biblioteca"
|
||
|
||
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
||
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
|
||
msgstr "Una biblioteca compartida de Free Pascal (.dll en Windows, .so en Linux, .dylib en MacOS X)."
|
||
|
||
#: lazarusidestrconsts.lisline
|
||
msgid "Line:"
|
||
msgstr "Línea:"
|
||
|
||
#: lazarusidestrconsts.lislinelength
|
||
msgid "Line/Length"
|
||
msgstr "Línea/Longitud"
|
||
|
||
#: lazarusidestrconsts.lislink
|
||
msgid "Link:"
|
||
msgstr "Enlace:"
|
||
|
||
#: lazarusidestrconsts.lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr "opciones del enlazador"
|
||
|
||
#: lazarusidestrconsts.lislinktarget
|
||
msgid "Link target"
|
||
msgstr "Enlace objetivo:"
|
||
|
||
#: lazarusidestrconsts.lislistofallcasevalues
|
||
msgid "list of all case values"
|
||
msgstr "listar todos los valores case"
|
||
|
||
#: lazarusidestrconsts.lisloadedsuccessfully
|
||
msgid "Loaded successfully"
|
||
msgstr "Cargado correctamente"
|
||
|
||
#: lazarusidestrconsts.lisloadingfailed
|
||
msgid "Loading %s failed."
|
||
msgstr "La carga de %s falló"
|
||
|
||
#: lazarusidestrconsts.lisloadmacrofrom
|
||
msgid "Load macro from"
|
||
msgstr "Cargar macro desde"
|
||
|
||
#: lazarusidestrconsts.lislocals
|
||
msgid "Locals"
|
||
msgstr "Locales"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgcopyname
|
||
msgid "&Copy Name"
|
||
msgstr "&Copiar Nombre"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgcopyvalue
|
||
msgid "C&opy Value"
|
||
msgstr "C&opiar Valor"
|
||
|
||
#: lazarusidestrconsts.lislocalsnotevaluated
|
||
msgid "Locals not evaluated"
|
||
msgstr "Locales no evaluadas"
|
||
|
||
#: lazarusidestrconsts.lislogcallstack
|
||
msgid "Log Call Stack"
|
||
msgstr "Log pila(stack) de llamadas"
|
||
|
||
#: lazarusidestrconsts.lislogcallstacklimit
|
||
msgid "(frames limit. 0 - no limits)"
|
||
msgstr "(marco limite. 0 - sin limites)"
|
||
|
||
#: lazarusidestrconsts.lislogevalexpression
|
||
msgctxt "lazarusidestrconsts.lislogevalexpression"
|
||
msgid "Eval expression"
|
||
msgstr "Evaluar expresión"
|
||
|
||
#: lazarusidestrconsts.lislogmessage
|
||
#, fuzzy
|
||
#| msgid "Log message"
|
||
msgid "Log Message"
|
||
msgstr "Registrar Mensaje"
|
||
|
||
#: lazarusidestrconsts.lislowercasestring
|
||
msgid "lowercase string"
|
||
msgstr "cadena en minúsculas"
|
||
|
||
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
||
msgid "Lowercase string given as parameter"
|
||
msgstr "cadena dada como parámetro en minúsculas"
|
||
|
||
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
||
msgid "lpk has vanished on disk. Using as alternative%s"
|
||
msgstr "lpk ha desaparecido en disco. Utilizando como alternativa %s"
|
||
|
||
#: lazarusidestrconsts.lislpkismissing
|
||
msgid "lpk is missing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislrsincludefiles
|
||
msgid "lrs include files"
|
||
msgstr "Archivos de inclusión .lrs"
|
||
|
||
#: lazarusidestrconsts.lismacpascal
|
||
msgid "Mac Pascal"
|
||
msgstr "Mac Pascal"
|
||
|
||
#: lazarusidestrconsts.lismacro
|
||
msgid "Macro %s"
|
||
msgstr "Macro %s"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr "Introducir datos"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr "Introducir parámetros de ejecución"
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
||
#, fuzzy
|
||
#| msgid "Main Unit has Application.CreateForm statements"
|
||
msgid "Main unit has Application.CreateForm statements"
|
||
msgstr "La unidad principal como Application.Instrucciones CreateForm"
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
|
||
#, fuzzy
|
||
#| msgid "Main Unit has Application.Title statements"
|
||
msgid "Main unit has Application.Title statements"
|
||
msgstr "La unidad principal como Application.Instrucciones Title"
|
||
|
||
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
||
#, fuzzy
|
||
#| msgid "Main Unit has Uses Section containing all Units of project"
|
||
msgid "Main unit has Uses section containing all units of project"
|
||
msgstr "La unidad principal tiene una sección uses que contiene todas las unidades del proyecto"
|
||
|
||
#: lazarusidestrconsts.lismainunitispascalsource
|
||
#, fuzzy
|
||
#| msgid "Main Unit is Pascal Source"
|
||
msgid "Main unit is Pascal source"
|
||
msgstr "La unidad principal es una fuente Pascal"
|
||
|
||
#: lazarusidestrconsts.lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr "Hacer ejecutable"
|
||
|
||
#: lazarusidestrconsts.lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr "Make no encontrado"
|
||
|
||
#: lazarusidestrconsts.lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr "Crear ResourceString"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "Añadir a sección"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
||
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr "Resourcestring %s%s%s ya existe.%sPor favor escoja otro nombre.%sUse Ignorar para añadirla de todas formas."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr "Opciones de conversión"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr "Identificador Personalizado"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
||
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Identificador"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr "Longitud de identificador:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr "Prefijo de Identificador:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr "Insertar afabéticamente"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr "Insertar sensible al contexto"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr "Sección de Resourcesting no válida"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr "Por favor, escoja una sección de resourcestring de la lista."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr "Ya existe Resourcestring"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr "Sección Resourcestring:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr "Previsualizar fuente"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr "Constante de Cadena en código fuente"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr "Las cadenas con mismo valor:"
|
||
|
||
#: lazarusidestrconsts.lismanagesourceeditors
|
||
msgid "Manage Source Editors ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismaxs
|
||
msgid "Max %d"
|
||
msgstr "Máx %d"
|
||
|
||
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
||
msgid "%s Maybe you have to recompile the package."
|
||
msgstr "%s Tal vez tenga que recompilar el paquete."
|
||
|
||
#: lazarusidestrconsts.lismeaction
|
||
msgctxt "lazarusidestrconsts.lismeaction"
|
||
msgid "Action"
|
||
msgstr "Acción"
|
||
|
||
#: lazarusidestrconsts.lismemorydump
|
||
msgid "Memory Dump"
|
||
msgstr "Volcado de Memoria"
|
||
|
||
#: lazarusidestrconsts.lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "Abortar Construcción"
|
||
|
||
#: lazarusidestrconsts.lismenuaboutfpc
|
||
msgid "About FPC"
|
||
msgstr "Acerca de FPC"
|
||
|
||
#: lazarusidestrconsts.lismenuaddbreakpoint
|
||
#, fuzzy
|
||
#| msgid "Add breakpoint"
|
||
msgid "Add &Breakpoint"
|
||
msgstr "Añadir punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
||
msgid "Add Active File to Package ..."
|
||
msgstr "Añadir archivo Activo al paquete ..."
|
||
|
||
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
||
#, fuzzy
|
||
#| msgid "Add jump point to history"
|
||
msgid "Add Jump Point to History"
|
||
msgstr "Añadir Punto de Salto al historial"
|
||
|
||
#: lazarusidestrconsts.lismenuaddtoproject
|
||
#, fuzzy
|
||
#| msgid "Add editor file to Project"
|
||
msgid "Add Editor File to Project"
|
||
msgstr "Añadir Archivo de Editor al Proyecto"
|
||
|
||
#: lazarusidestrconsts.lismenuaddwatch
|
||
#, fuzzy
|
||
#| msgid "Add watch ..."
|
||
msgid "Add &Watch ..."
|
||
msgstr "Añadir Punto de Observación ..."
|
||
|
||
#: lazarusidestrconsts.lismenubeaklinesinselection
|
||
#, fuzzy
|
||
#| msgid "Break Lines in selection"
|
||
msgid "Break Lines in Selection"
|
||
msgstr "Dividir Líneas en la Selección"
|
||
|
||
#: lazarusidestrconsts.lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "Construir Archivo"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarus
|
||
#, fuzzy
|
||
#| msgid "Build Lazarus with current profile"
|
||
msgid "Build Lazarus with Current Profile"
|
||
msgstr "Construir Lazarus con el Perfil Actual"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarusprof
|
||
#, fuzzy
|
||
#| msgid "Build Lazarus with profile: %s"
|
||
msgid "Build Lazarus with Profile: %s"
|
||
msgstr "Construir Lazarus con el Perfil: %s"
|
||
|
||
#: lazarusidestrconsts.lismenuchecklfm
|
||
#, fuzzy
|
||
#| msgid "Check LFM file in editor"
|
||
msgid "Check LFM File in Editor"
|
||
msgstr "Verificar archivo LFM en editor"
|
||
|
||
#: lazarusidestrconsts.lismenucleandirectory
|
||
#, fuzzy
|
||
#| msgid "Clean directory ..."
|
||
msgid "Clean Directory ..."
|
||
msgstr "Limpiar Directorio ..."
|
||
|
||
#: lazarusidestrconsts.lismenucleanupcompiled
|
||
msgid "Clean up Build Files ..."
|
||
msgstr "Limpiar Archivos de Construcción ..."
|
||
|
||
#: lazarusidestrconsts.lismenucloseall
|
||
#, fuzzy
|
||
#| msgid "Close A&ll Editor Files"
|
||
msgid "Close A&ll"
|
||
msgstr "Cerrar Todos"
|
||
|
||
#: lazarusidestrconsts.lismenucloseeditorfile
|
||
msgid "&Close Editor File"
|
||
msgstr "&Cerrar Editor Archivo"
|
||
|
||
#: lazarusidestrconsts.lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "Cerrar Proyecto"
|
||
|
||
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
||
#, fuzzy
|
||
#| msgid "CodeTools defines editor ..."
|
||
msgid "CodeTools Defines Editor ..."
|
||
msgstr "Editor de Defines de CodeTools ..."
|
||
|
||
#: lazarusidestrconsts.lismenucommentselection
|
||
#, fuzzy
|
||
#| msgid "Comment selection"
|
||
msgid "Comment Selection"
|
||
msgstr "Comentar Selección"
|
||
|
||
#: lazarusidestrconsts.lismenucompletecode
|
||
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Completar código"
|
||
|
||
#: lazarusidestrconsts.lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr "Configurar archivo Construir+Ejecutar"
|
||
|
||
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
||
#, fuzzy
|
||
#| msgid "Configure custom components ..."
|
||
msgid "Configure Custom Components ..."
|
||
msgstr "Configurar Componentes Personalizados ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigexternaltools
|
||
#, fuzzy
|
||
#| msgid "Configure external tools ..."
|
||
msgid "Configure External Tools ..."
|
||
msgstr "Configuración de Herramientas Externas ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr "Configurar \"Construir Lazarus\" ..."
|
||
|
||
#: lazarusidestrconsts.lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr "Ayuda sensible al contexto"
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi package to Lazarus package ..."
|
||
msgid "Convert Delphi Package to Lazarus Package ..."
|
||
msgstr "Convertir Paquete de Delphi a Paquete de Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi project to Lazarus project ..."
|
||
msgid "Convert Delphi Project to Lazarus Project ..."
|
||
msgstr "Convertir Proyecto de Delphi a Proyecto de Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi unit to Lazarus unit ..."
|
||
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
||
msgstr "Convertir Unidad de Delphi a Unidad de Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
||
#, fuzzy
|
||
#| msgid "Convert binary DFM to text LFM + check syntax ..."
|
||
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
||
msgstr "Convertir Archivo Binario DFM a Texto LFM y Comprobar Sintaxis..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertencoding
|
||
#, fuzzy
|
||
#| msgid "Convert encoding of projects/packages ..."
|
||
msgid "Convert Encoding of Projects/Packages ..."
|
||
msgstr "Convertir Codificación de página de Proyectos/Paquetes ..."
|
||
|
||
#: lazarusidestrconsts.lismenudebugwindows
|
||
#, fuzzy
|
||
#| msgid "Debug windows"
|
||
msgid "Debug Windows"
|
||
msgstr "Ventanas de Depuración"
|
||
|
||
#: lazarusidestrconsts.lismenudiff
|
||
#| msgid "Diff"
|
||
msgctxt "lazarusidestrconsts.lismenudiff"
|
||
msgid "Diff ..."
|
||
msgstr "Diff ..."
|
||
|
||
#: lazarusidestrconsts.lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "&Editar"
|
||
|
||
#: lazarusidestrconsts.lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr "Plantillas de Código ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr "Editar Ayuda sensible al contexto"
|
||
|
||
#: lazarusidestrconsts.lismenueditinstallpkgs
|
||
#, fuzzy
|
||
#| msgid "Install/Uninstall packages ..."
|
||
msgid "Install/Uninstall Packages ..."
|
||
msgstr "Instalar/Desinstalar Paquetes ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditor
|
||
#, fuzzy
|
||
#| msgid "Menu Editor..."
|
||
msgid "Menu Editor ..."
|
||
msgstr "Editor de Menu ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorcreatesubmenu
|
||
msgid "Create Submenu"
|
||
msgstr "Crear Submenú"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletefromtemplate
|
||
#, fuzzy
|
||
#| msgid "Delete From Template..."
|
||
msgid "Delete From Template ..."
|
||
msgstr "Borrar desde Plantilla ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditordeleteitem
|
||
msgid "Delete Item"
|
||
msgstr "Borrar Elemento"
|
||
|
||
#: lazarusidestrconsts.lismenueditorhandleonclickevent
|
||
msgid "Handle OnClick Event"
|
||
msgstr "Procesar Evento OnClick"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
|
||
#, fuzzy
|
||
#| msgid "Insert From Template..."
|
||
msgid "Insert From Template ..."
|
||
msgstr "Insertar desde Plantilla ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
|
||
msgid "Insert New Item (after)"
|
||
msgstr "Insertar Nuevo Elemento (después)"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
|
||
msgid "Insert New Item (before)"
|
||
msgstr "Insertar Nuevo Elemento (antes)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr "Editor de Menú"
|
||
|
||
#: lazarusidestrconsts.lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr "Mover Abajo (o derecha)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr "Mover Arriba (o Izquierda)"
|
||
|
||
#: lazarusidestrconsts.lismenueditornewtemplatedescription
|
||
#, fuzzy
|
||
#| msgid "New Template Description..."
|
||
msgid "New Template Description ..."
|
||
msgstr "Nueva descripción de plantilla ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorsaveastemplate
|
||
#, fuzzy
|
||
#| msgid "Save As Template..."
|
||
msgid "Save As Template ..."
|
||
msgstr "Guardar como Plantilla ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorselectmenu
|
||
msgid "Select Menu:"
|
||
msgstr "Seleccionar Menú:"
|
||
|
||
#: lazarusidestrconsts.lismenueditorselecttemplate
|
||
msgid "Select Template:"
|
||
msgstr "Seleccionar plantilla:"
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplatepreview
|
||
msgid "Template Preview"
|
||
msgstr "Previsualizar Plantilla"
|
||
|
||
#: lazarusidestrconsts.lismenuencloseinifdef
|
||
msgid "Enclose in $IFDEF ..."
|
||
msgstr "Encerrar en $IFDEF ..."
|
||
|
||
#: lazarusidestrconsts.lismenuencloseselection
|
||
#, fuzzy
|
||
#| msgid "Enclose selection ..."
|
||
msgid "Enclose Selection ..."
|
||
msgstr "Encerrar Selección ..."
|
||
|
||
#: lazarusidestrconsts.lismenuevaluate
|
||
#, fuzzy
|
||
#| msgid "Evaluate/Modify ..."
|
||
msgid "E&valuate/Modify ..."
|
||
msgstr "Evaluar/Modificar ..."
|
||
|
||
#: lazarusidestrconsts.lismenuexampleprojects
|
||
msgid "Example Projects ..."
|
||
msgstr "Proyectos Ejemplo ..."
|
||
|
||
#: lazarusidestrconsts.lismenuextractproc
|
||
#, fuzzy
|
||
#| msgid "Extract procedure ..."
|
||
msgid "Extract Procedure ..."
|
||
msgstr "Extraer Procedimiento ..."
|
||
|
||
#: lazarusidestrconsts.lismenufile
|
||
msgid "&File"
|
||
msgstr "&Archivo"
|
||
|
||
#: lazarusidestrconsts.lismenufind
|
||
msgctxt "lazarusidestrconsts.lismenufind"
|
||
msgid "Find"
|
||
msgstr "Buscar"
|
||
|
||
#: lazarusidestrconsts.lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr "&Buscar..."
|
||
|
||
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
||
#, fuzzy
|
||
#| msgid "Find other end of code block"
|
||
msgid "Find Other End of Code Block"
|
||
msgstr "Buscar Otro Final del Bloque de Código"
|
||
|
||
#: lazarusidestrconsts.lismenufindcodeblockstart
|
||
#, fuzzy
|
||
#| msgid "Find code block start"
|
||
msgid "Find Start of Code Block"
|
||
msgstr "Buscar Inicio del Bloque de Código"
|
||
|
||
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
||
#, fuzzy
|
||
#| msgid "Find Declaration at cursor"
|
||
msgid "Find Declaration at Cursor"
|
||
msgstr "Buscar Declaración desde Cursor"
|
||
|
||
#: lazarusidestrconsts.lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr "Buscar Referencias del Identificador ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindinfiles
|
||
#, fuzzy
|
||
#| msgid "Find &in files ..."
|
||
msgid "Find &in Files ..."
|
||
msgstr "Buscar &en Archivos ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "Buscar &Siguiente"
|
||
|
||
#: lazarusidestrconsts.lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "Buscar &Anterior"
|
||
|
||
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
||
msgid "Find References Of Used Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenugeneraloptions
|
||
msgid "Options ..."
|
||
msgstr "Opciones ..."
|
||
|
||
#: lazarusidestrconsts.lismenugotoincludedirective
|
||
#, fuzzy
|
||
#| msgid "Goto include directive"
|
||
msgid "Goto Include Directive"
|
||
msgstr "Ir a Directiva de Inclusión"
|
||
|
||
#: lazarusidestrconsts.lismenugotoline
|
||
#, fuzzy
|
||
#| msgid "Goto line ..."
|
||
msgid "Goto Line ..."
|
||
msgstr "Ir a Línea ..."
|
||
|
||
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
||
#, fuzzy
|
||
#| msgid "Guess misplaced IFDEF/ENDIF"
|
||
msgid "Guess Misplaced IFDEF/ENDIF"
|
||
msgstr "Buscar IFDEF/ENDIF Fuera de Lugar"
|
||
|
||
#: lazarusidestrconsts.lismenuguessunclosedblock
|
||
#, fuzzy
|
||
#| msgid "Guess unclosed block"
|
||
msgid "Guess Unclosed Block"
|
||
msgstr "Buscar bloque sin Cerrar"
|
||
|
||
#: lazarusidestrconsts.lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "A&yuda"
|
||
|
||
#: lazarusidestrconsts.lismenuideinternals
|
||
#, fuzzy
|
||
#| msgid "IDE internals"
|
||
msgid "IDE Internals"
|
||
msgstr "Interioridades del IDE"
|
||
|
||
#: lazarusidestrconsts.lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr "Búsqueda incremental"
|
||
|
||
#: lazarusidestrconsts.lismenuindentselection
|
||
#, fuzzy
|
||
#| msgid "Indent selection"
|
||
msgid "Indent Selection"
|
||
msgstr "Sangrar selección"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
||
#, fuzzy
|
||
#| msgid "ChangeLog entry"
|
||
msgid "ChangeLog Entry"
|
||
msgstr "Entrada de registro de cambios"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcharacter
|
||
#, fuzzy
|
||
#| msgid "Insert from Character Map"
|
||
msgid "Insert from Character Map ..."
|
||
msgstr "Insertar desde Mapa de Caracteres ..."
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
||
#, fuzzy
|
||
#| msgid "Insert CVS keyword"
|
||
msgid "Insert CVS Keyword"
|
||
msgstr "Insertar palabra clave de CVS"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertdatetime
|
||
#, fuzzy
|
||
#| msgid "Current date and time"
|
||
msgid "Current Date and Time"
|
||
msgstr "Fecha y Hora Actual"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertfilename
|
||
msgid "Insert Full Filename ..."
|
||
msgstr "Insertar Nombre de archivo completo ..."
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgeneral
|
||
#| msgid "General"
|
||
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
||
msgid "Insert General"
|
||
msgstr "General"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgplnotice
|
||
#, fuzzy
|
||
#| msgid "GPL notice"
|
||
msgid "GPL Notice"
|
||
msgstr "Aviso GPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
||
#, fuzzy
|
||
#| msgid "LGPL notice"
|
||
msgid "LGPL Notice"
|
||
msgstr "Aviso LGPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmitnotice
|
||
msgid "MIT Notice"
|
||
msgstr "Aviso MIT"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
||
#, fuzzy
|
||
#| msgid "Modified LGPL notice"
|
||
msgid "Modified LGPL Notice"
|
||
msgstr "Aviso LGPL modificado"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertusername
|
||
#, fuzzy
|
||
#| msgid "Current username"
|
||
msgid "Current Username"
|
||
msgstr "Nombre de usuario actual"
|
||
|
||
#: lazarusidestrconsts.lismenuinspect
|
||
#, fuzzy
|
||
#| msgid "Inspect ..."
|
||
msgctxt "lazarusidestrconsts.lismenuinspect"
|
||
msgid "&Inspect ..."
|
||
msgstr "Inspeccionar"
|
||
|
||
#: lazarusidestrconsts.lismenujumpback
|
||
#, fuzzy
|
||
#| msgid "Jump back"
|
||
msgid "Jump Back"
|
||
msgstr "Saltar hacia atrás"
|
||
|
||
#: lazarusidestrconsts.lismenujumpforward
|
||
#, fuzzy
|
||
#| msgid "Jump forward"
|
||
msgid "Jump Forward"
|
||
msgstr "Saltar hacia adelante"
|
||
|
||
#: lazarusidestrconsts.lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr "Saltar a"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoimplementation
|
||
msgid "Jump to Implementation"
|
||
msgstr "Saltar a la Implementacion"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonextbookmark
|
||
#, fuzzy
|
||
#| msgid "Jump to next bookmark"
|
||
msgid "Jump to Next Bookmark"
|
||
msgstr "Saltar al marcador siguiente"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonexterror
|
||
#, fuzzy
|
||
#| msgid "Jump to next error"
|
||
msgid "Jump to Next Error"
|
||
msgstr "Saltar al error siguiente"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
||
#, fuzzy
|
||
#| msgid "Jump to previous bookmark"
|
||
msgid "Jump to Previous Bookmark"
|
||
msgstr "Saltar al marcador anterior"
|
||
|
||
#: lazarusidestrconsts.lismenujumptopreverror
|
||
#, fuzzy
|
||
#| msgid "Jump to previous error"
|
||
msgid "Jump to Previous Error"
|
||
msgstr "Saltar al error anterior"
|
||
|
||
#: lazarusidestrconsts.lismenulowercaseselection
|
||
#, fuzzy
|
||
#| msgid "Lowercase selection"
|
||
msgid "Lowercase Selection"
|
||
msgstr "Selección en minúsculas"
|
||
|
||
#: lazarusidestrconsts.lismenumacrolistview
|
||
msgid "Editor Macros ..."
|
||
msgstr "Editor Macros ..."
|
||
|
||
#: lazarusidestrconsts.lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr "Crear ResourceString ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewcomponent
|
||
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
||
msgid "New Component"
|
||
msgstr "Nuevo Componente"
|
||
|
||
#: lazarusidestrconsts.lismenunewform
|
||
msgid "New Form"
|
||
msgstr "Nuevo Formulario"
|
||
|
||
#: lazarusidestrconsts.lismenunewother
|
||
msgid "New ..."
|
||
msgstr "Nuevo ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewpackage
|
||
#, fuzzy
|
||
#| msgid "New package ..."
|
||
msgid "New Package ..."
|
||
msgstr "Paquete Nuevo ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "Nuevo Proyecto ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewprojectfromfile
|
||
#, fuzzy
|
||
#| msgid "New Project from file ..."
|
||
msgid "New Project from File ..."
|
||
msgstr "Nuevo proyecto desde archivo ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewunit
|
||
msgctxt "lazarusidestrconsts.lismenunewunit"
|
||
msgid "New Unit"
|
||
msgstr "Nueva Unidad"
|
||
|
||
#: lazarusidestrconsts.lismenuok
|
||
msgctxt "lazarusidestrconsts.lismenuok"
|
||
msgid "&OK"
|
||
msgstr "&Aceptar"
|
||
|
||
#: lazarusidestrconsts.lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "Ayuda en línea"
|
||
|
||
#: lazarusidestrconsts.lismenuopen
|
||
#| msgid "Open ..."
|
||
msgid "&Open ..."
|
||
msgstr "&Abrir ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
||
#, fuzzy
|
||
#| msgid "Open filename at cursor"
|
||
msgid "Open Filename at Cursor"
|
||
msgstr "Abrir nombre de archivo en cursor"
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackage
|
||
#, fuzzy
|
||
#| msgid "Open loaded package ..."
|
||
msgid "Open Loaded Package ..."
|
||
msgstr "Abrir paquete cargado ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackagefile
|
||
#, fuzzy
|
||
#| msgid "Open package file (.lpk) ..."
|
||
msgid "Open Package File (.lpk) ..."
|
||
msgstr "Abrir archivo de paquete (.lpk) ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
||
#, fuzzy
|
||
#| msgid "Open package of current unit"
|
||
msgid "Open Package of Current Unit"
|
||
msgstr "Abrir paquete de unidad actual"
|
||
|
||
#: lazarusidestrconsts.lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "Abrir Proyecto ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecent
|
||
#| msgid "Open &Recent ..."
|
||
msgid "Open &Recent"
|
||
msgstr "Abrir &Reciente"
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentpkg
|
||
#, fuzzy
|
||
#| msgid "Open recent package"
|
||
msgid "Open Recent Package"
|
||
msgstr "Abrir Paquete Reciente"
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentproject
|
||
#| msgid "Open Recent Project ..."
|
||
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
||
msgid "Open Recent Project"
|
||
msgstr "Abrir Proyecto Reciente"
|
||
|
||
#: lazarusidestrconsts.lismenupackage
|
||
#| msgid "&Package"
|
||
msgid "Pa&ckage"
|
||
msgstr "Pa&quete"
|
||
|
||
#: lazarusidestrconsts.lismenupackagegraph
|
||
#, fuzzy
|
||
#| msgid "Package Graph ..."
|
||
msgid "Package Graph"
|
||
msgstr "Gráfico de Paquete"
|
||
|
||
#: lazarusidestrconsts.lismenupackagelinks
|
||
#, fuzzy
|
||
#| msgid "Package links ..."
|
||
msgid "Package Links ..."
|
||
msgstr "Enlaces de Paquete ..."
|
||
|
||
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
||
msgid "New package component"
|
||
msgstr "Nuevo paquete componente"
|
||
|
||
#: lazarusidestrconsts.lismenuprocedurelist
|
||
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
||
msgid "Procedure List ..."
|
||
msgstr "Lista de Procedimientos ..."
|
||
|
||
#: lazarusidestrconsts.lismenuproject
|
||
msgid "&Project"
|
||
msgstr "&Proyecto"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr "Inspector de Proyecto"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr "Opciones del Proyecto ..."
|
||
|
||
#: lazarusidestrconsts.lismenuprojectrun
|
||
#, fuzzy
|
||
#| msgid "Run"
|
||
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
||
msgid "&Run"
|
||
msgstr "Ejecuta&r"
|
||
|
||
#: lazarusidestrconsts.lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr "Publicar proyecto ..."
|
||
|
||
#: lazarusidestrconsts.lismenuquickcompile
|
||
#, fuzzy
|
||
#| msgid "Quick compile"
|
||
msgid "Quick Compile"
|
||
msgstr "Compilado Rápido"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
||
#, fuzzy
|
||
#| msgid "Quick syntax check"
|
||
msgid "Quick Syntax Check"
|
||
msgstr "Comprobación Rápida de la Sintaxis"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
||
msgid "Quick syntax check OK"
|
||
msgstr "Verificación rápida de sintaxis exitosa"
|
||
|
||
#: lazarusidestrconsts.lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr "Eliminar del proyecto ..."
|
||
|
||
#: lazarusidestrconsts.lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr "Renombrar Identificador ..."
|
||
|
||
#: lazarusidestrconsts.lismenureportingbug
|
||
#, fuzzy
|
||
#| msgid "Reporting a bug"
|
||
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
||
msgid "Reporting a Bug"
|
||
msgstr "Reportar un error"
|
||
|
||
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
||
#, fuzzy
|
||
#| msgid "Rescan FPC source directory"
|
||
msgid "Rescan FPC Source Directory"
|
||
msgstr "Escanear de nuevo el directorio de fuentes de FPC"
|
||
|
||
#: lazarusidestrconsts.lismenuresetdebugger
|
||
#, fuzzy
|
||
#| msgid "Reset debugger"
|
||
msgid "Reset Debugger"
|
||
msgstr "Reiniciar Depurador"
|
||
|
||
#: lazarusidestrconsts.lismenurevert
|
||
msgid "Revert"
|
||
msgstr "Deshacer"
|
||
|
||
#: lazarusidestrconsts.lismenurun
|
||
msgctxt "lazarusidestrconsts.lismenurun"
|
||
msgid "&Run"
|
||
msgstr "Ejecuta&r"
|
||
|
||
#: lazarusidestrconsts.lismenurunfile
|
||
msgid "Run File"
|
||
msgstr "Ejecutar archivo"
|
||
|
||
#: lazarusidestrconsts.lismenurunparameters
|
||
#, fuzzy
|
||
#| msgid "Run Parameters ..."
|
||
msgid "Run &Parameters ..."
|
||
msgstr "Parámetros de ejecución ..."
|
||
|
||
#: lazarusidestrconsts.lismenuruntocursor
|
||
#, fuzzy
|
||
#| msgid "Run to &Cursor"
|
||
msgid "Step over to &Cursor"
|
||
msgstr "Ejecutar hasta el &Cursor"
|
||
|
||
#: lazarusidestrconsts.lismenusave
|
||
#| msgid "Save"
|
||
msgctxt "lazarusidestrconsts.lismenusave"
|
||
msgid "&Save"
|
||
msgstr "&Guardar"
|
||
|
||
#: lazarusidestrconsts.lismenusaveas
|
||
#| msgid "Save As ..."
|
||
msgid "Save &As ..."
|
||
msgstr "Guard&ar Como ..."
|
||
|
||
#: lazarusidestrconsts.lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "Guardar Proyecto"
|
||
|
||
#: lazarusidestrconsts.lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "Guardar proyecto como ..."
|
||
|
||
#: lazarusidestrconsts.lismenusearch
|
||
msgid "&Search"
|
||
msgstr "&Buscar"
|
||
|
||
#: lazarusidestrconsts.lismenuselect
|
||
msgid "Select"
|
||
msgstr "Seleccionar"
|
||
|
||
#: lazarusidestrconsts.lismenuselectall
|
||
#, fuzzy
|
||
#| msgid "Select all"
|
||
msgctxt "lazarusidestrconsts.lismenuselectall"
|
||
msgid "Select All"
|
||
msgstr "Seleccionar Todo"
|
||
|
||
#: lazarusidestrconsts.lismenuselectcodeblock
|
||
#, fuzzy
|
||
#| msgid "Select code block"
|
||
msgid "Select Code Block"
|
||
msgstr "Seleccionar Bloque de Código"
|
||
|
||
#: lazarusidestrconsts.lismenuselectline
|
||
#, fuzzy
|
||
#| msgid "Select line"
|
||
msgid "Select Line"
|
||
msgstr "Seleccionar Línea"
|
||
|
||
#: lazarusidestrconsts.lismenuselectparagraph
|
||
#, fuzzy
|
||
#| msgid "Select paragraph"
|
||
msgid "Select Paragraph"
|
||
msgstr "Seleccionar Párrafo"
|
||
|
||
#: lazarusidestrconsts.lismenuselecttobrace
|
||
#, fuzzy
|
||
#| msgid "Select to brace"
|
||
msgid "Select to Brace"
|
||
msgstr "Seleccionar Paréntesis"
|
||
|
||
#: lazarusidestrconsts.lismenuselectword
|
||
#, fuzzy
|
||
#| msgid "Select word"
|
||
msgid "Select Word"
|
||
msgstr "Sleccionar palabra"
|
||
|
||
#: lazarusidestrconsts.lismenusetfreebookmark
|
||
#, fuzzy
|
||
#| msgid "Set a free bookmark"
|
||
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
||
msgid "Set a Free Bookmark"
|
||
msgstr "Establecer un Marcador Libre"
|
||
|
||
#: lazarusidestrconsts.lismenushowexecutionpoint
|
||
#, fuzzy
|
||
#| msgid "S&how execution point"
|
||
msgid "S&how Execution Point"
|
||
msgstr "Ver Punto de Ejecucción"
|
||
|
||
#: lazarusidestrconsts.lismenusortselection
|
||
#, fuzzy
|
||
#| msgid "Sort selection ..."
|
||
msgid "Sort Selection ..."
|
||
msgstr "Ordenar selección ..."
|
||
|
||
#: lazarusidestrconsts.lismenusource
|
||
msgid "S&ource"
|
||
msgstr "&Fuente"
|
||
|
||
#: lazarusidestrconsts.lismenustepinto
|
||
#, fuzzy
|
||
#| msgid "Step in&to"
|
||
msgid "Step In&to"
|
||
msgstr "Paso a paso por Ins&trucciones"
|
||
|
||
#: lazarusidestrconsts.lismenustepintocontext
|
||
#, fuzzy
|
||
#| msgid "Step into (Context)"
|
||
msgid "Step Into (Context)"
|
||
msgstr "Paso a paso por Instrucciones (Contexto)"
|
||
|
||
#: lazarusidestrconsts.lismenustepintoinstr
|
||
#, fuzzy
|
||
#| msgid "Step into instruction"
|
||
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
|
||
msgid "Step Into Instruction"
|
||
msgstr "Avanzar una Instrucción"
|
||
|
||
#: lazarusidestrconsts.lismenustepintoinstrhint
|
||
#, fuzzy
|
||
#| msgid "Step into instruction"
|
||
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
|
||
msgid "Step Into Instruction"
|
||
msgstr "Avanzar una Instrucción"
|
||
|
||
#: lazarusidestrconsts.lismenustepout
|
||
#, fuzzy
|
||
#| msgid "Step o&ut"
|
||
msgid "Step O&ut"
|
||
msgstr "Ejecutar hasta el retorno de la función"
|
||
|
||
#: lazarusidestrconsts.lismenustepover
|
||
#, fuzzy
|
||
#| msgid "&Step over"
|
||
msgid "&Step Over"
|
||
msgstr "Paso a paso por funciones"
|
||
|
||
#: lazarusidestrconsts.lismenustepovercontext
|
||
#, fuzzy
|
||
#| msgid "Step over (Context)"
|
||
msgid "Step Over (Context)"
|
||
msgstr "Paso a paso por funciones (Contexto)"
|
||
|
||
#: lazarusidestrconsts.lismenustepoverinstr
|
||
#, fuzzy
|
||
#| msgid "Step over instruction"
|
||
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
|
||
msgid "Step Over Instruction"
|
||
msgstr "Saltar una Instrucción"
|
||
|
||
#: lazarusidestrconsts.lismenustepoverinstrhint
|
||
#, fuzzy
|
||
#| msgid "Step over instruction"
|
||
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
|
||
msgid "Step Over Instruction"
|
||
msgstr "Saltar una Instrucción"
|
||
|
||
#: lazarusidestrconsts.lismenuswapcaseselection
|
||
msgid "Swap Case in Selection"
|
||
msgstr "Intercambiar Mayus./Min. en selección"
|
||
|
||
#: lazarusidestrconsts.lismenutabstospacesselection
|
||
#, fuzzy
|
||
#| msgid "Tabs to spaces in selection"
|
||
msgid "Tabs to Spaces in Selection"
|
||
msgstr "Tabulaciones a Espacios en Selección"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateabout
|
||
msgid "About"
|
||
msgstr "Acerca de"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr "Contenidos"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr "Menú de Edición estándar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr "Menú de Archivo estándar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr "Menú de Ayuda estándar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefind
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
||
msgid "Find"
|
||
msgstr "Buscar"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefindnext
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
|
||
msgid "Find Next"
|
||
msgstr "Buscar Siguiente"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateopenrecent
|
||
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
||
msgid "Open Recent"
|
||
msgstr "Abrir Reciente"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr "Tutorial"
|
||
|
||
#: lazarusidestrconsts.lismenutogglecomment
|
||
#, fuzzy
|
||
#| msgid "Toggle comment"
|
||
msgid "Toggle Comment in Selection"
|
||
msgstr "Intercambiar Comentario en Selección"
|
||
|
||
#: lazarusidestrconsts.lismenutools
|
||
msgid "&Tools"
|
||
msgstr "&Herramientas"
|
||
|
||
#: lazarusidestrconsts.lismenuuncommentselection
|
||
#, fuzzy
|
||
#| msgid "Uncomment selection"
|
||
msgid "Uncomment Selection"
|
||
msgstr "Descomentar Selección"
|
||
|
||
#: lazarusidestrconsts.lismenuunindentselection
|
||
#, fuzzy
|
||
#| msgid "Unindent selection"
|
||
msgid "Unindent Selection"
|
||
msgstr "Desangrar Selección"
|
||
|
||
#: lazarusidestrconsts.lismenuuppercaseselection
|
||
#, fuzzy
|
||
#| msgid "Uppercase selection"
|
||
msgid "Uppercase Selection"
|
||
msgstr "Selección en Mayúsculas"
|
||
|
||
#: lazarusidestrconsts.lismenuuseunit
|
||
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
||
msgid "Add Unit to Uses Section ..."
|
||
msgstr "Añadir Unidad a Sección Uses ..."
|
||
|
||
#: lazarusidestrconsts.lismenuview
|
||
msgid "&View"
|
||
msgstr "&Ver"
|
||
|
||
#: lazarusidestrconsts.lismenuviewanchoreditor
|
||
#| msgid "View Anchor Editor"
|
||
msgid "Anchor Editor"
|
||
msgstr "Editor de Anclaje"
|
||
|
||
#: lazarusidestrconsts.lismenuviewassembler
|
||
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
||
msgid "Assembler"
|
||
msgstr "Ensamblador"
|
||
|
||
#: lazarusidestrconsts.lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "Puntos de Interrupción"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr "Pila(stack) de llamadas"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodebrowser
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
||
msgid "Code Browser"
|
||
msgstr "Navegador de código"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorador de Código"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
||
msgid "Component Palette"
|
||
msgstr "Paleta de componentes"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "Lista de &Componentes"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugevents
|
||
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
||
msgid "Event Log"
|
||
msgstr "Log de eventos"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugoutput
|
||
#, fuzzy
|
||
#| msgid "Debug output"
|
||
msgid "Debug Output"
|
||
msgstr "Depurar Salida"
|
||
|
||
#: lazarusidestrconsts.lismenuviewforms
|
||
#, fuzzy
|
||
#| msgid "Forms..."
|
||
msgid "Forms ..."
|
||
msgstr "Formularios ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewhistory
|
||
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
||
msgid "History"
|
||
msgstr "Historial"
|
||
|
||
#: lazarusidestrconsts.lismenuviewidespeedbuttons
|
||
#, fuzzy
|
||
#| msgid "IDE speed buttons"
|
||
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
|
||
msgid "IDE Speed Buttons"
|
||
msgstr "Ver botones del IDE"
|
||
|
||
#: lazarusidestrconsts.lismenuviewjumphistory
|
||
#, fuzzy
|
||
#| msgid "Jump History ..."
|
||
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
||
msgid "Jump History"
|
||
msgstr "Historial de Saltos"
|
||
|
||
#: lazarusidestrconsts.lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr "Variables locales"
|
||
|
||
#: lazarusidestrconsts.lismenuviewmessages
|
||
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
||
msgid "Messages"
|
||
msgstr "Ventana de Mensajes"
|
||
|
||
#: lazarusidestrconsts.lismenuviewobjectinspector
|
||
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
||
msgid "Object Inspector"
|
||
msgstr "Inspector de Objetos"
|
||
|
||
#: lazarusidestrconsts.lismenuviewprojectsource
|
||
msgid "&View Project Source"
|
||
msgstr "&Ver Fuente Proyecto"
|
||
|
||
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
||
msgid "Terminal Output"
|
||
msgstr "Salida Terminal"
|
||
|
||
#: lazarusidestrconsts.lismenuviewregisters
|
||
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
||
msgid "Registers"
|
||
msgstr "Registros"
|
||
|
||
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr "Explorador de Restricciones"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr "Buscar Resultados"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsourceeditor
|
||
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
||
msgid "Source Editor"
|
||
msgstr "Editor de código fuente"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtaborder
|
||
msgid "Tab Order"
|
||
msgstr "Orden Tab"
|
||
|
||
#: lazarusidestrconsts.lismenuviewthreads
|
||
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
||
msgid "Threads"
|
||
msgstr "Hilos (Threads)"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
||
#, fuzzy
|
||
#| msgid "Toggle form/unit view"
|
||
msgid "Toggle Form/Unit View"
|
||
msgstr "Cambiar Vista Formulario/Unidad"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitdependencies
|
||
#, fuzzy
|
||
#| msgid "Unit Dependencies ..."
|
||
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
||
msgid "Unit Dependencies"
|
||
msgstr "Dependencias de la Unidad ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitinfo
|
||
#, fuzzy
|
||
#| msgid "Unit Information"
|
||
msgid "Unit Information ..."
|
||
msgstr "Información de la Unidad ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewunits
|
||
#, fuzzy
|
||
#| msgid "Units..."
|
||
msgid "Units ..."
|
||
msgstr "Unidades ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr "Puntos de Observación"
|
||
|
||
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
||
msgid "What Needs Building"
|
||
msgstr "Que necesitas para construir"
|
||
|
||
#: lazarusidestrconsts.lismenuwindow
|
||
msgid "&Window"
|
||
msgstr "Ven&tana"
|
||
|
||
#: lazarusidestrconsts.lismeother
|
||
#, fuzzy
|
||
#| msgid "Other"
|
||
msgctxt "lazarusidestrconsts.lismeother"
|
||
msgid "Other tabs"
|
||
msgstr "Otras Pestañas"
|
||
|
||
#: lazarusidestrconsts.lismeprojects
|
||
msgid "Projects"
|
||
msgstr "Proyectos"
|
||
|
||
#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
|
||
msgid "Message contains no file position information:%s%s"
|
||
msgstr "El mensaje no contiene información sobre la posición del archivo:%s%s"
|
||
|
||
#: lazarusidestrconsts.lismessageseditor
|
||
msgid "Messages Editor"
|
||
msgstr "Editor de Mensajes"
|
||
|
||
#: lazarusidestrconsts.lismethodclassnotfound
|
||
msgid "Method class not found"
|
||
msgstr "Método de clase no hallado"
|
||
|
||
#: lazarusidestrconsts.lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr "Eventos desaparecidos"
|
||
|
||
#: lazarusidestrconsts.lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr "Identificadores desaparecidos"
|
||
|
||
#: lazarusidestrconsts.lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr "Paquetes desaparecidos"
|
||
|
||
#: lazarusidestrconsts.lismissingunitschoices
|
||
msgid "Your choices are:"
|
||
msgstr "Sus opciones son:"
|
||
|
||
#: lazarusidestrconsts.lismissingunitscomment
|
||
msgid "Comment Out"
|
||
msgstr "Descomentar"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsfordelphi
|
||
msgid "For Delphi only"
|
||
msgstr "Solo para Delphi"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1
|
||
msgid "1) Comment out the selected units."
|
||
msgstr "1) Descomentar las unidades seleccionadas"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1b
|
||
msgid "1) Use the units only for Delphi."
|
||
msgstr "1) Usar las unidades solo para Delphi"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo2
|
||
msgid "2) Search for units. Found paths are added to project settings."
|
||
msgstr "2) Buscar unidades. Las rutas encontradas son añadidas a la configuración del proyecto"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo3
|
||
msgid "3) Abort now, install packages or fix paths and try again."
|
||
msgstr "3) Abortar ahora, instalar paquetes o arreglar las rutas e intentar de nuevo"
|
||
|
||
#: lazarusidestrconsts.lismissingunitssearch
|
||
msgid "Search Unit Path"
|
||
msgstr "Ruta de Busqueda de Unidades"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsskip
|
||
msgid "Skip this Unit"
|
||
msgstr "Omitir esta Unidad"
|
||
|
||
#: lazarusidestrconsts.lismitnotice
|
||
msgid "<description>%sCopyright (c) <year> <copyright holders>%sPermission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:%sThe above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.%sTHE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
|
||
msgstr "<description>%sCopyright (c) <year> <copyright holders>%sPermiso se concede por el presente, gratuitamente, a cualquier persona a obtener una copia de este software y archivos asociados de documentación (el \"Software\"), para tratar en el Software sin restricción, incluyendo sin limitación los derechos para utilizar, copia, modificar, combina, publica, distribuir, otorgar una sublicencia, y/o vender copias del Software y para permitir a las personas a quienes el Software se suministra para hacerlo, sujeto a la siguiente condiciones:%sEl sobre aviso de copyright y este aviso de permiso se incluirán en todas las copias o partes sustanciales de la Software.%sEL SOFTWARE ES PROPORCIONADO \"COMO ES\", SIN GARANTÍA DE CUALQUIER TIPO, EXPRESS O IMPLÍCITAS, INCLUYENDO PERO NO LIMITADO A LAS GARANTÍAS DE COMERCIABILIDAD, APTITUD PARA UN PARTICULAR PROPÓSITO Y NO INFRACCIÓN. EN NINGÚN CASO LOS AUTORES O LOS TITULARES DEL COPYRIGHT SERÁ RESPONSABLE DE CUALQUIER RECLAMACIÓN, DAÑOS U OTRA RESPONSABILIDAD, YA SEA EN UNA ACCIÓN DE RESPONSABILIDAD CONTRACTUAL, EXTRACONTRACTUAL O DE OTRO TIPO, QUE SE PRESENTA, DE O EN RELACIÓN CON EL SOFTWARE O EL USO U OTRAS OPERACIONES EN EL SOFTWARE."
|
||
|
||
#: lazarusidestrconsts.lismmadditionsandoverrides
|
||
msgid "Additions and Overrides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmaddscustomoptions
|
||
msgid "Adds custom options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
||
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackages
|
||
msgid "Apply to all packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
||
msgid "Apply to all packages and projects."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
||
msgid "Apply to all packages matching name \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoproject
|
||
msgid "Apply to project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
||
msgid "Create a new group of options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmcustomoption
|
||
msgid "Custom Option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
||
msgid "Delete the selected target or option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
||
msgid "Does not add custom options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
||
msgid "Does not have IDE Macro %s:=%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
||
msgid "Does not override OutDir (-FU)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
||
msgid "Exclude all packages matching name \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
||
msgid "expected \":=\" after macro name, but found \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
||
msgid "expected macro name, but found \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmfromto
|
||
msgid "From %s to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmidemacro
|
||
msgid "IDE Macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmidemacro2
|
||
msgid "IDE Macro %s:=%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismminvalidcharacterat
|
||
msgid "invalid character \"%s\" at %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
||
msgid "invalid character in macro value \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmmissingmacroname
|
||
msgid "missing macro name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
||
msgid "Move selected item down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmmoveselecteditemup
|
||
msgid "Move selected item up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmnewtarget
|
||
msgid "New Target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
||
msgid "Override OutDir (-FU): %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
||
msgid "Override output directory (-FU)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
||
msgid "Override output directory -FU of target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
||
msgid "Redo last undo to this grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
||
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmsets
|
||
msgid "Set \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
||
msgid "Stored in IDE (environmentoptions.xml)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
||
msgid "Stored in project (.lpi)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
||
msgid "Stored in session of project (.lps)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmtargets
|
||
msgid "Targets: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
||
msgid "Undo last change to this grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmvalues
|
||
msgid "Value \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismmwas
|
||
msgid "(was \"%s\")"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismodifiedlgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sEsta biblioteca es software libre; usted puede redistribuirlo y/o modificarlo bajo los términos de la GNU Library General Public License publicada por la Free Software Foundation; sea versión 2 de la licencia, o (a su opción) cualquier versión posterior con la siguiente modificación:%sComo una excepción especial, los titulares de derechos de autor de esta biblioteca darle permiso para vincular esta biblioteca con módulos independientes para producir un ejecutable, independientemente de los términos de la licencia de estos módulos independientes y a copiar y distribuir el archivo ejecutable resultante en términos de su elección, siempre y cuando cumplan también, para cada uno módulo independiente linkado, los términos y condiciones de la licencia de dicho módulo. Un módulo independiente es un módulo que no sea derivado o basado en esta biblioteca. Si se modifica esta biblioteca, usted puede extender esta excepción a su versión de la biblioteca, pero no está obligado a hacerlo. Si usted no desea hacerlo, elimine esta declaración de excepción de su versión del programa.%sEsto se distribuye con la esperanza que sea útil, pero sin ninguna garantía; ni siquiera la garantía implícita de comerciabilidad o idoneidad para un fin determinado. Consulte la GNU Library General Public License para obtener más detalles. %sUsted debería haber recibido una copia de la GNU Library General Public License junto con esta biblioteca; Si no, escriba a la Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lismodify
|
||
msgid "&Modify"
|
||
msgstr "&Modificar"
|
||
|
||
#: lazarusidestrconsts.lismore
|
||
msgctxt "lazarusidestrconsts.lismore"
|
||
msgid "More"
|
||
msgstr "Más"
|
||
|
||
#: lazarusidestrconsts.lismoresub
|
||
msgctxt "lazarusidestrconsts.lismoresub"
|
||
msgid "More >>"
|
||
msgstr "Más >>"
|
||
|
||
#: lazarusidestrconsts.lismoveonepositiondown
|
||
msgid "Move \"%s\" one position down"
|
||
msgstr "Mover \"%s\" una posición abajo"
|
||
|
||
#: lazarusidestrconsts.lismoveonepositionup
|
||
msgid "Move \"%s\" one position up"
|
||
msgstr "Mover \"%s\" una posición arriba"
|
||
|
||
#: lazarusidestrconsts.lismovepage
|
||
#, fuzzy
|
||
#| msgid "Move Page ..."
|
||
msgid "Move Page"
|
||
msgstr "Mover Página"
|
||
|
||
#: lazarusidestrconsts.lismoveselecteddown
|
||
msgid "Move selected item down (Ctrl+Down)"
|
||
msgstr "Mover item selecionado abajo (Ctrl+Down)"
|
||
|
||
#: lazarusidestrconsts.lismoveselectedup
|
||
msgid "Move selected item up (Ctrl+Up)"
|
||
msgstr "Mover item selecionado arriba (Ctrl+Up)"
|
||
|
||
#: lazarusidestrconsts.lismoveto
|
||
msgid "Move to: "
|
||
msgstr "Mover a: "
|
||
|
||
#: lazarusidestrconsts.lisms
|
||
msgid "(ms)"
|
||
msgstr "(ms)"
|
||
|
||
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr "Guardar mensajes al archivo (*.txt)"
|
||
|
||
#: lazarusidestrconsts.lisname
|
||
msgctxt "lazarusidestrconsts.lisname"
|
||
msgid "Name"
|
||
msgstr "Nombre"
|
||
|
||
#: lazarusidestrconsts.lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr "Conflicto de nombre"
|
||
|
||
#: lazarusidestrconsts.lisnameofactivebuildmode
|
||
msgid "Name of active build mode"
|
||
msgstr "Nombre del modo de construcción activa"
|
||
|
||
#: lazarusidestrconsts.lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr "Nombre del nuevo procedimiento"
|
||
|
||
#: lazarusidestrconsts.lisnever
|
||
msgctxt "lazarusidestrconsts.lisnever"
|
||
msgid "Never"
|
||
msgstr "Nunca"
|
||
|
||
#: lazarusidestrconsts.lisnew
|
||
msgctxt "lazarusidestrconsts.lisnew"
|
||
msgid "New"
|
||
msgstr "Nuevo"
|
||
|
||
#: lazarusidestrconsts.lisnewclass
|
||
msgid "New Class"
|
||
msgstr "Nueva clase"
|
||
|
||
#: lazarusidestrconsts.lisnewconsoleapplication
|
||
msgid "New console application"
|
||
msgstr "Nueva aplicación de consola"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr "Crear un nuevo archivo de editor.%s Escoja el tipo."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr "Crear un nuevo archivo de texto vacío."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr "Crear un proyecto nuevo.%s Escoja el tipo."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr "Crear un paquete estándar nuevo.%sUn paquete es una colección de unidades y componentes."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr "Crear una unidad nueva con un módulo de datos."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
||
#| msgid "Create a new unit with a frame"
|
||
msgid "Create a new unit with a frame."
|
||
msgstr "Crear una unidad nueva con un frame."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr "Crear una unidad nueva con un formulario LCL."
|
||
|
||
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
||
msgid "Inherit from a project form or component"
|
||
msgstr "Heredar de un formulario o componente de proyecto."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "No se han seleccionado elementos"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "Por favor seleccione primero un elemento."
|
||
|
||
#: lazarusidestrconsts.lisnewencoding
|
||
msgid "New encoding:"
|
||
msgstr "Codificación de página nueva:"
|
||
|
||
#: lazarusidestrconsts.lisnewmacroname
|
||
msgid "Macro %d"
|
||
msgstr "Macro %d"
|
||
|
||
#: lazarusidestrconsts.lisnewmacroname2
|
||
msgid "New Macroname"
|
||
msgstr "Nuevo nombre de Macro"
|
||
|
||
#: lazarusidestrconsts.lisnewproject
|
||
#| msgid "%s - (new project)"
|
||
msgid "(new project)"
|
||
msgstr "(nuevo proyecto)"
|
||
|
||
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
||
msgid "New recorded macros. Not to be saved"
|
||
msgstr "Nuevas macros grabadas. No han sido salvadas"
|
||
|
||
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
||
#, fuzzy
|
||
#| msgid "New units are added to uses sections:"
|
||
msgid "New units are added to uses sections"
|
||
msgstr "Las unidades nuevas son añadidas a las secciones uses"
|
||
|
||
#: lazarusidestrconsts.lisno
|
||
msgid "No"
|
||
msgstr "No"
|
||
|
||
#: lazarusidestrconsts.lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr "No crear archivos de respaldo"
|
||
|
||
#: lazarusidestrconsts.lisnobuildprofilesselected
|
||
msgid "No profiles are selected to be built."
|
||
msgstr "Ningún perfil ha sido seleccionado para ser construido"
|
||
|
||
#: lazarusidestrconsts.lisnochange
|
||
msgid "No change"
|
||
msgstr "Sin cambios"
|
||
|
||
#: lazarusidestrconsts.lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "No se ha seleccionado código"
|
||
|
||
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr "No se heredan opciones del compilador."
|
||
|
||
#: lazarusidestrconsts.lisnohints
|
||
msgid "no hints"
|
||
msgstr "sin indicios"
|
||
|
||
#: lazarusidestrconsts.lisnoidewindowselected
|
||
msgid "No IDE window selected"
|
||
msgstr "No hay ninguna ventana IDE seleccionada"
|
||
|
||
#: lazarusidestrconsts.lisnolfmfile
|
||
msgid "No LFM file"
|
||
msgstr "Sin archivo LFM"
|
||
|
||
#: lazarusidestrconsts.lisnomacroselected
|
||
msgid "No macro selected"
|
||
msgstr "Ningúna macro seleccionada"
|
||
|
||
#: lazarusidestrconsts.lisnoname
|
||
msgid "noname"
|
||
msgstr "sin nombre"
|
||
|
||
#: lazarusidestrconsts.lisnone
|
||
msgid "%snone"
|
||
msgstr "%sninguno"
|
||
|
||
#: lazarusidestrconsts.lisnoneclicktochooseone
|
||
msgid "none, click to choose one"
|
||
msgstr "ninguno, clic para elegir uno"
|
||
|
||
#: lazarusidestrconsts.lisnonodeselected
|
||
msgid "no node selected"
|
||
msgstr "No hay ningún nodo seleccionado"
|
||
|
||
#: lazarusidestrconsts.lisnopascalfile
|
||
#, fuzzy
|
||
#| msgid "No pascal file"
|
||
msgid "No Pascal file"
|
||
msgstr "no es un archivo pascal"
|
||
|
||
#: lazarusidestrconsts.lisnoprogramfilesfound
|
||
msgid "No program file %s%s%s found."
|
||
msgstr "Ningún archivo de programa %s%s%s ha sido encontrado."
|
||
|
||
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr "No se ha encontrado sección de ResourceString"
|
||
|
||
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
||
#, fuzzy
|
||
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr "Normalmente el filtro es una expresión regular. En Sintaxis Simple un . es un caracter normal, un * significa cualquier cosa, un ? significa cualquier caracter, coma y punto y coma separan alternativas. Por ejemplo: Simple Syntax *.pas;*.pp corresponde a ^(.*\\.pas|.*\\.pp)$"
|
||
|
||
#: lazarusidestrconsts.lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr "No se ha encontrado constante de cadena"
|
||
|
||
#: lazarusidestrconsts.lisnotadesigntimepackage
|
||
msgid "Not a designtime package"
|
||
msgstr "No es un paquete para tiempo de diseño"
|
||
|
||
#: lazarusidestrconsts.lisnotaninstallpackage
|
||
msgid "Not an install package"
|
||
msgstr "No es un paquete instalable"
|
||
|
||
#: lazarusidestrconsts.lisnotavalidpascalidentifier
|
||
#, fuzzy
|
||
#| msgid "Not a valid pascal identifier"
|
||
msgid "Not a valid Pascal identifier"
|
||
msgstr "Identificador pascal no valido"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposbottom
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
||
msgid "Bottom"
|
||
msgstr "Abajo"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposleft
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
||
msgid "Left"
|
||
msgstr "Izquierda"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposright
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
||
msgid "Right"
|
||
msgstr "Derecho"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabpostop
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
||
msgid "Top"
|
||
msgstr "Arriba"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr "NOTA: No se pudo crear la Plantilla de Defines para los fuentes de Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr "NOTA: No se pudo crear la Plantilla de Defines para los fuentes de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisnotemplateselected
|
||
msgid "no template selected"
|
||
msgstr "sin plantilla seleccionada"
|
||
|
||
#: lazarusidestrconsts.lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr "No implementado"
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr "No implementado todavía:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisnotinstalled
|
||
msgid "not installed"
|
||
msgstr "no instalado"
|
||
|
||
#: lazarusidestrconsts.lisnotnow
|
||
msgid "Not now"
|
||
msgstr "Todavía no"
|
||
|
||
#: lazarusidestrconsts.lisnowloadedscheme
|
||
msgid "Now loaded: "
|
||
msgstr "Ahora cargado: "
|
||
|
||
#: lazarusidestrconsts.lisnpcreate
|
||
msgid "Create"
|
||
msgstr "Crear"
|
||
|
||
#: lazarusidestrconsts.lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr "Crear un proyecto nuevo"
|
||
|
||
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
||
msgid "Number of files to convert: %s"
|
||
msgstr "Número de archivos a convertir: %s"
|
||
|
||
#: lazarusidestrconsts.lisobjectpascaldefault
|
||
msgid "Object Pascal - default"
|
||
msgstr "Object Pascal - predeterminado"
|
||
|
||
#: lazarusidestrconsts.lisobjectpath
|
||
msgid "object path"
|
||
msgstr "ruta de objeto"
|
||
|
||
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
||
msgid "Switch to Object Inspector Favorites tab"
|
||
msgstr "Cambiar a pestaña Favoritos del Inspector de Objetos"
|
||
|
||
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
|
||
msgid "Switch to Object Inspector Favorites tab after asking for component name"
|
||
msgstr "Cambiar a pestaña Favoritos del Inspector de Objetos después de preguntar el nombre del componente"
|
||
|
||
#: lazarusidestrconsts.lisoff
|
||
msgid "? (Off)"
|
||
msgstr "? (Desactivado)"
|
||
|
||
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
||
msgid "Add to favorite properties"
|
||
msgstr "Añadir a propiedades favoritas"
|
||
|
||
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
||
msgid "Choose a base class for the favorite property %s%s%s."
|
||
msgstr "Elija una clase base para la propiedad favorita %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisoifclassnotfound
|
||
msgid "Class %s%s%s not found."
|
||
msgstr "Clase %s%s%s no encontrada."
|
||
|
||
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
||
msgid "Remove from favorite properties"
|
||
msgstr "Quitar de propiedades favoritas"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr "instalar automáticamente dinámicos"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr "instalar automáticamente estáticos"
|
||
|
||
#: lazarusidestrconsts.lisoipdescription
|
||
msgid "Description: "
|
||
msgstr "Descripción: "
|
||
|
||
#: lazarusidestrconsts.lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%s Descripción: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr "Nombre de archivo: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr "instalado dinámico"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr "instalado estático"
|
||
|
||
#: lazarusidestrconsts.lisoipmissing
|
||
msgid "missing"
|
||
msgstr "falta"
|
||
|
||
#: lazarusidestrconsts.lisoipmodified
|
||
msgid "modified"
|
||
msgstr "modificado"
|
||
|
||
#: lazarusidestrconsts.lisoipopenloadedpackage
|
||
#, fuzzy
|
||
#| msgid "Open loaded package"
|
||
msgid "Open Loaded Package"
|
||
msgstr "Abrir Paquete Cargado"
|
||
|
||
#: lazarusidestrconsts.lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr "Nombre de Paquete"
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr "Por favor seleccione un paquete"
|
||
|
||
#: lazarusidestrconsts.lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr "sólo lectura"
|
||
|
||
#: lazarusidestrconsts.lisoipstate
|
||
msgctxt "lazarusidestrconsts.lisoipstate"
|
||
msgid "State"
|
||
msgstr "Estado"
|
||
|
||
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "%sEste paquete ya está instalado, pero no se ha encontrado el archivo lpk."
|
||
|
||
#: lazarusidestrconsts.lisok
|
||
#, fuzzy
|
||
#| msgid "ok"
|
||
msgctxt "lazarusidestrconsts.lisok"
|
||
msgid "OK"
|
||
msgstr "Aceptar"
|
||
|
||
#: lazarusidestrconsts.lisoldclass
|
||
msgid "Old Class"
|
||
msgstr "Clase antigua"
|
||
|
||
#: lazarusidestrconsts.lison
|
||
msgid "? (On)"
|
||
msgstr "? (Activado)"
|
||
|
||
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
||
msgid "On break line (i.e. return or enter key)"
|
||
msgstr "Al final de línea (ej. retorno o tecla enter)"
|
||
|
||
#: lazarusidestrconsts.lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr "Sólo busca palabras completas"
|
||
|
||
#: lazarusidestrconsts.lisonpastefromclipboard
|
||
msgid "On paste from clipboard"
|
||
msgstr "Al pegar desde portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisopen
|
||
msgctxt "lazarusidestrconsts.lisopen"
|
||
msgid "Open"
|
||
msgstr "Abrir"
|
||
|
||
#: lazarusidestrconsts.lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr "Abrir como un archivo XML"
|
||
|
||
#: lazarusidestrconsts.lisopendesigneronopenunit
|
||
msgid "Open designer on open unit"
|
||
msgstr "Abrir el diseñador de la unidad abierta"
|
||
|
||
#: lazarusidestrconsts.lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr "Abrir archivo existente"
|
||
|
||
#: lazarusidestrconsts.lisopenfile
|
||
#, fuzzy
|
||
#| msgid "Open file"
|
||
msgctxt "lazarusidestrconsts.lisopenfile"
|
||
msgid "Open File"
|
||
msgstr "Abrir archivo"
|
||
|
||
#: lazarusidestrconsts.lisopenfile2
|
||
#, fuzzy
|
||
#| msgid "Open file"
|
||
msgctxt "lazarusidestrconsts.lisopenfile2"
|
||
msgid "Open file"
|
||
msgstr "Abrir archivo"
|
||
|
||
#: lazarusidestrconsts.lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr "Abrir %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr "¿Abrir paquete?"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage2
|
||
msgid "Open package %s"
|
||
msgstr "Abrir paquete %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr "Abrir archivo de paquete"
|
||
|
||
#: lazarusidestrconsts.lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "¿Abrir Proyecto?"
|
||
|
||
#: lazarusidestrconsts.lisopenproject2
|
||
msgid "Open project"
|
||
msgstr "Abrir proyecto"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr "Abrir proyecto otra vez"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "Abrir archivo de Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr "Abrir enlace simbólico"
|
||
|
||
#: lazarusidestrconsts.lisopentarget
|
||
msgid "Open target"
|
||
msgstr "Abrir objetivo"
|
||
|
||
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr "Abrir el archivo como código normal"
|
||
|
||
#: lazarusidestrconsts.lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr "¿Abrir el paquete %s?"
|
||
|
||
#: lazarusidestrconsts.lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr "¿Abrir el proyecto %s?"
|
||
|
||
#: lazarusidestrconsts.lisopenxml
|
||
msgid "Open XML"
|
||
msgstr "Abrir XML"
|
||
|
||
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
|
||
msgid "Options changed, recompiling clean with -B"
|
||
msgstr "Opciones cambiadas, recompila limpiando con -B"
|
||
|
||
#: lazarusidestrconsts.lisor
|
||
msgid "or"
|
||
msgstr "o"
|
||
|
||
#: lazarusidestrconsts.lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr "Ignorar lenguaje. Por ejemplo --languaje=de. Para los valores posibles mirar los archivos en el directorio languages"
|
||
|
||
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
||
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
||
msgstr "%sreemplaza al compilador predeterminado. ej. ppc386 ppcx64 ppcppc etc. El predeterminado se almacena en environmentoptions.xml"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
||
#, fuzzy
|
||
#| msgid "%soverride the project build mode."
|
||
msgid "%soverride the project or IDE build mode."
|
||
msgstr "%sreemplaza el projecto o el modo de construcción del IDE"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
||
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
||
msgstr "%sreemplaza al cpu del proyecto. ej. i386 x86_64 powerpc powerpc_64 etc. predeterminado: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
||
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
||
msgstr "%sreemplaza al sistema operativo del proyecto. ej. win32 linux. predeterminado: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
||
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
||
msgstr "%sreemplaza el widgetset del proyecto. ej. gtk gtk2 qt win32 carbon. predeterminado: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr "¿Sobreescribir archivo?"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr "Sobreescribir archivo en disco"
|
||
|
||
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
||
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
||
msgstr "'Propietario' ya es usado por TReader/TWriter. Por favor, escoja otro nombre."
|
||
|
||
#: lazarusidestrconsts.lispackage
|
||
msgid "Package"
|
||
msgstr "Paquete"
|
||
|
||
#: lazarusidestrconsts.lispackage2
|
||
msgid "package %s"
|
||
msgstr "paquete %s"
|
||
|
||
#: lazarusidestrconsts.lispackageinfo
|
||
#, fuzzy
|
||
#| msgid "Package Info"
|
||
msgid "Package info"
|
||
msgstr "Información de paquete"
|
||
|
||
#: lazarusidestrconsts.lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr "El nombre de paquete comienza con ..."
|
||
|
||
#: lazarusidestrconsts.lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr "El nombre de paquete contiene ..."
|
||
|
||
#: lazarusidestrconsts.lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr "El paquete necesita instalación"
|
||
|
||
#: lazarusidestrconsts.lispackageoutputdirectories
|
||
msgid "Package output directories"
|
||
msgstr "Directorios de salida de paquetes"
|
||
|
||
#: lazarusidestrconsts.lispackagesourcedirectories
|
||
msgid "Package source directories"
|
||
msgstr "Directorios de fuentes de paquetes"
|
||
|
||
#: lazarusidestrconsts.lispackageunit
|
||
msgid "package unit"
|
||
msgstr "Unidad de paquete"
|
||
|
||
#: lazarusidestrconsts.lispage
|
||
msgid "Page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisparsed
|
||
msgid ", parsed "
|
||
msgstr ", analizado"
|
||
|
||
#: lazarusidestrconsts.lispascalfile
|
||
msgid "Pascal file"
|
||
msgstr "Pascal archivo"
|
||
|
||
#: lazarusidestrconsts.lispasscount
|
||
msgid "Pass Count"
|
||
msgstr "Cuenta Pasos"
|
||
|
||
#: lazarusidestrconsts.lispaste
|
||
msgctxt "lazarusidestrconsts.lispaste"
|
||
msgid "Paste"
|
||
msgstr "Pegar"
|
||
|
||
#: lazarusidestrconsts.lispasteclipboard
|
||
msgid "paste clipboard"
|
||
msgstr "Pegar portapapeles"
|
||
|
||
#: lazarusidestrconsts.lispastetextfromclipboard
|
||
msgid "Paste text from clipboard"
|
||
msgstr "Pegar texto desde el portapapeles"
|
||
|
||
#: lazarusidestrconsts.lispath
|
||
msgid "Path"
|
||
msgstr "Ruta"
|
||
|
||
#: lazarusidestrconsts.lispatheditbrowse
|
||
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
||
msgid "Browse"
|
||
msgstr "Explorar"
|
||
|
||
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
||
msgid "Delete Invalid Paths"
|
||
msgstr "Borrar Paths Invalidos"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathdown
|
||
#, fuzzy
|
||
#| msgid "Move path down"
|
||
msgid "Move path down (Ctrl+Down)"
|
||
msgstr "Mover ruta abajo (Ctrl+Abajo)"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathup
|
||
#, fuzzy
|
||
#| msgid "Move path up"
|
||
msgid "Move path up (Ctrl+Up)"
|
||
msgstr "Mover ruta arriba (Ctrl+Arriba)"
|
||
|
||
#: lazarusidestrconsts.lispatheditoraddhint
|
||
msgid "Add new path to the list"
|
||
msgstr "Añadir nuevo path a la lista"
|
||
|
||
#: lazarusidestrconsts.lispatheditordeletehint
|
||
msgid "Delete the selected path"
|
||
msgstr "Borrar el path seleccionado"
|
||
|
||
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
||
msgid "Remove non-existent (gray) paths from the list"
|
||
msgstr "Quitar paths no existentes (gris) de la lista"
|
||
|
||
#: lazarusidestrconsts.lispatheditorreplacehint
|
||
msgid "Replace the selected path with a new path"
|
||
msgstr "Reemplazar el path seleccionado con un nuevo path"
|
||
|
||
#: lazarusidestrconsts.lispatheditortempladdhint
|
||
msgid "Add template to the list"
|
||
msgstr "Añadir plantilla a la lista"
|
||
|
||
#: lazarusidestrconsts.lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr "Ruta de plantillas"
|
||
|
||
#: lazarusidestrconsts.lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr "Buscar rutas:"
|
||
|
||
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
||
msgid "path of the instantfpc cache"
|
||
msgstr "path para el cache instantfpc"
|
||
|
||
#: lazarusidestrconsts.lispathofthemakeutility
|
||
msgid "Path of the make utility"
|
||
msgstr "Ruta a la utilidad make"
|
||
|
||
#: lazarusidestrconsts.lispathtoinstance
|
||
msgid "Path to failed Instance:"
|
||
msgstr "Ruta a Instancia Fallida"
|
||
|
||
#: lazarusidestrconsts.lispause
|
||
msgctxt "lazarusidestrconsts.lispause"
|
||
msgid "Pause"
|
||
msgstr "Pausar"
|
||
|
||
#: lazarusidestrconsts.lispckcleartousethepackagename
|
||
msgid "Clear to use the package name"
|
||
msgstr "Limpia para usar el nombre del paquete"
|
||
|
||
#: lazarusidestrconsts.lispckdisablei18noflfm
|
||
msgid "Disable I18N of lfm"
|
||
msgstr "Desactiva I18N de lfm"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddanitem
|
||
msgid "Add an item"
|
||
msgstr "Añadir un elemento"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddtoproject
|
||
#, fuzzy
|
||
#| msgid "Add to project"
|
||
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
||
msgid "Add to Project"
|
||
msgstr "Agregar al Proyecto"
|
||
|
||
#: lazarusidestrconsts.lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "Aplicar cambios"
|
||
|
||
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr "Llamar %sRegistro%s procedimiento de la unidad seleccionada"
|
||
|
||
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
||
msgid "Clean up dependencies ..."
|
||
msgstr "Limpiar las dependencias ..."
|
||
|
||
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
||
msgid "Clear default/preferred filename of dependency"
|
||
msgstr "Borrar nombre de archivo predeterminado/preferido de la dependencia"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr "¿Compilar todo?"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr "Compilar paquete"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr "Opciones del Compilador para el paquete %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
||
msgid "Create fpmake.pp"
|
||
msgstr "Crear fpmake.pp"
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatemakefile
|
||
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Crear Makefile"
|
||
|
||
#: lazarusidestrconsts.lispckeditdefault
|
||
msgid "%s, default: %s"
|
||
msgstr "%s, predeterminado: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr "Propiedades de la dependencia"
|
||
|
||
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
||
msgid "Edit General Options"
|
||
msgstr "Editar Opciones Generales"
|
||
|
||
#: lazarusidestrconsts.lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr "Propiedades de archivo"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstall
|
||
msgid "Install"
|
||
msgstr "Instalar"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstallpackageintheide
|
||
msgid "Install package in the IDE"
|
||
msgstr "Instalar paquete en el IDE"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr "Versión máxima no válida"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr "Versión mínima no válida"
|
||
|
||
#: lazarusidestrconsts.lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr "Versión máxima:"
|
||
|
||
#: lazarusidestrconsts.lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr "Versión mínima:"
|
||
|
||
#: lazarusidestrconsts.lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr "Modificado: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr "Mover dependencia abajo"
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr "Mover dependencia arriba"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr "Paquete %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
||
msgid "Package %s%s%s has changed.%sSave package?"
|
||
msgstr "El paquete %s%s%s ha cambiado.%s¿Guardar paquete?"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr "paquete %s no guardado"
|
||
|
||
#: lazarusidestrconsts.lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s, Página: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr "Re-Añadir dependencia"
|
||
|
||
#: lazarusidestrconsts.lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr "Re-Añadir archivo"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr "Sólo-Lectura: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
||
#, fuzzy
|
||
#| msgid "Recompile all required"
|
||
msgid "Recompile All Required"
|
||
msgstr "Recompilar Todo lo Requerido"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileclean
|
||
#, fuzzy
|
||
#| msgid "Recompile clean"
|
||
msgid "Recompile Clean"
|
||
msgstr "Recompilar Limpio"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr "¿Re-Compilar este y todos los paquetes requeridos?"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr "Registrar complementos"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr "Registrar unidad"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr "Eliminar dependencia"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr "¿Eliminar dependencia?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "¿Eliminar la dependencia %s%s%s%s del paquete %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedfiles
|
||
msgid "Removed Files"
|
||
msgstr "Archivos Quitados"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
||
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
||
msgid "Removed required packages"
|
||
msgstr "Paquetes requeridos eliminados"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr "Eliminar archivo"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr "¿Eliminar archivo?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
||
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "¿Eliminar el archivo %s%s%s%s del paquete %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "Eliminar elemento seleccionado"
|
||
|
||
#: lazarusidestrconsts.lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr "Paquetes Requeridos"
|
||
|
||
#: lazarusidestrconsts.lispckeditsavepackage
|
||
#, fuzzy
|
||
#| msgid "Save package"
|
||
msgid "Save Package"
|
||
msgstr "Guardar Paquete"
|
||
|
||
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
||
msgid "Store file name as default for this dependency"
|
||
msgstr "Almacenar nombre de archivo como predeterminado para esta dependencia"
|
||
|
||
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
||
msgid "Store file name as preferred for this dependency"
|
||
msgstr "Almacenar nombre de archivo como preferido para esta dependencia"
|
||
|
||
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "La versión máxima %s%s%s no es una versión válida de paquete.%s(ejemplo correcto 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "La versión mínima %s%s%s no es una versión válida de paquete.%s(ejemplo correcto 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr "Desinstalar"
|
||
|
||
#: lazarusidestrconsts.lispckeditviewpackagesource
|
||
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
||
msgid "View Package Source"
|
||
msgstr "Ver Fuente de Paquete"
|
||
|
||
#: lazarusidestrconsts.lispckexplbase
|
||
#, fuzzy
|
||
#| msgid "Base, can not be uninstalled"
|
||
msgid "Base, cannot be uninstalled"
|
||
msgstr "Base, no puede ser desinstalado"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstalled
|
||
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
||
msgid "Installed"
|
||
msgstr "Instalado"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr "Instalar en próximo inicio"
|
||
|
||
#: lazarusidestrconsts.lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr "%sEstado: "
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
||
#, fuzzy
|
||
#| msgid "Uninstall on next start"
|
||
msgid "Uninstall on next start (unless needed by an installed package)"
|
||
msgstr "Desinstalar en el próximo inicio"
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallpackage
|
||
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
||
msgid "Uninstall package %s"
|
||
msgstr "Desinstalar paquete %s"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "Añadir opciones a los proyectos y paquetes dependientes"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "Añadir rutas a los paquetes/proyectos dependientes"
|
||
|
||
#: lazarusidestrconsts.lispckoptsauthor
|
||
#, fuzzy
|
||
#| msgid "Author:"
|
||
msgid "Author"
|
||
msgstr "Autor"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "Reconstruir automáticamente según las necesidades"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "Reconstruir automáticamente al reconstruir todo"
|
||
|
||
#: lazarusidestrconsts.lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr "Personalizado"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
||
#, fuzzy
|
||
#| msgid "Description/Abstract"
|
||
msgid "Description / Abstract"
|
||
msgstr "Descripción / Abstracto"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntime
|
||
msgid "Designtime"
|
||
msgstr "Tiempo de Diseño"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
||
#, fuzzy
|
||
#| msgid "Designtime and Runtime"
|
||
msgid "Designtime and runtime"
|
||
msgstr "Tiempo de diseño y tiempo de ejecución"
|
||
|
||
#: lazarusidestrconsts.lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr "Integración del IDE"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr "Incluir"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr "Tipo del paquete no válido"
|
||
|
||
#: lazarusidestrconsts.lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr "Biblioteca"
|
||
|
||
#: lazarusidestrconsts.lispckoptslicense
|
||
#, fuzzy
|
||
#| msgid "License:"
|
||
msgid "License"
|
||
msgstr "Licencia"
|
||
|
||
#: lazarusidestrconsts.lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr "Enlazador"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr "Mayor"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr "Compilación manual (nunca automáticamente)"
|
||
|
||
#: lazarusidestrconsts.lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr "Menor"
|
||
|
||
#: lazarusidestrconsts.lispckoptsobject
|
||
msgid "Object"
|
||
msgstr "Objecto"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr "Opciones de Paquete"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackagetype
|
||
#, fuzzy
|
||
#| msgid "PackageType"
|
||
msgid "Package type"
|
||
msgstr "Tipo de paquete"
|
||
|
||
#: lazarusidestrconsts.lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr "Proporciona"
|
||
|
||
#: lazarusidestrconsts.lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr "Publicar"
|
||
|
||
#: lazarusidestrconsts.lispckoptsruntime
|
||
msgid "Runtime"
|
||
msgstr "Tiempo Ejecución"
|
||
|
||
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
||
msgstr "El paquete %s%s%s tiene la bandera de auto instalar.%s Eso significa que se instalará en el IDE. Los paquetes de instalación%s deben ser paquetes de diseño."
|
||
|
||
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr "Este paquete proporciona lo mismo que los paquetes siguientes:"
|
||
|
||
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
||
#, fuzzy
|
||
#| msgid "Update/Rebuild"
|
||
msgid "Update / Rebuild"
|
||
msgstr "Actualizar / Reconstruir"
|
||
|
||
#: lazarusidestrconsts.lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr "Uso"
|
||
|
||
#: lazarusidestrconsts.lispckpackage
|
||
msgid "Package:"
|
||
msgstr "Paquete:"
|
||
|
||
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
||
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
||
msgstr "Path de búsqueda para archivos fpdoc XML. Varios path deben estar separadas por punto y coma."
|
||
|
||
#: lazarusidestrconsts.lispckshowunneededdependencies
|
||
msgid "Show unneeded dependencies"
|
||
msgstr "Mostrar las dependencias innecesarias"
|
||
|
||
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
||
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
||
msgstr "Cuando el formulario se guarda, el IDE puede almacenar todas las propiedades TTranslateString del paquete en el archivo po. Para ello es necesario habilitar I18N para este paquete, proporcione un directorio po de salida y deje esta opción sin marcar."
|
||
|
||
#: lazarusidestrconsts.lispdabort
|
||
msgctxt "lazarusidestrconsts.lispdabort"
|
||
msgid "Abort"
|
||
msgstr "Abortar"
|
||
|
||
#: lazarusidestrconsts.lispdprogress
|
||
msgid "Progress"
|
||
msgstr "Progreso"
|
||
|
||
#: lazarusidestrconsts.lispecollapsedirectory
|
||
msgid "Collapse directory"
|
||
msgstr "Colapsar directorio"
|
||
|
||
#: lazarusidestrconsts.lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr "Conflicto encontrado"
|
||
|
||
#: lazarusidestrconsts.lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr "Editar Unidad Virtual"
|
||
|
||
#: lazarusidestrconsts.lispeexpanddirectory
|
||
msgid "Expand directory"
|
||
msgstr "Expander directorio"
|
||
|
||
#: lazarusidestrconsts.lispefilename
|
||
msgid "Filename:"
|
||
msgstr "Nombre de archivo:"
|
||
|
||
#: lazarusidestrconsts.lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr "Corregir MAY/min en Ficheros"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr "Nombre de archivo de unidad no válido"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr "Nombre de unidad no válido"
|
||
|
||
#: lazarusidestrconsts.lispemissingfilesofpackage
|
||
msgid "Missing files of package %s"
|
||
msgstr "Archivos perdidos del paquete %s"
|
||
|
||
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
||
msgid "New file not in include path"
|
||
msgstr "Nuevo archivo no está en ruta de inclusión"
|
||
|
||
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
||
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
||
msgid "No files missing. All files exist."
|
||
msgstr "Ningún archivo perdido. Todos los archivos existen."
|
||
|
||
#: lazarusidestrconsts.lisperemovefiles
|
||
msgid "Remove files"
|
||
msgstr "Eliminar archivos"
|
||
|
||
#: lazarusidestrconsts.lisperevertpackage
|
||
#, fuzzy
|
||
#| msgid "Revert package"
|
||
msgid "Revert Package"
|
||
msgstr "Revertir paquete"
|
||
|
||
#: lazarusidestrconsts.lispesavepackageas
|
||
#, fuzzy
|
||
#| msgid "Save package as"
|
||
msgid "Save Package As ..."
|
||
msgstr "Guardar paquete como ..."
|
||
|
||
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
||
msgid "Show directory hierarchy"
|
||
msgstr "Mostrar jerarquía de directorios"
|
||
|
||
#: lazarusidestrconsts.lispeshowmissingfiles
|
||
#, fuzzy
|
||
#| msgid "Show missing files"
|
||
msgid "Show Missing Files"
|
||
msgstr "Mostrar archivos perdidos"
|
||
|
||
#: lazarusidestrconsts.lispesortfiles
|
||
#, fuzzy
|
||
#| msgid "Sort Files"
|
||
msgid "Sort Files Permanently"
|
||
msgstr "Ordenar archivos Permanentemente"
|
||
|
||
#: lazarusidestrconsts.lispesortfilesalphabetically
|
||
msgid "Sort files alphabetically"
|
||
msgstr "Ordenar archivos alfabéticamente"
|
||
|
||
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
||
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
||
msgstr "El archivo \"%s\" no está actualmente en la ruta de inclusión del paquete.%s¿Añadir \"%s\" a la ruta de inclusión? "
|
||
|
||
#: lazarusidestrconsts.lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr "Nombre de unidad:"
|
||
|
||
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
||
msgid "Use all units in directory"
|
||
msgstr "Usar todas las unidades dentro del directorio"
|
||
|
||
#: lazarusidestrconsts.lispeusenounitsindirectory
|
||
msgid "Use no units in directory"
|
||
msgstr "No usar ninguna unidad dentro del directorio"
|
||
|
||
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
||
msgid "Clean up package dependencies"
|
||
msgstr "Limpieza de dependencias de paquetes"
|
||
|
||
#: lazarusidestrconsts.lispkgclearselection
|
||
msgid "Clear Selection"
|
||
msgstr "Limpiar selección"
|
||
|
||
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr "Añadir ruta de fuentes compilados"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr "Directorio de salida"
|
||
|
||
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr "Marca de directorio fuente del Paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr "Ruta de Unidad"
|
||
|
||
#: lazarusidestrconsts.lispkgdeletedependencies
|
||
msgid "Delete dependencies"
|
||
msgstr "Eliminar dependencias"
|
||
|
||
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr "¿Desea realmente olvidar todos los cambios en el paquete %s y recargarlo desde el archivo?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr "Nueva unidad no presente un ruta de unidades"
|
||
|
||
#: lazarusidestrconsts.lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr "Publicar Paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr "¿Revertir paquete?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
#| msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
||
msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
|
||
msgstr "El archivo %s%s%s%sno está actualmente en la ruta de unidades del paquete.%s%s¿Añadir %s%s%s a la ruta de unidades?"
|
||
|
||
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
|
||
msgid "There are more functions in the popupmenu"
|
||
msgstr "Hay más funciones en el menú contextual"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypebinary
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
||
msgid "Binary"
|
||
msgstr "Binario"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr "Incluir Archivo"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr "Archivo xml de problemas"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr "LFM - Lazarus desde texto"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr "LRS - Recurso de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypemainunit
|
||
msgid "Main Unit"
|
||
msgstr "Unidad Principal"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypetext
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
||
msgid "Text"
|
||
msgstr "Texto"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeunit
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
|
||
msgid "Unit"
|
||
msgstr "Unidad"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr "Unidad virtual"
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
||
msgid "Package directory. Parameter is package ID"
|
||
msgstr "Directorio paquete. Parametro es ID paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
||
msgid "Package include files search path. Parameter is package ID"
|
||
msgstr "Path busqueda inclusion de paquete. Parametro es ID paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
||
msgid "Package source search path. Parameter is package ID"
|
||
msgstr "Path busqueda fuentes de paquete. Parametro es ID paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
||
msgid "Package unit search path. Parameter is package ID"
|
||
msgstr "Path busqueda unidad de paquete. Parametro es ID paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s%s"
|
||
msgstr "%sAñadiendo nueva Dependencia para paquete %s: paquete %s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s%s"
|
||
msgstr "%sAñadiendo nueva Dependencia para proyecto %s: paquete %s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr "Añadir unidad a la cláusula uses del paquete. Desactivar esto sólo para unidades, puede que no se compile en todos los casos"
|
||
|
||
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr "Encontradas unidades ambiguas"
|
||
|
||
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr "Paquetes instalados automáticamente"
|
||
|
||
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr "%sAmbos paquetes están conectados. Esto significa que cualquiera de los dos paquetes usa al otro, o ambos son usados por un tercer paquete."
|
||
|
||
#: lazarusidestrconsts.lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr "Dependencia rota"
|
||
|
||
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
||
msgid "Circular dependencies found"
|
||
msgstr "Dependencia circular encontrada"
|
||
|
||
#: lazarusidestrconsts.lispkgmangcompilingpackage
|
||
msgid "Compiling package %s"
|
||
msgstr "Compilando paquete %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr "Falló el borrado"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr "¿Borrar archivo de Paquete Viejo?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file %s%s%s?"
|
||
msgstr "¿Borrar archivo de paquete viejo %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr "Dependencia sin Propietario: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr "Error leyendo archivo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr "Error Leyendo Paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
|
||
msgid "Error: updating po files failed for package %s"
|
||
msgstr "Error: falló al actualizar archivos .po para el paquete %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Error escribiendo archivo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr "Error Escribiendo Paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr "El archivo ya está en el paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr "El archivo está en el Proyecto"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr "El nombre de archivo difiere del nombre del paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr "El nombre del archivo es usado por otro paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr "El nombre del archivo es usado por el proyecto"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotfound
|
||
msgid "File %s%s%s not found."
|
||
msgstr "No se encontró el archivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr "Archivo no guardado"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr "Instalar el paquete %s instalará automáticamente el paquete:"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr "Instalar el paquete %s instalará automáticamente los paquetes:"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr "Nombre de compilador no válido"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr "Extensión de archivo no válida"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr "Extensión de archivo del paquete no válida"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr "Nombre de archivo del paquete no válido"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr "Nombre del paquete no válido"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr "Nombre de Paquete no válido"
|
||
|
||
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
||
msgstr "Cargar el paquete %s reemplazaráa el paquete %s%sdel archivo%s.%s El paquete viejo ha sido modificado.%s%s¿Guardar el paquete viejo %s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr "Nuevo paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr "Paquete: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr "Conflictos de paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
||
#, fuzzy
|
||
#| msgid "Package is no designtime package"
|
||
msgid "Package is not a designtime package"
|
||
msgstr "El paquete no es de Tiempo de diseño"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr "Se requiere el Paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr "archivo fuente principal del paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr "El nombre de paquete ya existe"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr "Los paquetes deben de tener la extensión .lpk"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
||
msgid "Please compile the package first."
|
||
msgstr "Porfavor compile el paquete primero."
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr "Por favor guarde el archivo antes de añadirlo al paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr "Proyecto: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr "¿Reconstruir Lazarus?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr "¿Renombrar archivo en minúsculas?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file %s%s%s?"
|
||
msgstr "¿Reemplazar archivo existente %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr "Reemplazar Archivo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
||
msgid "One or more required packages were not found. See package graph for details."
|
||
msgstr "Uno o más paquetes necesarios no fueron encontrados. Ver el gráfico de paquete para más detalles."
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackage
|
||
#, fuzzy
|
||
#| msgid "Save Package?"
|
||
msgid "Save package?"
|
||
msgstr "¿Guardar paquete?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr "Guardar Paquete %s (*.lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
||
msgstr "¿Debería renombrarse el archivo %s%s%s%s en minúsculas?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr "Saltar este paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr "Archivo de configuración de paquetes estáticos"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr "El archivo de compilador para el paquete %s no es un ejecutable válido:%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "El archivo %s%s%s%sya está en el paquete %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
||
#, fuzzy
|
||
#| msgid "The file %s%s%s is not a lazarus package."
|
||
msgid "The file %s%s%s is not a Lazarus package."
|
||
msgstr "El archivo %s%s%s no es un paquete de lazarus."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
||
msgstr "El nombre de archivo %s%s%s no se corresponde con el nombre del paquete %s%s%s en el archivo.%s¿Cambiar el nombre del paquete a %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr "El nombre de archivo %s%s%s es parte del proyecto actual.%sLos proyectos y los paquetes no deberían compartir archivos."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
||
msgstr "El nombre de archivo %s%s%s está siendo usado por%s el paquete %s%s%s%s en el archivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
|
||
msgid "The file \"%s\" of package %s was not found."
|
||
msgstr "El archivo \"%s\" del paquete %s no se a encontrado."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr "Falló la carga del siguiente paquete:"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr "Falló la carga de los siguientes paquetes:"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
||
msgstr "%sLas siguientes unidades serán añadidas a la sección uses de%s%s:%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
||
msgstr "Falló la compilación del paquete %s%s%s.%s¿Eliminarlo de la lista de instalación?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
#, fuzzy
|
||
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
|
||
msgstr "El nombre de archivo del paquete %s%s%s en %s%s%s%s no es un nombre de paquete de lazarus válido."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
#, fuzzy
|
||
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
||
msgstr "El paquete %s es un paquete de sólo ejecución.%sLos paquetes de sólo ejecución no pueden ser instalados en el IDE."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
||
#, fuzzy
|
||
#| msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also uses the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
|
||
msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
|
||
msgstr "El paquete %s está compilado de forma automáticamente y su directorio de salida es \"%s\", que está en el path de búsqueda de unit predeterminado del compilador. El paquete utiliza otros paquetes que también utiliza la búsqueda de unit por defecto del compilador. Esto crea un bucle infinito. %sTu puedes solucionar este problema%squitandolo del path de su fichero de configuración del compilador (por ejemplo fpc.cfg)%so al deshabilitar la actualización automática de este paquete %so mediante la eliminación de las dependencias."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
#, fuzzy
|
||
#| msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
||
msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr "El paquete %s%s%s está marcado para instalar, pero no se puede encontrar.%s¿Borrar la dependencia de la lista de paquetes de instalación?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr "El paquete %s es requerido por %s, que está marcado para instalar.%sMira el gráfico de paquete."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr "El nombre de paquete %s%s%s no es un nombre de paquete válido%sPor favor escoja otro nombre (e.j. paquete1.lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
||
msgstr "El nombre de paquete %s%s%s de%s del archivo %s%s%s no es válido."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
#, fuzzy
|
||
#| msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "El paquete %s%s%s fue marcado.%sActualmente lazarus solo soporta paquetes enlazados estáticamente. La desinstalación completa necesita reconstruir y reiniciar lazarus.%s%s¿Quiere reconstruir lazarus ahora?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
#, fuzzy
|
||
#| msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "El paquete %s%s%s se marcó para instalar.%sActualmente lazarus solo soporta paquetes enlazados estáticamente. La instalación completa necesita reconstruir y reiniciar lazarus.%s%s¿Desea reconstruir ahora Lazarus?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr "El proyecto requiere el paquete %s%s%s.%sPero no se ha encontrado. Mire Proyecto -> Inspector de Proyecto."
|
||
|
||
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
||
msgstr "Hay dos unidades con el mismo nombre:%s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
||
msgid "There is a circular dependency in the packages. See package graph."
|
||
msgstr "Hay una dependencia circular en los paquetes. Ver el gráfico de paquetes."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
||
msgstr "Hay una unidad FPC con el mismo nombre que el paquete:%s%s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
||
msgstr "Hay una unidad de FPC con el mismo nombre como:%s%s%s%s%s desde %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
||
msgstr "Ya hay otro paquete con el nombre %s%s%s.%sPaquete en conflicto: %s%s%s%sArchivo: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
||
#, fuzzy
|
||
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
||
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
|
||
msgstr "Ya hay un paquete %s%s%s cargado %s del archivo %s%s%s.%sMire Paquete -> Gráfico de paquete.%s Es imposible reemplazarlo."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr "Hay un paquete sin guardar en los paquetes requeridos. Mire el gráfico de paquete."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
||
msgstr "Hay una unidad con el mismo nombre que el paquete:%s%s1. %s%s%s de %s%s2. %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr "Este es un paquete virtual. Todavía no tiene código. Por favor, guarde el paquete primero."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr "No se ha podido crear el directorio"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
||
msgstr "No se ha podido crear el directorio de salida %s%s%s%s para el paquete %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
||
msgstr "No se ha podido crear el directorio fuente de paquete %s%s%s%s para el paquete %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
#, fuzzy
|
||
#| msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
||
msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
||
msgstr "No se ha podido crear el directorio objetivo para lazarus:%s%s%s%s.%s Este directorio se necesita paralos cambios realizados en el IDE de lazarus con sus propios paquetes."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file %s%s%s."
|
||
msgstr "No se ha podido borrar el archivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr "No se ha podido borrar el archivo"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
||
msgstr "No se ha podido borrar el archivo de estado viejo %s%s%s%s para el paquete %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr "No se pudo cargar el paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
||
msgstr "No se ha podido abrir el paquete %s%s%s.%sEste paquete está marcado para instalación."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "No se ha podido leer el archivo de estado %s%s%s%s del paquete %s.%s Error: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
||
msgstr "No se ha podido escribir el paquete %s%s%s%s al archivo %s%s%s.%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "No se ha podido escribir el archivo de estado %s%s%s%s del paquete %s.%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr "¿Desinstalar paquete?"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr "¿Desinstalar paquete %s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr "Paquete sin guardar"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr "Usar unidad"
|
||
|
||
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
||
msgstr "Advertencia: El archivo %s%s%s%s pertenece al proyecto actual."
|
||
|
||
#: lazarusidestrconsts.lispkgmgrkeep
|
||
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
||
msgid "keep"
|
||
msgstr "mantener"
|
||
|
||
#: lazarusidestrconsts.lispkgmgrnew
|
||
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
||
msgid "new"
|
||
msgstr "nuevo"
|
||
|
||
#: lazarusidestrconsts.lispkgmgrremove
|
||
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
||
msgid "remove"
|
||
msgstr "quitar"
|
||
|
||
#: lazarusidestrconsts.lispkgselectapackage
|
||
msgid "Select a package"
|
||
msgstr "Seleccionar un paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgsinstalled
|
||
msgctxt "lazarusidestrconsts.lispkgsinstalled"
|
||
msgid "Installed"
|
||
msgstr "Instalado"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
||
#, fuzzy
|
||
#| msgid "Can not register components without unit"
|
||
msgid "Cannot register components without unit"
|
||
msgstr "No se puede registrar los componentes sin una unidad"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class %s%s%s already defined"
|
||
msgstr "La clase %s%s%s del Componente ya está definida"
|
||
|
||
#: lazarusidestrconsts.lispkgsysfilename
|
||
msgid "%s%sFile Name: %s%s%s"
|
||
msgstr "%s%sNombre de Archivo: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr "Clase de componente no válida"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr "Nombre de unidad no válido: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgsyslpkfilename
|
||
msgid "%s%slpk file: %s%s%s"
|
||
msgstr "%s%sarchivo lpk: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr "Archivo de paquete no encontrado"
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
||
msgid "Package registration error"
|
||
msgstr "Error de registro del paquete"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr "Registrar procedimiento como nulo"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr "Se llamó a RegisterUnit, pero no se está registrando un paquete."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
|
||
msgid "%s%sThe lpk file was not found."
|
||
msgstr "%s%sEl archivo lpk no se ha encontrado."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr "El paquete %s%s%s está instalado pero se encontró un archivo de paquete (.lpk) no válido.%sSe ha creado un paquete vacío."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr "Este es el paquete predeterminado. Usado únicamente para componentes sin paquete. Estos componentes están sin actualizar."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr "Este paquete está instalado pero el archivo .lpk no se encuentra. Todos sus componentes están desactivados. Por favor, corrija esto."
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitname
|
||
msgid "%s%sUnit Name: %s%s%s"
|
||
msgstr "%s%sNombre de Unidad: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
||
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
||
msgstr "Unidad \"%s\" no se encontró en el archivo lpk.%sProvablemente este lpk no se utilizó para la construcción de este IDE. O el mal uso en el paquete del procedimiento RegisterUnit."
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
||
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
|
||
msgid "Unit \"%s\" was removed from package (lpk)"
|
||
msgstr "Unidad \"%s\" ha sido removida del paquete (lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
||
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
|
||
msgstr "No se necesitan las siguientes dependencias, debido a la transitividad automática entre dependencias de paquetes."
|
||
|
||
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
||
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options / Additions and Overrides%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr "Este archivo no está en ningún paquete cargado."
|
||
|
||
#: lazarusidestrconsts.lispkgtransitivity
|
||
msgid "Transitivity"
|
||
msgstr "Transitividad"
|
||
|
||
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file %s%s%s.%sError: %s"
|
||
msgstr "No se puede leer el archivo del paquete %s%s%s.%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisplay
|
||
msgid "Play"
|
||
msgstr "Reproducir"
|
||
|
||
#: lazarusidestrconsts.lispldglobal
|
||
msgctxt "lazarusidestrconsts.lispldglobal"
|
||
msgid "Global"
|
||
msgstr "Global"
|
||
|
||
#: lazarusidestrconsts.lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr "Enlaces de paquete"
|
||
|
||
#: lazarusidestrconsts.lispldshowgloballinks
|
||
msgid "Show global links"
|
||
msgstr "Mostrar enlaces globales"
|
||
|
||
#: lazarusidestrconsts.lispldshowuserlinks
|
||
msgid "Show user links"
|
||
msgstr "Mostrar enlaces del usuario"
|
||
|
||
#: lazarusidestrconsts.lisplduser
|
||
msgid "User"
|
||
msgstr "Usuario"
|
||
|
||
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
||
msgid "Please fix the error shown in the message window, which is normally below the source editor."
|
||
msgstr "Por favor solucione el error mostrado en la ventana de mensajes, que normalmente está debajo del editor de código fuente."
|
||
|
||
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr "Por favor abra una unidad antes de ejecutar."
|
||
|
||
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr "Por favor seleccione algo de código para extraer un nuevo procedure/method"
|
||
|
||
#: lazarusidestrconsts.lisplistall
|
||
msgid "<All>"
|
||
msgstr "<Todo>"
|
||
|
||
#: lazarusidestrconsts.lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr "Cambiar Fuente"
|
||
|
||
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr "Copiar nombre del método al portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr "Filtrar por cualquier coincidencia en el método"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr "Filtar por coincidencia en el comienzo del método"
|
||
|
||
#: lazarusidestrconsts.lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr "Saltar a selección"
|
||
|
||
#: lazarusidestrconsts.lisplistnone
|
||
msgid "<None>"
|
||
msgstr "Ninguno"
|
||
|
||
#: lazarusidestrconsts.lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr "&Objetos"
|
||
|
||
#: lazarusidestrconsts.lisplistprocedurelist
|
||
msgid "Procedure List"
|
||
msgstr "Lista de Procedimientos."
|
||
|
||
#: lazarusidestrconsts.lisplisttype
|
||
msgctxt "lazarusidestrconsts.lisplisttype"
|
||
msgid "Type"
|
||
msgstr "Tipo"
|
||
|
||
#: lazarusidestrconsts.lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr "Seleccione el directorio de archivos .po"
|
||
|
||
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr "No guardar ninguna información de la sesión"
|
||
|
||
#: lazarusidestrconsts.lispointer
|
||
msgid "Pointer"
|
||
msgstr "Puntero"
|
||
|
||
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
||
msgid "Save in IDE config directory"
|
||
msgstr "Guardar en el directorio de configuración del IDE"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr "Guardar en el archivo .lpi"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr "Guardar en el archivo .lps en el directorio del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisposavesessionfoldstate
|
||
msgid "Save fold info"
|
||
msgstr "Guardar información de pliege(fold)"
|
||
|
||
#: lazarusidestrconsts.lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr "Guardar información de la sesión en"
|
||
|
||
#: lazarusidestrconsts.lisposavesessionjumphistory
|
||
msgid "Save jump history"
|
||
msgstr "Guardar salto historial"
|
||
|
||
#: lazarusidestrconsts.lisprecedingword
|
||
msgid "Preceding word"
|
||
msgstr "Palabra anterior"
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr "directorio de configuración primario, donde Lazarus guarda sus archivos de configuración. Por defecto es "
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigpath
|
||
msgid "Primary config path"
|
||
msgstr "Ruta de configuración primaria"
|
||
|
||
#: lazarusidestrconsts.lisprior
|
||
msgid "prior %s"
|
||
msgstr "anterior %s"
|
||
|
||
#: lazarusidestrconsts.lispriority
|
||
msgctxt "lazarusidestrconsts.lispriority"
|
||
msgid "Priority"
|
||
msgstr "Prioridad"
|
||
|
||
#: lazarusidestrconsts.lisprivate
|
||
msgid "Private"
|
||
msgstr "Privado"
|
||
|
||
#: lazarusidestrconsts.lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr "Método privado"
|
||
|
||
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
||
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
|
||
msgstr "Es probable que necesite instalar algunos paquetes antes de continuar.%s%sAdvertencia:%sEl proyecto utiliza los siguientes paquetes en tiempo de diseño, los cuales pueden ser necesarios para abrir el formulario en el diseñador. Si continua, podría obtener errores relativos a componentes desaparecidos y la carga del formulario probablemente producirá resultados no deseados.%s%sSe recomienda cancelar e instalar esos paquetes primero.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprocedure
|
||
msgctxt "lazarusidestrconsts.lisprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Procedimiento"
|
||
|
||
#: lazarusidestrconsts.lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr "Procedimiento con interface"
|
||
|
||
#: lazarusidestrconsts.lisprogram
|
||
msgctxt "lazarusidestrconsts.lisprogram"
|
||
msgid "Program"
|
||
msgstr "Programa"
|
||
|
||
#: lazarusidestrconsts.lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr "Programa detectado"
|
||
|
||
#: lazarusidestrconsts.lisprogramnotfound
|
||
msgid "Program %s not found"
|
||
msgstr "Programa %s no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
||
msgid "A Free Pascal command line program with some useful settings added."
|
||
msgstr "Un programa de comando de linea de Free Pascal agregó algunos ajustes útiles."
|
||
|
||
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
#, fuzzy
|
||
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
||
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
||
msgstr "El archivo de código del programa debe de tener una extensión de pascal del tipo .pas, .pp o .lpr"
|
||
|
||
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
||
#, fuzzy
|
||
#| msgid "Add files to project"
|
||
msgid "Add Files to Project"
|
||
msgstr "Añadir Archivos al Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr "Ya existe la dependencia"
|
||
|
||
#: lazarusidestrconsts.lisprojaddeditorfile
|
||
#, fuzzy
|
||
#| msgid "Add editor files"
|
||
msgid "Add Editor Files"
|
||
msgstr "Añadir archivos de editor"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr "Versión Min-Max no válida"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpackagename
|
||
msgid "Invalid packagename"
|
||
msgstr "Nombre de paquete no válido"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
||
#, fuzzy
|
||
#| msgid "Invalid pascal unit name"
|
||
msgid "Invalid Pascal unit name"
|
||
msgstr "Nombre de unidad de Pascal no válido"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr "Versión no válida"
|
||
|
||
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr "Versión máxima (opcional):"
|
||
|
||
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr "Versión mínima (opcional)"
|
||
|
||
#: lazarusidestrconsts.lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr "Nuevo Requerimiento"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr "Nombre de paquete:"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr "Paquete no encontrado"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
||
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
||
msgstr "La dependencia %s%s%s no se ha encontrado.%sPor favor, escoja un paquete existente."
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La versión máxima %s%s%s no es válida.%sPor favor use el formato mayor.menor.release.construccion%s Por ejemplo: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "La versión máxima es menor que la versión mínima."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La versión mínima %s%s%s no es válida.%sPor favor use el formato mayor.menor.release.construccion%s Por ejemplo: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
||
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
||
msgstr "El nombre de paquete %s%s%s no es válido.%sPor favor escoja un paquete existente."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package %s%s%s."
|
||
msgstr "El proyecto ya tiene una dependencia para el paquete %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
||
msgstr "El nombre de unidad %s%s%s ya existe en el proyecto%s con archivo: %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
||
msgstr "EL nombre de unidad %s%s%s ya existe en la selección%s con archivo: %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
#, fuzzy
|
||
#| msgid "The unit name %s%s%s is not a valid pascal identifier."
|
||
msgid "The unit name %s%s%s is not a valid Pascal identifier."
|
||
msgstr "El nombre de unidad %s%s%s no es identificador de pascal válido."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtoproject
|
||
#, fuzzy
|
||
#| msgid "Add to project"
|
||
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
||
msgid "Add to Project"
|
||
msgstr "Añadir al Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr "Ya existe el nombre de unidad"
|
||
|
||
#: lazarusidestrconsts.lisproject
|
||
msgid "Project %s"
|
||
msgstr "Proyecto %s"
|
||
|
||
#: lazarusidestrconsts.lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr "Proyecto cambiado"
|
||
|
||
#: lazarusidestrconsts.lisprojectchangedondisk
|
||
msgid "Project changed on disk"
|
||
msgstr "El proyecto ha cambiado en el disco-"
|
||
|
||
#: lazarusidestrconsts.lisprojectcount
|
||
msgid "%d projects"
|
||
msgstr "%d proyectos"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectory
|
||
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Directorio del Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
||
msgid "Title in taskbar shows also directory path of the project"
|
||
msgstr "El título de la barra de tareas muestra también la ruta del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr "Nombre de archivo del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr "Ruta Include del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr "Archivo de información del proyecto detectado"
|
||
|
||
#: lazarusidestrconsts.lisprojectinformation
|
||
#, fuzzy
|
||
#| msgid "Project Information"
|
||
msgid "Project information"
|
||
msgstr "Información del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr "El proyecto es ejecutable"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacro
|
||
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
||
msgid "Project"
|
||
msgstr "Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr "Propiedades de la macro del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectoutdir
|
||
msgid "Project Output directory (e.g. the ppu directory)"
|
||
msgstr "Directorio de salida del proyecto (ej. el directorio ppu)"
|
||
|
||
#: lazarusidestrconsts.lisprojectoutputdirectory
|
||
msgid "Project output directory"
|
||
msgstr "Directorio salida de Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectpathhint
|
||
msgid "Directory where project's main file must be"
|
||
msgstr "Directorio donde el archivo principal del proyecto debe estar"
|
||
|
||
#: lazarusidestrconsts.lisprojectsession
|
||
msgid "Project Session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsessionchanged
|
||
msgid "Project session changed"
|
||
msgstr "Session de proyecot cambiada"
|
||
|
||
#: lazarusidestrconsts.lisprojectsourcedirectories
|
||
msgid "Project source directories"
|
||
msgstr "Directorios de fuentes del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
||
msgid "%0:s%0:s At address %1:x"
|
||
msgstr "%0:s%0:s en dirección %1:x"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
||
msgid "Project %s raised exception class '%s'."
|
||
msgstr "El proyecto %s ha lanzado una excepción de la clase '%s'."
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
||
msgid "Project %s raised exception class '%s' with message:%s%s"
|
||
msgstr "El proyecto %s ha lanzado una excepción '%s' con el mensaje:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
||
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
||
msgstr "%0:s%0:s En archivo '%1:s' en dirección %2:x"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
||
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
||
msgstr "%0:s%0:s En archivo '%1:s' en linea %2:d"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
||
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
||
msgstr "%0:s%0:s En archivo '%1:s' en linea %2:d:%0:s%3:s"
|
||
|
||
#: lazarusidestrconsts.lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr "Ruta fuente del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
|
||
#| msgid "Project %s%s%s successfully built. :)"
|
||
msgid "Project %s%s%s successfully built"
|
||
msgstr "El proyecto %s%s%s se ha construido correctamente"
|
||
|
||
#: lazarusidestrconsts.lisprojectunit
|
||
msgid "project unit"
|
||
msgstr "Unidad del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr "Ruta de Unidad del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojectwizard
|
||
msgid "Project Wizard"
|
||
msgstr "Asistente de proyecto"
|
||
|
||
#: lazarusidestrconsts.lisprojfiles
|
||
msgid "Files:"
|
||
msgstr "Archivos:"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr "Confirmar borrado de dependencia"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr "Confirmar eliminación de archivo"
|
||
|
||
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr "¿Borrar dependencia para %s?"
|
||
|
||
#: lazarusidestrconsts.lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr "Inspector de Proyecto - %s"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
||
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
||
msgid "Removed required packages"
|
||
msgstr "Paquetes requeridos eliminados"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr "¿Eliminar el archivo %s del proyecto?"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr "No se puede leer el archivo de estado %s del proyecto %s.%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr "No es posible escribir el archivo de estado para el proyecto %s%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr "Construir siempre (incluso si nada ha cambiado)"
|
||
|
||
#: lazarusidestrconsts.lisprojoptserror
|
||
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
||
msgid "Error"
|
||
msgstr "Error"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr "No se ha podido cambiar en el programa fuente la lista de crear automáticamente formularios.%sPor favor corrija los errores primero."
|
||
|
||
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr "Marca del directorio fuente del proyecto"
|
||
|
||
#: lazarusidestrconsts.lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr "Preguntar por valor"
|
||
|
||
#: lazarusidestrconsts.lisproperties
|
||
msgid "Properties (replace or remove)"
|
||
msgstr "Propiedades (reemplazar o eliminar)"
|
||
|
||
#: lazarusidestrconsts.lisprotected
|
||
msgid "Protected"
|
||
msgstr "Protegido"
|
||
|
||
#: lazarusidestrconsts.lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr "Método protegido"
|
||
|
||
#: lazarusidestrconsts.lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr "Método público"
|
||
|
||
#: lazarusidestrconsts.lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr "Método publicado"
|
||
|
||
#: lazarusidestrconsts.lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr "Directorio para publicar el proyecto"
|
||
|
||
#: lazarusidestrconsts.lispublishproject
|
||
msgid "Publish Project"
|
||
msgstr "Publicar Proyecto"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
||
#, fuzzy
|
||
#| msgid "Invalid Exclude filter"
|
||
msgid "Invalid exclude filter"
|
||
msgstr "Filtro de exclusión no válido"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
||
#, fuzzy
|
||
#| msgid "Invalid Include filter"
|
||
msgid "Invalid include filter"
|
||
msgstr "Filtro de inclusión no válido"
|
||
|
||
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
||
msgid "Save .lrs files in the output directory"
|
||
msgstr "Guardar archivos .lrs en el directorio de salida"
|
||
|
||
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
||
#, fuzzy
|
||
#| msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
||
msgid "A Pascal unit must have the extension .pp or .pas"
|
||
msgstr "Una unidad de pascal debe tener la extension .pp o .pas"
|
||
|
||
#: lazarusidestrconsts.lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr "Editar unidad virtual"
|
||
|
||
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
||
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Ya hay una unidad con este nombre.%sArchivo: %s"
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
||
#, fuzzy
|
||
#| msgid "The unitname is not a valid pascal identifier."
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid Pascal identifier."
|
||
msgstr "El nombre de unidad no es un identificador Pascal válido"
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
#, fuzzy
|
||
#| msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
||
msgid "The unitname is used when the IDE extends uses clauses"
|
||
msgstr "El nombre de unidad se usa cuando el IDE extiende la cláusula uses."
|
||
|
||
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "El nombre de la unidad y el nombre del archivo no coinciden.%sEjemplo: unit1.pas y Unit1"
|
||
|
||
#: lazarusidestrconsts.lispwconvertproject
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi Project"
|
||
msgid "Convert &Delphi Project"
|
||
msgstr "Convertir Proyecto &Delphi"
|
||
|
||
#: lazarusidestrconsts.lispwnewproject
|
||
#, fuzzy
|
||
#| msgid "New Project"
|
||
msgid "&New Project"
|
||
msgstr "&Nuevo Proyecto"
|
||
|
||
#: lazarusidestrconsts.lispwopenproject
|
||
#, fuzzy
|
||
#| msgid "Open Project"
|
||
msgid "&Open Project"
|
||
msgstr "Abrir Proyect&o"
|
||
|
||
#: lazarusidestrconsts.lispwopenrecentproject
|
||
#, fuzzy
|
||
#| msgid "Open Recent Project"
|
||
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
||
msgid "Open &Recent Project"
|
||
msgstr "Abrir Proyecto &Reciente"
|
||
|
||
#: lazarusidestrconsts.lispwviewexampleprojects
|
||
msgid "View &Example Projects"
|
||
msgstr "Ver Proyectos &Ejemplo"
|
||
|
||
#: lazarusidestrconsts.lisquickfixcreatelocalvariable
|
||
msgid "Create local variable"
|
||
msgstr "Crear variable local"
|
||
|
||
#: lazarusidestrconsts.lisquickfixes
|
||
msgid "Quick fixes"
|
||
msgstr "Corrección rápida"
|
||
|
||
#: lazarusidestrconsts.lisquickfixremoveunit
|
||
msgid "Quick fix: Remove unit"
|
||
msgstr "Solución rápida: Eliminar unidad"
|
||
|
||
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
||
msgid "Search identifier"
|
||
msgstr "Buscar identificador"
|
||
|
||
#: lazarusidestrconsts.lisquit
|
||
msgctxt "lazarusidestrconsts.lisquit"
|
||
msgid "Quit"
|
||
msgstr "Salir"
|
||
|
||
#: lazarusidestrconsts.lisquitlazarus
|
||
#, fuzzy
|
||
#| msgid "Quit Lazarus"
|
||
msgid "&Quit Lazarus"
|
||
msgstr "Salir de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisreaderror
|
||
msgid "Read Error"
|
||
msgstr "Error de lectura"
|
||
|
||
#: lazarusidestrconsts.lisreallydelete
|
||
msgid "Really delete?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrecenttabs
|
||
msgid "Recent tabs"
|
||
msgstr "Tabs recientes"
|
||
|
||
#: lazarusidestrconsts.lisrecord
|
||
msgctxt "lazarusidestrconsts.lisrecord"
|
||
msgid "Record"
|
||
msgstr "Grabar"
|
||
|
||
#: lazarusidestrconsts.lisrecordedmacros
|
||
msgid "Recorded"
|
||
msgstr "Grabados"
|
||
|
||
#: lazarusidestrconsts.lisrecordstruct
|
||
msgid "Record/Structure"
|
||
msgstr "Record/Estructura"
|
||
|
||
#: lazarusidestrconsts.lisredo
|
||
msgctxt "lazarusidestrconsts.lisredo"
|
||
msgid "Redo"
|
||
msgstr "Rehacer"
|
||
|
||
#: lazarusidestrconsts.lisregisters
|
||
msgctxt "lazarusidestrconsts.lisregisters"
|
||
msgid "Registers"
|
||
msgstr "Registros"
|
||
|
||
#: lazarusidestrconsts.lisregularexpression
|
||
msgid "Regular expression"
|
||
msgstr "Expresión Regular"
|
||
|
||
#: lazarusidestrconsts.lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr "Rutas relativas"
|
||
|
||
#: lazarusidestrconsts.lisremove
|
||
#, fuzzy
|
||
#| msgid "remove"
|
||
msgctxt "lazarusidestrconsts.lisremove"
|
||
msgid "Remove"
|
||
msgstr "Quitar"
|
||
|
||
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr "Eliminar todas las propiedades inválidas"
|
||
|
||
#: lazarusidestrconsts.lisremoveallunits
|
||
msgid "Remove all units"
|
||
msgstr "Eliminar todas las Unidades"
|
||
|
||
#: lazarusidestrconsts.lisremovedpropertys
|
||
msgid "Removed property \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovefrominstalllist
|
||
msgid "Remove from install list"
|
||
msgstr "Eliminar de la lista de instalación"
|
||
|
||
#: lazarusidestrconsts.lisremovefromproject
|
||
#, fuzzy
|
||
#| msgid "Remove from project"
|
||
msgid "Remove from Project"
|
||
msgstr "Eliminar del Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisremovefromsearchpath
|
||
msgid "Remove from search path"
|
||
msgstr "Borrar de la ruta de búsqueda"
|
||
|
||
#: lazarusidestrconsts.lisremoveincludepath
|
||
msgid "Remove include path?"
|
||
msgstr "Quitar rutas incluidas?"
|
||
|
||
#: lazarusidestrconsts.lisremovelocalvariable
|
||
msgid "Remove local variable %s"
|
||
msgstr "Eliminar variable local %s"
|
||
|
||
#: lazarusidestrconsts.lisremovelocalvariable2
|
||
msgid "Remove local variable"
|
||
msgstr "Eliminar variable local"
|
||
|
||
#: lazarusidestrconsts.lisremovenonexistingfiles
|
||
#, fuzzy
|
||
#| msgid "Remove non existing files"
|
||
msgid "Remove nonexistent files"
|
||
msgstr "Eliminar archivos no existentes"
|
||
|
||
#: lazarusidestrconsts.lisremoveselectedunits
|
||
msgid "Remove selected units"
|
||
msgstr "Eliminar las unidades seleccionadas"
|
||
|
||
#: lazarusidestrconsts.lisremovethem
|
||
msgid "Remove them"
|
||
msgstr "Quitarlos"
|
||
|
||
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
||
msgid "Remove the paths from \"Other sources\""
|
||
msgstr "Eliminar las rutas de \"Otras fuentes\""
|
||
|
||
#: lazarusidestrconsts.lisremoveunitfromusessection
|
||
msgid "Remove unit from uses section"
|
||
msgstr "Eliminar unidad de la sección uses"
|
||
|
||
#: lazarusidestrconsts.lisremoveunitpath
|
||
msgid "Remove unit path?"
|
||
msgstr "Quitar ruta de unidad"
|
||
|
||
#: lazarusidestrconsts.lisrename
|
||
msgctxt "lazarusidestrconsts.lisrename"
|
||
msgid "Rename"
|
||
msgstr "Renombrar"
|
||
|
||
#: lazarusidestrconsts.lisrename2
|
||
msgid "Rename ..."
|
||
msgstr "Renombrar ..."
|
||
|
||
#: lazarusidestrconsts.lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr "¿Renombrar archivo?"
|
||
|
||
#: lazarusidestrconsts.lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr "Fallo al renombrar archivo"
|
||
|
||
#: lazarusidestrconsts.lisrenameshowresult
|
||
msgid "Show list of renamed Identifiers"
|
||
msgstr "Mostrar lista de Identificadores renombrados"
|
||
|
||
#: lazarusidestrconsts.lisrenameto
|
||
msgid "Rename to %s"
|
||
msgstr "Renombrar a %s"
|
||
|
||
#: lazarusidestrconsts.lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr "Renombrar en minúsculas"
|
||
|
||
#: lazarusidestrconsts.lisreopenproject
|
||
msgid "Reopen project"
|
||
msgstr "Reabrir proyecto"
|
||
|
||
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
||
msgid "Reopen with another encoding"
|
||
msgstr "Re-Abrir con otra codificación de página"
|
||
|
||
#: lazarusidestrconsts.lisrepeat
|
||
msgctxt "lazarusidestrconsts.lisrepeat"
|
||
msgid "Repeat"
|
||
msgstr "Repeat"
|
||
|
||
#: lazarusidestrconsts.lisrepeatcount
|
||
msgid "Repeat Count:"
|
||
msgstr "Cuenta a Repetir:"
|
||
|
||
#: lazarusidestrconsts.lisreplace
|
||
msgctxt "lazarusidestrconsts.lisreplace"
|
||
msgid "Replace"
|
||
msgstr "Reemplazar"
|
||
|
||
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
||
msgid "Replaced property \"%s\" with \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacedtypeswiths
|
||
msgid "Replaced type \"%s\" with \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacement
|
||
msgid "Replacement"
|
||
msgstr "Reemplazo"
|
||
|
||
#: lazarusidestrconsts.lisreplacementfuncs
|
||
msgid "Replacement functions"
|
||
msgstr "Reemplazo de funciones"
|
||
|
||
#: lazarusidestrconsts.lisreplacements
|
||
msgid "Replacements"
|
||
msgstr "Reemplazos"
|
||
|
||
#: lazarusidestrconsts.lisreplaceremoveunknown
|
||
msgid "Fix unknown properties and types"
|
||
msgstr "Arreglar propiedades y tipos"
|
||
|
||
#: lazarusidestrconsts.lisreplacewholeidentifier
|
||
msgid "Replace whole identifier"
|
||
msgstr "Reemplazar el indentificador del conjunto"
|
||
|
||
#: lazarusidestrconsts.lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr "Falló la recolocación de la selección"
|
||
|
||
#: lazarusidestrconsts.lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
|
||
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
|
||
msgid "Requires FPC 2.4 or above. Like Delphi resources"
|
||
msgstr "Requiere FPC 2.4 o superior. Al igual que los recursos de Delphi"
|
||
|
||
#: lazarusidestrconsts.lisrescan
|
||
msgid "Rescan"
|
||
msgstr "Escanear de nuevo"
|
||
|
||
#: lazarusidestrconsts.lisreset
|
||
msgid "Reset"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
||
msgid "Reset all file filters to defaults?"
|
||
msgstr "Restablecer todos los filtros de archivos a los valores predeterminados?"
|
||
|
||
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
||
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr "Error al guardar recurso"
|
||
|
||
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
||
#, fuzzy
|
||
#| msgid "Resource type of project:"
|
||
msgid "Resource type of project"
|
||
msgstr "Tipo de recursos del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisrestart
|
||
msgctxt "lazarusidestrconsts.lisrestart"
|
||
msgid "Restart"
|
||
msgstr "Reiniciar"
|
||
|
||
#: lazarusidestrconsts.lisresult2
|
||
msgid "Result:"
|
||
msgstr "Result:"
|
||
|
||
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
||
msgid "returns list of all values of case variable in front of variable"
|
||
msgstr "Devuelve una lista de todos los valores de una variable CASE frente a la variable"
|
||
|
||
#: lazarusidestrconsts.lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr "Fallo al revertir"
|
||
|
||
#: lazarusidestrconsts.lisright
|
||
msgctxt "lazarusidestrconsts.lisright"
|
||
msgid "Right"
|
||
msgstr "Derecha"
|
||
|
||
#: lazarusidestrconsts.lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr "Anclaje derecho"
|
||
|
||
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr "Espaciado derecho. Este valor se añade al espaciado base y se usa para el espaciado derecho del control."
|
||
|
||
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
||
msgstr "Este es el control hermano al cual el lado derecho está anclado. Déjelo vacío para que sea el padre."
|
||
|
||
#: lazarusidestrconsts.lisrightsides
|
||
msgid "Right sides"
|
||
msgstr "Lados derechos"
|
||
|
||
#: lazarusidestrconsts.lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr "Igualar espacio a la derecha"
|
||
|
||
#: lazarusidestrconsts.lisroot
|
||
msgid "Root"
|
||
msgstr "Raiz"
|
||
|
||
#: lazarusidestrconsts.lisrootdirectory
|
||
msgid "Root Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrun
|
||
msgctxt "lazarusidestrconsts.lisrun"
|
||
msgid "Run"
|
||
msgstr "Ejecutar"
|
||
|
||
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
||
msgid "\"Run and Design time\" packages have no limitations."
|
||
msgstr "Los paquetes \"tiempo ejecución y diseño\" no tienen limitaciones."
|
||
|
||
#: lazarusidestrconsts.lisrunbuttonhint
|
||
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
|
||
msgid "Run"
|
||
msgstr "Ejecutar"
|
||
|
||
#: lazarusidestrconsts.lisrunning
|
||
msgid "%s (running ...)"
|
||
msgstr "%s (ejecutando ...)"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr "archivo no ejecutable"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application %s%s%s is not executable."
|
||
msgstr "La aplicación huésped %s%s%s no es ejecutable."
|
||
|
||
#: lazarusidestrconsts.lisrunstage
|
||
msgctxt "lazarusidestrconsts.lisrunstage"
|
||
msgid "Run"
|
||
msgstr "Ejecutar"
|
||
|
||
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
||
#, fuzzy
|
||
#| msgid "Runtime only, can not be installed in IDE"
|
||
msgid "Runtime only, cannot be installed in IDE"
|
||
msgstr "Tiempo de ejecución solo, no puede ser instalado en el IDE"
|
||
|
||
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
||
#, fuzzy
|
||
#| msgid "\"Run time only\" packages are only for projects. They can not be installed in the IDE, not even indirectly."
|
||
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
||
msgstr "Los paquetes \"solo tiempo ejecución\" son solamente para proyectos. No pueden ser instalados en el IDE, ni siquiera indirectamente."
|
||
|
||
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
||
#, fuzzy
|
||
#| msgid "\"Run time\" packages can be used by projects. They can not be installed in the IDE, unless some design time package requires them."
|
||
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
|
||
msgstr "Los paquetes \"tiempo ejecución\" pueden ser utilizados por proyectos. No pueden ser instalados en el IDE, añ menos requiere algún paquete de tiempo de diseño."
|
||
|
||
#: lazarusidestrconsts.lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr "fallo al ejecutar"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
||
#, fuzzy
|
||
#| msgid "Abstract methods - not yet overridden"
|
||
msgid "Abstract Methods - not yet overridden"
|
||
msgstr "Métodos abstractos - todavía no sobrecargados"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsof
|
||
msgid "Abstract methods of %s"
|
||
msgstr "Métodos abstractos de %s"
|
||
|
||
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr "El cursor no está en la declaración de una clase"
|
||
|
||
#: lazarusidestrconsts.lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr "El IDE está ocupado"
|
||
|
||
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr "%s es una clase abstracta, tiene %s métodos abstractos."
|
||
|
||
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr "No se han encontrado métodos abstractos"
|
||
|
||
#: lazarusidestrconsts.lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr "Ignorar todo lo seleccionado"
|
||
|
||
#: lazarusidestrconsts.lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr "Ignorar la primera selección"
|
||
|
||
#: lazarusidestrconsts.lissamselectnone
|
||
msgid "Select none"
|
||
msgstr "No seleccionar nada"
|
||
|
||
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr "Hay %s métodos abstractos que sobrecargar.%sSeleccione los métodos para los cuales se crearán las sobrecargas:"
|
||
|
||
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr "No quedan métodos abstractos que sobrecargar."
|
||
|
||
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr "Este método no puede ser sobrecargado porque está definido en la clase actual"
|
||
|
||
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr "No se pueden mostrar los métodos abstractos de la clase actual porque"
|
||
|
||
#: lazarusidestrconsts.lissave
|
||
#, fuzzy
|
||
#| msgid "Save ..."
|
||
msgctxt "lazarusidestrconsts.lissave"
|
||
msgid "Save"
|
||
msgstr "Guardar"
|
||
|
||
#: lazarusidestrconsts.lissaveall
|
||
msgctxt "lazarusidestrconsts.lissaveall"
|
||
msgid "Save All"
|
||
msgstr "Guardar todo"
|
||
|
||
#: lazarusidestrconsts.lissaveallchecked
|
||
msgid "Save All Checked"
|
||
msgstr "Salva Todos los Chequeados"
|
||
|
||
#: lazarusidestrconsts.lissaveallmessagestofile
|
||
#, fuzzy
|
||
#| msgid "Save all messages to file"
|
||
msgid "Save All Messages to File"
|
||
msgstr "Guardar todos los mensajes a Archivo"
|
||
|
||
#: lazarusidestrconsts.lissaveallmodified
|
||
#, fuzzy
|
||
#| msgid "save all modified files"
|
||
msgid "Save all modified files"
|
||
msgstr "Guardar todos los archivos modificados"
|
||
|
||
#: lazarusidestrconsts.lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr "Diálogo guardar y salir"
|
||
|
||
#: lazarusidestrconsts.lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr "Guardar y reconstruir el IDE"
|
||
|
||
#: lazarusidestrconsts.lissaveas
|
||
msgctxt "lazarusidestrconsts.lissaveas"
|
||
msgid "Save As"
|
||
msgstr "Guardar Como"
|
||
|
||
#: lazarusidestrconsts.lissavechangedfiles
|
||
msgid "Save changed files?"
|
||
msgstr "Guardar archivos cambiados?"
|
||
|
||
#: lazarusidestrconsts.lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "¿Guardar cambios?"
|
||
|
||
#: lazarusidestrconsts.lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr "¿Guardar cambios al proyecto %s?"
|
||
|
||
#: lazarusidestrconsts.lissavecurrenteditorfile
|
||
#, fuzzy
|
||
#| msgid "save current editor file"
|
||
msgid "Save current editor file"
|
||
msgstr "Guardar el archivo actual del editor"
|
||
|
||
#: lazarusidestrconsts.lissavedsuccessfully
|
||
msgid "Saved successfully"
|
||
msgstr "Salvado automaticamente"
|
||
|
||
#: lazarusidestrconsts.lissavedwithidesettings
|
||
msgid "Saved with IDE settings"
|
||
msgstr "Salvado con ajustes de IDE"
|
||
|
||
#: lazarusidestrconsts.lissavedwithprojectsession
|
||
msgid "Saved with project session"
|
||
msgstr "Salvado con session de proyecto"
|
||
|
||
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr "Guardar información del editor en archivos diferentes al del proyecto"
|
||
|
||
#: lazarusidestrconsts.lissavefileas
|
||
msgid "Save file as"
|
||
msgstr "Guardar archivo como"
|
||
|
||
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
||
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
||
msgstr "¿Guardar archivo %s%s%s%santes de cerrar formulario %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr "Guardar información de los archivos del editor cerrados"
|
||
|
||
#: lazarusidestrconsts.lissavemacroas
|
||
msgid "Save macro as"
|
||
msgstr "Guardar macro como"
|
||
|
||
#: lazarusidestrconsts.lissaveproject
|
||
msgid "Save project %s (*%s)"
|
||
msgstr "Guardar proyecto %s (*%s)"
|
||
|
||
#: lazarusidestrconsts.lissavesessionchangestoproject
|
||
msgid "Save session changes to project %s?"
|
||
msgstr "Guardar cambios en la sesion al proyecot %s?"
|
||
|
||
#: lazarusidestrconsts.lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "Guardar opciones"
|
||
|
||
#: lazarusidestrconsts.lissavespace
|
||
msgid "Save "
|
||
msgstr "Guardar "
|
||
|
||
#: lazarusidestrconsts.lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr "Factor de Escala:"
|
||
|
||
#: lazarusidestrconsts.lisscanning
|
||
msgid "Scanning"
|
||
msgstr "Escaneando"
|
||
|
||
#: lazarusidestrconsts.lisscanparentdir
|
||
msgid "Scanning parent directory"
|
||
msgstr "Escaneando el directorio padre"
|
||
|
||
#: lazarusidestrconsts.lissearchpaths2
|
||
msgid "Search paths"
|
||
msgstr "Rutas de busqueda"
|
||
|
||
#: lazarusidestrconsts.lissearchunit
|
||
msgid "Search unit"
|
||
msgstr "Buscar unidad"
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr "directorio secundario de configuración, donde Lazarus busca las plantillas de archivos de configuración. Por defecto es "
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigpath
|
||
msgid "Secondary config path"
|
||
msgstr "Ruta de configuración secundaria"
|
||
|
||
#: lazarusidestrconsts.lisseemessages
|
||
msgid "See messages."
|
||
msgstr "Ver mensajes."
|
||
|
||
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr "%sVea Proyeco -> Inspector de Proyecto"
|
||
|
||
#: lazarusidestrconsts.lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr "Seleccionar un elemento de ayuda:"
|
||
|
||
#: lazarusidestrconsts.lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "Seleccionar un nodo"
|
||
|
||
#: lazarusidestrconsts.lisselectanotherlclwidgetsetmacrolclwidgettype
|
||
msgid "Select another LCL widget set (macro LCLWidgetType)"
|
||
msgstr "Seleccionar otro widgetset LCL (macro LCLWidgetType)"
|
||
|
||
#: lazarusidestrconsts.lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr "Seleccionar desde archivos Delphi (*.dfm)"
|
||
|
||
#: lazarusidestrconsts.lisselected
|
||
msgctxt "lazarusidestrconsts.lisselected"
|
||
msgid "Selected"
|
||
msgstr "Seleccionado"
|
||
|
||
#: lazarusidestrconsts.lisselectedandchildcontrols
|
||
msgid "Selected and child controls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedbottomneighbour
|
||
msgid "(selected bottom neighbour)"
|
||
msgstr "(vecino inferior seleccionado)"
|
||
|
||
#: lazarusidestrconsts.lisselectedcommandsmapping
|
||
msgid "Selected Command's Mapping"
|
||
msgstr "Seleccionado mapeo de comandos"
|
||
|
||
#: lazarusidestrconsts.lisselectedforinstallation
|
||
msgid "selected for installation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedforuninstallation
|
||
msgid "selected for uninstallation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedleftneighbour
|
||
msgid "(selected left neighbour)"
|
||
msgstr "(vecino izquierdo seleccionado)"
|
||
|
||
#: lazarusidestrconsts.lisselectedrightneighbour
|
||
msgid "(selected right neighbour)"
|
||
msgstr "(vecino derecho seleccionado)"
|
||
|
||
#: lazarusidestrconsts.lisselectedtopneighbour
|
||
msgid "(selected top neighbour)"
|
||
msgstr "(vecino superior seleccionado)"
|
||
|
||
#: lazarusidestrconsts.lisselectfile
|
||
msgid "Select the file"
|
||
msgstr "Seleccionar el archivo"
|
||
|
||
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
||
msgid "Select FPC source directory"
|
||
msgstr "Selecciona directorio de fuentes de FPC"
|
||
|
||
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr "La selección excede la constante de cadena"
|
||
|
||
#: lazarusidestrconsts.lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr "Herramienta de selección"
|
||
|
||
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
||
msgid "Select Lazarus source directory"
|
||
msgstr "Selecciona directorio fuente Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisselectpathto
|
||
msgid "Select path to %s"
|
||
msgstr "Selecciona ruta a %s"
|
||
|
||
#: lazarusidestrconsts.lissetdefault
|
||
msgid "Set default"
|
||
msgstr "Establecer predeterminado"
|
||
|
||
#: lazarusidestrconsts.lissetupdefaultindentation
|
||
#, fuzzy
|
||
#| msgid "(Setup default indentation)"
|
||
msgid "(Set up default indentation)"
|
||
msgstr "(Configurar sangría predeterminada)"
|
||
|
||
#: lazarusidestrconsts.lisshort
|
||
msgid "Short:"
|
||
msgstr "Corto:"
|
||
|
||
#: lazarusidestrconsts.lisshow
|
||
msgid "Show"
|
||
msgstr "Mostrar"
|
||
|
||
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
||
msgid "Show component tree"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowdeclarationhints
|
||
msgid "Show declaration hints"
|
||
msgstr "Mostrar descripciones de declaración"
|
||
|
||
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
||
msgid "Show differences between modes ..."
|
||
msgstr "Mostrar diferencias entre modos ..."
|
||
|
||
#: lazarusidestrconsts.lisshowemptyunitspackages
|
||
msgid "Show empty units/packages"
|
||
msgstr "Ver unidades/paquetes vacios"
|
||
|
||
#: lazarusidestrconsts.lisshowglyphsfor
|
||
msgid "Show Glyphs for:"
|
||
msgstr "Mostrar iconos en:"
|
||
|
||
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
||
msgid "Show gutter"
|
||
msgstr "Mostrar columna de marcas"
|
||
|
||
#: lazarusidestrconsts.lisshowhelp
|
||
msgid "Show help"
|
||
msgstr "Mostrar ayuda"
|
||
|
||
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
||
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
||
msgid "Show hints"
|
||
msgstr "Mostrar descripciones en el Inspector de Objetos"
|
||
|
||
#: lazarusidestrconsts.lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr "Mostrar identificadores"
|
||
|
||
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
||
msgid "Show information box"
|
||
msgstr "Mostrar ventana de información"
|
||
|
||
#: lazarusidestrconsts.lisshowonlymodified
|
||
msgid "Show only modified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowoverviewgutter
|
||
msgid "Show overview Gutter"
|
||
msgstr "Mostrar columna de marcas general"
|
||
|
||
#: lazarusidestrconsts.lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr "Mostrar paquetes"
|
||
|
||
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
||
msgid "Show position of source editor"
|
||
msgstr "Mostrar posicion de editor fuentes"
|
||
|
||
#: lazarusidestrconsts.lisshowrelativepaths
|
||
msgid "Show relative paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
||
msgid "Show setup dialog for most important settings"
|
||
msgstr "Mostrar dialogo configuracion para los ajustes mas importantes"
|
||
|
||
#: lazarusidestrconsts.lisshowspecialcharacters
|
||
msgid "Show special characters"
|
||
msgstr "Mostrar carácteres especiales"
|
||
|
||
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
||
msgid "Show status bar"
|
||
msgstr "Mostrar barra de estado"
|
||
|
||
#: lazarusidestrconsts.lisshowunits
|
||
msgid "Show units"
|
||
msgstr "Mostrar unidades"
|
||
|
||
#: lazarusidestrconsts.lisshowunusedunits
|
||
msgid "Show unused units ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
||
msgid "Show value hints while debugging"
|
||
msgstr "Mostrar descripciones de valores cuando este depurando"
|
||
|
||
#: lazarusidestrconsts.lisshowversionandexit
|
||
msgid "show version and exit"
|
||
msgstr "Mostrar versión y salir"
|
||
|
||
#: lazarusidestrconsts.lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr "Encoger al más pequeño"
|
||
|
||
#: lazarusidestrconsts.lissibling
|
||
msgid "Sibling"
|
||
msgstr "Hermano"
|
||
|
||
#: lazarusidestrconsts.lissimpleprogram
|
||
msgid "Simple Program"
|
||
msgstr "Programa simple"
|
||
|
||
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
||
msgid "A most simple Free Pascal command line program."
|
||
msgstr "El mas sencillo programa Free Pascar en linea de comandos"
|
||
|
||
#: lazarusidestrconsts.lissimplesyntax
|
||
#, fuzzy
|
||
#| msgid "Simple Syntax"
|
||
msgid "Simple syntax"
|
||
msgstr "Sintaxis simple"
|
||
|
||
#: lazarusidestrconsts.lisskiperrors
|
||
msgid "Skip errors"
|
||
msgstr "Saltar errores"
|
||
|
||
#: lazarusidestrconsts.lisskipfile
|
||
msgid "Skip file"
|
||
msgstr "Omitir archivo"
|
||
|
||
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr "Saltar archivo y continuar cargando"
|
||
|
||
#: lazarusidestrconsts.lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr "Continuar cargando el último proyecto"
|
||
|
||
#: lazarusidestrconsts.lissmallerratherthanfaster
|
||
msgid "Smaller rather than faster"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissmatches
|
||
msgid "Matches"
|
||
msgstr "Coincidencias"
|
||
|
||
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr "Lo siento, este tipo no está todavía implementado"
|
||
|
||
#: lazarusidestrconsts.lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "Ascendiendo"
|
||
|
||
#: lazarusidestrconsts.lissortselcasesensitive
|
||
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
||
msgid "&Case Sensitive"
|
||
msgstr "&Sensible a Mayúsculas"
|
||
|
||
#: lazarusidestrconsts.lissortseldescending
|
||
msgid "Descending"
|
||
msgstr "Descendente"
|
||
|
||
#: lazarusidestrconsts.lissortseldomain
|
||
msgid "Domain"
|
||
msgstr "Dominio"
|
||
|
||
#: lazarusidestrconsts.lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr "Ignorar espacios"
|
||
|
||
#: lazarusidestrconsts.lissortsellines
|
||
msgid "Lines"
|
||
msgstr "Líneas"
|
||
|
||
#: lazarusidestrconsts.lissortseloptions
|
||
msgctxt "lazarusidestrconsts.lissortseloptions"
|
||
msgid "Options"
|
||
msgstr "Opciones"
|
||
|
||
#: lazarusidestrconsts.lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr "Párrafos"
|
||
|
||
#: lazarusidestrconsts.lissortselpreview
|
||
msgctxt "lazarusidestrconsts.lissortselpreview"
|
||
msgid "Preview"
|
||
msgstr "Vista previa"
|
||
|
||
#: lazarusidestrconsts.lissortselsort
|
||
msgid "Accept"
|
||
msgstr "Aceptar"
|
||
|
||
#: lazarusidestrconsts.lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr "Ordenar selección"
|
||
|
||
#: lazarusidestrconsts.lissortselwords
|
||
msgctxt "lazarusidestrconsts.lissortselwords"
|
||
msgid "Words"
|
||
msgstr "Palabras"
|
||
|
||
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr "Origen y destino son el mismo:%s%s"
|
||
|
||
#: lazarusidestrconsts.lissourcebreakpoint
|
||
#, fuzzy
|
||
#| msgid "&Source Breakpoint..."
|
||
msgid "&Source Breakpoint ..."
|
||
msgstr "Punto de Interrupción en código fuente ..."
|
||
|
||
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
||
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
||
msgstr "El directorio origen %s%s%s%sy el directorio de destino %s%s%s%sson el mismo.%s%sQuizas no entendió bien ésta función.%sLa cúal limpiará/recreará el directorio de destino%sy copiará el paquete/proyecto en el."
|
||
|
||
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
||
msgid "Source directory %s%s%s does not exist."
|
||
msgstr "El directorio fuente %s%s%s no existe."
|
||
|
||
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
||
msgid "Source Editor Window Manager"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr "Fuente modificado"
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
||
msgid "Source of page %s%s%s has changed. Save?"
|
||
msgstr "El código fuente de la página %s%s%s ha cambiado.¿Guardar?"
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
|
||
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
|
||
msgstr "Las fuentes de más de una página han cambiado. ¿Guardar página %s%s%s? (%d más)"
|
||
|
||
#: lazarusidestrconsts.lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr "Rutas fuente"
|
||
|
||
#: lazarusidestrconsts.lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr "Igualar espacio"
|
||
|
||
#: lazarusidestrconsts.lissrcos
|
||
msgid "Src OS"
|
||
msgstr "OS Fuente"
|
||
|
||
#: lazarusidestrconsts.lisssearching
|
||
msgid "Searching"
|
||
msgstr "Buscando"
|
||
|
||
#: lazarusidestrconsts.lisssearchtext
|
||
msgid "Search text"
|
||
msgstr "Buscar texto"
|
||
|
||
#: lazarusidestrconsts.lisstartconversion
|
||
msgid "Start Conversion"
|
||
msgstr "Comenzar Conversión"
|
||
|
||
#: lazarusidestrconsts.lisstartide
|
||
msgid "Start IDE"
|
||
msgstr "Arrancar IDE"
|
||
|
||
#: lazarusidestrconsts.lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr "Empezar con un proyecto nuevo"
|
||
|
||
#: lazarusidestrconsts.lisstop
|
||
msgctxt "lazarusidestrconsts.lisstop"
|
||
msgid "Stop"
|
||
msgstr "Detener"
|
||
|
||
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr "¿Parar esta sesión de depuración y reconstruir el proyecto?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr "¿Parar Depurando?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr "¿Parar sesión de depuración?"
|
||
|
||
#: lazarusidestrconsts.lisstoponexception
|
||
msgid "Stop on exception"
|
||
msgstr "Detener en excepción"
|
||
|
||
#: lazarusidestrconsts.lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr "¿Parar la depuración?"
|
||
|
||
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
||
msgid "Store path delimiters \\ and / as"
|
||
msgstr "Guarde delimitadores de ruta \\ y / como"
|
||
|
||
#: lazarusidestrconsts.lisstrangelpifile
|
||
msgid "Strange lpi file"
|
||
msgstr "Archivo lpi extraño"
|
||
|
||
#: lazarusidestrconsts.lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr "Error de flujo"
|
||
|
||
#: lazarusidestrconsts.lisstring
|
||
msgid "String"
|
||
msgstr "Cadena"
|
||
|
||
#: lazarusidestrconsts.lisstyle
|
||
msgctxt "lazarusidestrconsts.lisstyle"
|
||
msgid "Style"
|
||
msgstr "Estilo"
|
||
|
||
#: lazarusidestrconsts.lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr "Subprocedimiento"
|
||
|
||
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr "Subprocedimiento en el mismo nivel"
|
||
|
||
#: lazarusidestrconsts.lissuccess
|
||
msgid "Success"
|
||
msgstr "Éxito"
|
||
|
||
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
||
msgid "Suggest default name of new file in lowercase"
|
||
msgstr "Sugerir nombre predeterminado del nuevo archivo en minúsculas"
|
||
|
||
#: lazarusidestrconsts.lissuspiciousincludepath
|
||
msgid "Suspicious include path"
|
||
msgstr "Ruta de inclusión sospechosa"
|
||
|
||
#: lazarusidestrconsts.lissuspiciousunitpath
|
||
msgid "Suspicious unit path"
|
||
msgstr "Ruta de unidad sospechosa"
|
||
|
||
#: lazarusidestrconsts.lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr "Revisión SVN: "
|
||
|
||
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr "Nombre de variable no válido"
|
||
|
||
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
||
msgid "%s%s%s is not a valid identifier."
|
||
msgstr "%s%s%s no es un identificador válido."
|
||
|
||
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr "No hacer caso de variable de sistema"
|
||
|
||
#: lazarusidestrconsts.lissyntaxmode
|
||
msgid "Syntax mode"
|
||
msgstr "Modo de sintaxis"
|
||
|
||
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
||
msgid "system.ppu not found. Check your fpc.cfg."
|
||
msgstr "system.ppu no se encuentra. Revise su fpc.cfg."
|
||
|
||
#: lazarusidestrconsts.listab
|
||
msgid "Tab"
|
||
msgstr "Tab"
|
||
|
||
#: lazarusidestrconsts.listaborderconfirmsort
|
||
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
||
msgstr "Ordenar el orden de tabulación de todos los controles secundarios de \"%s\" por sus posiciones?"
|
||
|
||
#: lazarusidestrconsts.listaborderdownhint
|
||
msgid "Move the selected control down in tab order"
|
||
msgstr "Mover el control seleccionado hacia abajo en el orden de tabulación"
|
||
|
||
#: lazarusidestrconsts.listaborderof
|
||
#, fuzzy
|
||
#| msgid "Tab Order of"
|
||
msgid "Tab Order of %s"
|
||
msgstr "Orden de tabulación de %s"
|
||
|
||
#: lazarusidestrconsts.listabordersorthint
|
||
msgid "Calculate tab order for controls by their X- and Y- positions"
|
||
msgstr "Calcular el orden de tabulación de los controles por parte de sus posiciones X- e Y-"
|
||
|
||
#: lazarusidestrconsts.listaborderuphint
|
||
msgid "Move the selected control up in tab order"
|
||
msgstr "Mover el control seleccionado hacia arriba en el orden de tabulación"
|
||
|
||
#: lazarusidestrconsts.listabsfor
|
||
msgid "Tabs for %s"
|
||
msgstr "Tabs por %s"
|
||
|
||
#: lazarusidestrconsts.listakesnapshot
|
||
msgid "Take a Snapshot"
|
||
msgstr "Tomar una Instantanea"
|
||
|
||
#: lazarusidestrconsts.listarget
|
||
msgid "Target:"
|
||
msgstr "Objetivo:"
|
||
|
||
#: lazarusidestrconsts.listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr "CPU objetivo"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
||
msgid "Target file name: (-o, empty = use unit output directory)"
|
||
msgstr "Nombre de archivo final: (-o, vacio = usar el directorio de salida de la unidad)"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameo
|
||
msgid "Target file name (-o):"
|
||
msgstr "Nombre del archivo final (-o):"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr "Nombre del archivo objetivo del proyecto"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr "NombreDeArchivo + Parametros objetivo"
|
||
|
||
#: lazarusidestrconsts.listargetos
|
||
msgctxt "lazarusidestrconsts.listargetos"
|
||
msgid "Target OS"
|
||
msgstr "OS objetivo:"
|
||
|
||
#: lazarusidestrconsts.listcompilerinternalerror
|
||
msgid "Internal compiler error! (%d)"
|
||
msgstr "¡Error interno del compilador! (%d)"
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcell
|
||
msgid "Editable Cell"
|
||
msgstr "Celda Editable"
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
||
#, fuzzy
|
||
msgid "Inserts an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
|
||
msgstr "Inserta una celda editable. Las células se puede navegar con el tabulador.%0:sLa macro \"param\" toma una lista de argumentos separados por comas.%0:sEl primer argumento es el valor predeterminado.%0:sEl segundo argumento (opcional) puede ser utilizado para conectar la celda a otro celda (syncro edit)%0:s%0:s mientras param(\"foo\") hace param(foo);%0:sInserta dos celdas independientes, ambos con el texto por defecto \"foo\"%0:sLas comillas son opcionales%0:s%0:s si param(\"foo\") > 0 y param(\"foo\", sync = 1) < 99 entonces %0:sInserta dos celdas vinculadas, ya sea una edición, cambiará la otra también%0:sEl valor \"1\" se refiere a la posición del otro \"param()\", así que si hay más params:%0:s si param(\"bar\") y param(foo) > 0 y param(foo,sync=2) < 99 entonces%0:sLa segunda y tercera están vinculadas. (el tercero se refiere a \"2\") %0:s%0:s\"sync se puede acortar a \"s\":%0:s si param(\"foo\") > 0 y param(\"foo\",s=1) < 99 entonces%0:s%0:s si param(\"bar\") y param(\"foo\") > 0 y param(\"foo\",sync) < 99 entonces%0:sEl segundo y tercero están vinculados.%0:sNota: \"Sync no tiene una posición y no \"=\", así que se sincroniza a la celda anterior con el mismo defecto (en este caso \"foo\")"
|
||
|
||
#: lazarusidestrconsts.listemplatefile
|
||
msgid "Template file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listestdirectory
|
||
msgid "Test directory"
|
||
msgstr "Directorio de prueba"
|
||
|
||
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
||
msgid "The Application Bundle was created for \"%s\""
|
||
msgstr "El envoltorio de la aplicación fue creado para \"%s\""
|
||
|
||
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
#, fuzzy
|
||
#| msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
||
msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
||
msgstr "La clase %s%s%s es del tipo TControl y no puede ser pegada en un objeto que no es un control.%sNo se puede pegar."
|
||
|
||
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
||
#, fuzzy
|
||
#| msgid "The codetools found an error:%s%s%s"
|
||
msgid "The Codetools found an error:%s%s%s"
|
||
msgstr "Codetools encontró un error:%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
||
msgid "The command after %s%s%s is not executable."
|
||
msgstr "El comando después %s%s%s no es ejecutable."
|
||
|
||
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s%s%s%s"
|
||
msgstr "El comando después de publicar no es válido:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
||
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
||
msgstr "El archivo del complilador \"%s\" parece no ser correcto:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
||
msgid "The component %s can not be deleted, because it is not owned by %s."
|
||
msgstr "El componente %s no pude ser eliminado por que %s no es su propietario"
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
||
msgstr "El editor de componentes de la clase %s%s%s ha creado el error:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
||
msgstr "El editor de componentes de la clase %s%s%s%sinvocado con el verbo #%s %s%s%s%sha creado el error:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
||
msgstr "El componente %s hereda de %s.%sPara eliminar un componente heredado, abra el ancestro y borrelo ahí."
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
||
msgstr "El componente %s es heredado de %s.%sPara renombrar un componente heredado abre el padre y renombralo alli."
|
||
|
||
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
||
#, fuzzy
|
||
#| msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
|
||
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
||
msgstr "El nombre del componente debe ser unico entre todos los componentes del formulario/módulo de datos. El nombre es cotejado sin diferenciar entre minúsculas o mayúsculas como un identificador pascal normal. "
|
||
|
||
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
||
msgid "The configuration will be downgraded/converted."
|
||
msgstr "La configuración se degradó/convirtio."
|
||
|
||
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
||
#, fuzzy
|
||
#| msgid "The %s contains a not existing directory:%s%s"
|
||
msgid "The %s contains a nonexistent directory:%s%s"
|
||
msgstr "El %s contiene un directorio inexistente:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
||
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
||
msgstr "El %s contiene un carácter * asterisco.%sLazarus usa este como un carácter normal y no lo desarrolla como máscara de archivo."
|
||
|
||
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
||
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
||
msgstr "El FPC actual no tiene archivo de configuración. Ello hará que probablemente no se encuentren algunas unidades. Compruebe su instalación de fpc."
|
||
|
||
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
||
#, fuzzy
|
||
#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
|
||
msgstr "El directorio actual de las fuentes de Free Pascal%s%s%s%sno parece el correcto.%sPulse Aceptar para usar %s%s%s.%sEn otro caso compruebe Herramientas -> Opciones -> Archivos"
|
||
|
||
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
||
#, fuzzy
|
||
#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
|
||
msgstr "El directorio actual de Lazarus %s%s%s%sno parece el correcto.%sSin él no podrá crear aplicaciones LCL.%sPulse Aceptar para usar %s%s%s.%sEn otro caso compruebe Herramientas -> Opciones -> Archivos"
|
||
|
||
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
#, fuzzy
|
||
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
||
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
|
||
msgstr "El depurador %s%s%s%sno existe o no es ejecutable.%s%sMire Herramientas -> Opciones -> Opciones del depurador"
|
||
|
||
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
|
||
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
|
||
msgstr "El ejecutable del depurador normalmente tiene el nombre \"%s\". Por favor dar la ruta completa del archivo."
|
||
|
||
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
||
msgid "The default mode must be stored in project, not in session."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s%s%s%s does not exist."
|
||
msgstr "El directorio de destino%s%s%s%s no existe."
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
||
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
||
msgstr "El directorio de destino %s%s%s no existe.%sFavor de verificar el nombre del archivo objetivo del proyecto en Menu > Proyecto > Opciones de Proyecto."
|
||
|
||
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
||
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
||
msgstr "El directorio \"%s\" no contiene ningún más archivos del proyecto . Quitar este directorio de la ruta de búsqueda del proyecto?"
|
||
|
||
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
||
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
||
msgstr "El directorio \"%s\" no contiene más unidades del proyecto. Quitar este directorio de la ruta de busqueda de unidad(unit) del proyecto?"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
||
msgstr "El directorio %s%s%s no se necesitará más en la ruta de la unidad.%s¿Eliminarlo?"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
||
msgid "The directory %s%s%s is not writable."
|
||
msgstr "El directorio %s%s%s no es escribible"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
||
msgstr "El directorio %s%s%s no está todavía en la ruta de la unidad.%s¿Añadirlo?"
|
||
|
||
#: lazarusidestrconsts.listhedirectorywasnotfound
|
||
msgid "The directory %s was not found."
|
||
msgstr "El directorio %s no fue encontrado."
|
||
|
||
#: lazarusidestrconsts.listhefile
|
||
msgid "The file %s%s%s"
|
||
msgstr "El archivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
||
msgid "The file %s does not look like a lpi file."
|
||
msgstr "El archivo %s no parece un archivo lpi."
|
||
|
||
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
||
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
||
msgstr "El índice de archivos es necesario para funciones como la busqueda de declaraciones. Durante el escaneo puede editar las fuentes y compilar, pero funciones como la busqueda de declaraciones mostrarán errores de unidad-no-encontrada. Esto puede tardar un minuto."
|
||
|
||
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
||
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
||
msgstr "El archivo %s%s%s es un enlace simbólico.%s%s ¿Abrir %s%s%s en su lugar?"
|
||
|
||
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
||
#, fuzzy
|
||
#| msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
|
||
msgid "The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?"
|
||
msgstr "El archivo %s%s%s no es un proyecto de lazarus.%s¿Creamos un nuevo proyecto para %s?"
|
||
|
||
#: lazarusidestrconsts.listhefilemaskisinvalid
|
||
msgid "The file mask \"%s\" is invalid."
|
||
msgstr "La mascara de archivo \"%s\" es invalida."
|
||
|
||
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
||
msgid "The file mask \"%s\" is not a valid regular expression."
|
||
msgstr "La mascara de archivo \"%s\" no es una expresion regular valida."
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
||
#, fuzzy
|
||
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr "El archivo %s%s%s%sparece ser un programa. ¿Cerrar el proyecto actual y crear un nuevo proyecto de Lazarus para este programa?%s\"No\" cargará el archivo como un fuente normal."
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
#, fuzzy
|
||
#| msgid "The file %s seems to be the program file of an existing lazarus Project."
|
||
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
||
msgstr "El archivo %s parece ser el archivo de programa de un proyecto de Lazarus existente"
|
||
|
||
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
||
msgstr "El archivo %s%s%s%sfue hallado en uno de los directorios de fuentes del paquete %s y parece una Unidad compilada. Las Unidades compiladas deben estar en el directorio de Salida del paquete, de otro modo otros paquetes pueden tener problemas cuando usen éste paquete.%s%s¿Eliminar el archivo causante de la ambigüedad?"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
||
msgstr "No se encontró el archivo %s%s%s%s.%s¿Quiere localizarlo usted mismo?%s"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr "No se ha encontrado el archivo %s%s%s%s.%sIgnorar seguiráa cargando el proyecto,%sAbortar pararáa la carga."
|
||
|
||
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
||
msgstr "Los métodos siguientes usados por %s no están en el fuente%s%s%s%s%s%s¿Eliminar las referencias pendientes?"
|
||
|
||
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
||
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
||
msgstr "El directorio de origen FPC \"%s\" no se ve correcto:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
||
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
||
msgstr "El ejecutable del compilador Free Pascal normalmente tiene el nombre \"%s\". También puede utilizar el compilador objetivo específico, como \"%s\". Por favor indique la ruta completa del archivo."
|
||
|
||
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
||
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
||
msgstr "El identificador es una Unidad. Favor de usar la función Archivo -> Guardar Como para renombrar una Unidad."
|
||
|
||
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
||
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
|
||
msgstr "La tecla %s%sya ha sido asignada a %s.%s%s¿Eliminar la asignación anterior y asignar la tecla a la nueva función%s%s?"
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
||
msgstr "El envoltorio de la aplicación %s%snecesario para la ejecución no existe o no es ejecutable.%s¿Ha creado uno?%s%sVea Proyecto -> Opciones del proyecto -> Configuraciones de la aplicación."
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
||
msgstr "La aplicación lanzada %s%s%s%sno existe o no es ejecutable.%s%sMire Ejecutar -> Parámetros de ejecución -> Local"
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
||
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
||
msgstr "El directorio Lazarus contiene las fuentes del IDE y los archivos del paquete de LCL y muchos paquetes estándar. Por ejemplo, contiene el archivo \"ide%slazarus.lpi\". Los archivos de conversión se encuentran allí también."
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
||
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
||
msgstr "El directorio de Lazarus \"%s\" no se ve bien:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
#, fuzzy
|
||
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
||
msgstr "El archivo LFM (formulario Lazarus) contiene propiedades no válidas. Esto significa por ejemplo que contiene algunas propiedades/clases, que no existen en el LCL actual. La solución normal es eliminar estas propiedades desde el lfm y arreglar el código pascal manualmente."
|
||
|
||
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
||
msgid "The macro \"%s\" does not begin with \"%s\"."
|
||
msgstr "La macro \"%s\" no comienza con \"%s\"."
|
||
|
||
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
||
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
||
msgstr "El ejecutable \"make\" normalmente tiene el nombre \"%s\". Es necesario para la construcción del IDE. Por favor dar la ruta completa del archivo."
|
||
|
||
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
||
#, fuzzy
|
||
#| msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
||
msgid "The new include file is not yet in the include search path.%sAdd directory %s to build modes?"
|
||
msgstr "El archivo de inclusión nuevo no está todavia en la ruta de busqueda de archivos de inclusión.%s¿Añadir directorio %s?"
|
||
|
||
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
#, fuzzy
|
||
#| msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s to build modes?"
|
||
msgstr "La nueva unidad no está todavía en la ruta de búsqueda de unidad.%s¿Añadir directorio %s?"
|
||
|
||
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
||
msgid "The old configuration will be upgraded."
|
||
msgstr "La configuración anterior se actualizará."
|
||
|
||
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
||
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
||
msgstr "\"Otras fuentes\" contiene un directorio que ya está en \"Otros archivos de unidad\".%s%s"
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
||
msgid "The output directory %s%s%s is missing."
|
||
msgstr "No se encuentra el directorio de salida %s%s%s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
||
msgid "The output directory of %s is listed in the include search path of %s."
|
||
msgstr "El directorio de salida de %s esta listado en la ruta de archivos incluidos de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
||
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
||
msgstr "El directori de salida de %s esta listado en la ruta de archivos incluidos heredada de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
||
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
||
msgstr "El directorio de salida de %s esta listado en la ruta de busqueda de Unidades heredada de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
||
msgid "The output directory of %s is listed in the unit search path of %s."
|
||
msgstr "El directorio de salida de %s esta listado en la ruta de busqueda de Unidades de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
||
msgid " The output directory should be a separate directory and not contain any source files."
|
||
msgstr "El directorio de salida debería ser un directorio aparte y que no contenga archivos de código fuente."
|
||
|
||
#: lazarusidestrconsts.listheownerclasshasthisname
|
||
msgid "The owner class has this name"
|
||
msgstr "El propietario de la clase tiene este nombre"
|
||
|
||
#: lazarusidestrconsts.listheownerhasthisname
|
||
msgid "The owner has this name"
|
||
msgstr "El propietario tiene este nombre"
|
||
|
||
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
||
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
||
msgstr "El paquete %s añade la ruta \"%s\" a las rutas de inclusión del IDE.%sEs probablemente una mala configuración del paquete."
|
||
|
||
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
||
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
||
msgstr "El paquete %s añade la ruta \"%s\" a las rutas de unidades del IDE.%sEs probablemente una mala configuración del paquete."
|
||
|
||
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr "El paquete ya contiene una Unidad con este nombre."
|
||
|
||
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
||
#, fuzzy
|
||
#| msgid "The package %s can not be installed, because it requires the package \"%s\", which is a runtime only package."
|
||
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
||
msgstr "El paquete %s no se puede instalar, ya que requiere el paquete \"%s\", que es un paquete sólo en tiempo de ejecución."
|
||
|
||
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
||
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
|
||
msgstr "El paquete %s no puede ser desinstalado, por que es necesario para el mismo IDE."
|
||
|
||
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
||
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
||
msgstr "El paquete %s no tiene ningún procedimiento \"Register\", lo que normalmente significa que no proporciona ningún complemento para el IDE. Instalarlo probablemente solo incrementará el tamaño del IDE e incluso podría hacerlo inestable.%s%sSugerencia: Si quiere usar un paquete en su projecto, use el elemento del menú \"Añadir a proyecto\"."
|
||
|
||
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
||
msgid "The package %s is already in the list"
|
||
msgstr "El paquete %s esta actualmente en la lista"
|
||
|
||
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
||
#, fuzzy
|
||
#| msgid "The package %s is not a design time package. It cannot be installed in the IDE"
|
||
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
||
msgstr "El paquete %s no es un paquete en tiempo de diseño. Este no podra ser instalado en el IDE"
|
||
|
||
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
||
msgid "The path of \"make\" is not correct: \"%s\""
|
||
msgstr "La ruta de \"make\" no es correcta: \"%s\""
|
||
|
||
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
#, fuzzy
|
||
#| msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
||
msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
|
||
msgstr "El programa %smake%s no se encuentra.%sEsta herramienta es necesaria para construir Lazarus.%s"
|
||
|
||
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
||
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
||
msgstr "Las opciones de compilador del proyecto y las directivas en la fuente principal difieren. Para la nueva unidad el modo y el tipo de cadena del proyecto son usados:"
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
||
#, fuzzy
|
||
#| msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
|
||
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
||
msgstr "El proyecto no usa las interfaces de unidad del LCL, pero es requerido por LCLBase.%sRecibirá errores extraños del enlazador si usa formularios del LCL sin interfaces."
|
||
|
||
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
||
msgid "The project has no main source file."
|
||
msgstr "El proyecto no tiene un archivo fuente principal."
|
||
|
||
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
||
msgstr "¡El archivo de info del archivo %s%s%s%s es igual al archivo fuente principal del proyecto!"
|
||
|
||
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
||
msgid "The project information file %s%s%s%shas changed on disk."
|
||
msgstr "El archivo de información del proyecto %s%s%s%sha cambiado en el disco duro."
|
||
|
||
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
#, fuzzy
|
||
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr "El proyecto debe guardarse antes de construirlo%sSi establece el Directorio de Prueba en las opciones del IDE,%spodría crear proyectos nuevos y construirlos a la vez.%s¿Guardar proyecto?"
|
||
|
||
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
||
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
||
msgstr "El proyecto usa OS objetivo=%s y CPU=%s.%sEl system.ppu para este objetivo no se encontró en los directorios de los binarios de FPC. %sAsegúrese de que FPC esta instalado correctamente para este objetivo y que el archivo fpc.cfg contiene los directorios correctos."
|
||
|
||
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
|
||
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
|
||
msgstr "El proyecto usa los nuevos recursos de FPC, que requiere al menos FPC 2.4"
|
||
|
||
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr "Hay otros archivos en el directorio con el mismo nombre,%s difieren sólo en may/min:%s%s%s¿Borrarlos?"
|
||
|
||
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
||
msgstr "Hay un archivo con el mismo nombre y extensión similar en disco%sArchivo: %s%sArchivo Ambiguo: %s%s%s¿Borrar archivo ambiguo?"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
||
msgid "There is already a build mode with this name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
||
msgid "There is already a component class with the name %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
||
msgid "There is already a component with this name"
|
||
msgstr "Ya existe un componente con este nombre"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name %s%s%s"
|
||
msgstr "Ya hay un formulario con el nombre %s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
||
msgid "There is already a macro with the name %s%s%s."
|
||
msgstr "Ya existe una macro con el nombre %s%s%s."
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
||
msgid "There is already an IDE macro with the name \"%s\""
|
||
msgstr "Ya existe una macro del IDE con el nombre \"%s\""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
||
msgid "There is already a package %s in the list"
|
||
msgstr "Ya existe un paquete %s en la lista"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "Ya hay una unidad con el nombre %s%s%s. Los identificadores Pascal deben ser únicos."
|
||
|
||
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
||
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
||
msgstr "Hay una unidad con el nombre %s%s%s en el proyecto.%sPor favor escoja un nombre diferente"
|
||
|
||
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
||
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
||
msgstr "No hay fpc.exe en el directorio de %s. Por lo general, el ejecutable make se instala junto con el compilador FPC."
|
||
|
||
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
||
msgid "There must be at least one build mode."
|
||
msgstr "Debe existir al menos un modo de construcción."
|
||
|
||
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
||
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
||
msgstr "La clase de recurso %s%s%s desciende de %s%s%s. Problablemente esto es un error para TForm."
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr "Se produjo un error mientras se escribía el componente seleccionado %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr "Se produjo un error mientras se convertía el flujo binario del componente seleccionado: %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr "Se produjo un error mientras se copiaba el flujo del compontente al portapapeles:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
||
#, fuzzy
|
||
#| msgid "The root component can not be deleted."
|
||
msgid "The root component cannot be deleted."
|
||
msgstr "No se puede eliminar el componente raiz."
|
||
|
||
#: lazarusidestrconsts.listhesefileswillbedeleted
|
||
msgid "These files will be deleted"
|
||
msgstr "Estos archivos serán eliminados"
|
||
|
||
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
||
msgid "These settings are stored with the project."
|
||
msgstr "Estas configuraciones son guardadas con el proyecto."
|
||
|
||
#: lazarusidestrconsts.listheseunitswerenotfound
|
||
msgid "These units were not found:"
|
||
msgstr "Estas unidades no se han encontrado:"
|
||
|
||
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
||
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
||
msgstr "Las fuentes de los paquetes de Free Pascal son necesarios para la navegación y el autocompletado de código. Por ejemplo, se tiene el archivo \"%s\"."
|
||
|
||
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
||
msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)"
|
||
msgstr "El Directorio de prueba no se pudo encontrar:%s%s%s%s%s(ver opciones de IDE)"
|
||
|
||
#: lazarusidestrconsts.listheunitalreadyexists
|
||
msgid "The unit %s%s%s already exists."
|
||
msgstr "La unidad(unit) %s%s%s ya existe."
|
||
|
||
#: lazarusidestrconsts.listheunitbelongstopackage
|
||
msgid "The unit belongs to package %s."
|
||
msgstr "La unidad pertenece al paquete %s."
|
||
|
||
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr "La unidad %s existe dos veces en la ruta de unidad de %s:"
|
||
|
||
#: lazarusidestrconsts.listheunithasthisname
|
||
msgid "The unit has this name"
|
||
msgstr "La unidad tiene este nombre"
|
||
|
||
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
||
#, fuzzy
|
||
#| msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
|
||
msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
|
||
msgstr "En nombre de archivo de la Unidad %s%s%s no esta en minúsculas.%sEl compilador FreePascal no busca todas las coincidencias de mayúsculas/Minúsculas. Se recomienda usar minúsculas en el nombre de archivo.%s%s¿Renombrar archivo en minúsculas?"
|
||
|
||
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
||
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
||
msgstr "La unidad %s es parte de las fuentes de FPC, pero el archivo xml correspondiente de fpdoc no fue encontrado.%sYa sea por que usted todavía no ha añadido el directorio fpcdocs a la ruta de búsqueda o la unidad no está documentada todavía.%sLos archivos fpdoc para las fuentes de FPC se puede descargar de: %s%sPor favor agregar el directorio en las opciones del editor fpdoc.%sCon el fin de crear un nuevo archivo en el directorio debe tener permisos de escritura."
|
||
|
||
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
||
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
||
msgstr "La Unidad %s es usada por otros archivos.%s¿Desea actualizar las referencias automáticamente?"
|
||
|
||
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "La unidad también tiene el nombre %s%s%s. Los identificadores Pascal deben ser únicos."
|
||
|
||
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
||
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
||
msgstr "La ruta de Busqueda de Unidades de %s%s%s contiene el directorio de fuentes %s%s%s del paquete %s"
|
||
|
||
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
||
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
||
msgstr "El directorio de trabajo %s%s%s no existe.%sPor favor, verifique el directorio de trabajo en el Menu > Ejecutar > Parámetros de Ejecución."
|
||
|
||
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
||
msgid "This component already contains a class with the name %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
||
msgid "This function needs an open .lfm file in the source editor."
|
||
msgstr "Esta función necesita un archivo .lfm abierto en el editor de código fuente."
|
||
|
||
#: lazarusidestrconsts.listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr "este mensaje de ayuda"
|
||
|
||
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
#, fuzzy
|
||
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr "Esto parece un archivo Pascal.%sEs recomendable usar minúsculas para los nombres de archivos para evitar problemas varios en algunos sistemas de archivos y diferentes compiladores.%s¿Renombrar el nombre en minúsculas?"
|
||
|
||
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
||
msgid "This project has no main source file"
|
||
msgstr "El proyecto no tiene un archivo fuente principal."
|
||
|
||
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
||
msgid "This project has only the default build mode."
|
||
msgstr "Este proyecto sólo tiene por defecto un modo de construcción."
|
||
|
||
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
||
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
||
msgstr "Este conjunto de opciones para construir Lazarus no es compatible con esta instalación.%sEl directorio %s%s%s no tiene permisos de escritura.%sVisite el sitio web de Lazarus para conocer otras maneras de instalar Lazarus."
|
||
|
||
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr "Esta sentencia no puede ser extraida.%sPor favor, seleccione algo de código para extraer un nuevo procedimiento/método."
|
||
|
||
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
||
msgid "This will create a circular dependency."
|
||
msgstr "Esto creará una dependencia circular."
|
||
|
||
#: lazarusidestrconsts.listhreads
|
||
msgctxt "lazarusidestrconsts.listhreads"
|
||
msgid "Threads"
|
||
msgstr "Hilos(Threads)"
|
||
|
||
#: lazarusidestrconsts.listhreadscurrent
|
||
msgctxt "lazarusidestrconsts.listhreadscurrent"
|
||
msgid "Current"
|
||
msgstr "Actual"
|
||
|
||
#: lazarusidestrconsts.listhreadsfunc
|
||
msgctxt "lazarusidestrconsts.listhreadsfunc"
|
||
msgid "Function"
|
||
msgstr "Función"
|
||
|
||
#: lazarusidestrconsts.listhreadsgoto
|
||
msgid "Goto"
|
||
msgstr "Ir a"
|
||
|
||
#: lazarusidestrconsts.listhreadsline
|
||
msgctxt "lazarusidestrconsts.listhreadsline"
|
||
msgid "Line"
|
||
msgstr "Línea"
|
||
|
||
#: lazarusidestrconsts.listhreadsnotevaluated
|
||
msgid "Threads not evaluated"
|
||
msgstr "Hilos(Threads) no evaluados"
|
||
|
||
#: lazarusidestrconsts.listhreadssrc
|
||
msgctxt "lazarusidestrconsts.listhreadssrc"
|
||
msgid "Source"
|
||
msgstr "Fuente"
|
||
|
||
#: lazarusidestrconsts.listhreadsstate
|
||
msgctxt "lazarusidestrconsts.listhreadsstate"
|
||
msgid "State"
|
||
msgstr "Estado"
|
||
|
||
#: lazarusidestrconsts.listinfobuildautocloseonsuccess
|
||
msgid "&Automatically close on success"
|
||
msgstr "Cerrar &automaticamente en caso de éxito."
|
||
|
||
#: lazarusidestrconsts.listinfobuildcompiling
|
||
msgid "Compiling:"
|
||
msgstr "Compilando:"
|
||
|
||
#: lazarusidestrconsts.listitle
|
||
msgid "&Title"
|
||
msgstr "&Título"
|
||
|
||
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
||
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
||
msgstr "El título en la barra de tareas muestra por ejemplo: project1.lpi - Lazarus"
|
||
|
||
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
||
msgid "Title (leave empty for default)"
|
||
msgstr "Título (dejar vacio en forma predeterminada)"
|
||
|
||
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr "Función: añadir delimitador de ruta"
|
||
|
||
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
||
#, fuzzy
|
||
#| msgid "Function: chomp path delimiter"
|
||
msgid "Function: remove trailing path delimiter"
|
||
msgstr "Funciones: "
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr "Función: extraer extensión de archivo"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr "Función: extraer nombre y extensión del archivo"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr "Función: extraer sólo nombre de archivo"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr "Función: extraer ruta del archivo"
|
||
|
||
#: lazarusidestrconsts.listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(macro desconocida: %s)"
|
||
|
||
#: lazarusidestrconsts.listofpcpath
|
||
msgid "Path:"
|
||
msgstr "Ruta:"
|
||
|
||
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
||
msgid "Toggle showing filenames with full path or with relative path"
|
||
msgstr "Intercambiar mostrar ruta completa o relativa para nombres de archivo"
|
||
|
||
#: lazarusidestrconsts.listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr "Anclaje superior"
|
||
|
||
#: lazarusidestrconsts.listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr "Frontera superior. Este valor se añadirá a la frontera superior y se usará para el espacio sobre el control."
|
||
|
||
#: lazarusidestrconsts.listopinfoview
|
||
msgid "Show Class/Proc Hint"
|
||
msgstr "Mostrar Sugerencia Clase/Procedimiento"
|
||
|
||
#: lazarusidestrconsts.listops
|
||
msgid "Tops"
|
||
msgstr "Topes"
|
||
|
||
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
||
msgstr "Este es el control hermano al cual el lado superior está anclado. Déjelo vacío para que sea el padre."
|
||
|
||
#: lazarusidestrconsts.listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr "Igualar espacio superior"
|
||
|
||
#: lazarusidestrconsts.listreeneedsrefresh
|
||
msgid "Tree needs refresh"
|
||
msgstr "El árbol necesita actualizarse"
|
||
|
||
#: lazarusidestrconsts.listurbopascal
|
||
msgid "Turbo Pascal"
|
||
msgstr "Turbo Pascal"
|
||
|
||
#: lazarusidestrconsts.listypes
|
||
msgid "Types (not removed if no replacement)"
|
||
msgstr "Tipos (no se eliminan si no hay reemplazo)"
|
||
|
||
#: lazarusidestrconsts.lisudadditionaldirectories
|
||
msgid "Additional directories:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudallpackageunits
|
||
msgid "All package units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudallsourceeditorunits
|
||
msgid "All source editor units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudallunits
|
||
msgid "All units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
||
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudcollapseallnodes
|
||
msgid "Collapse all nodes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudexpandallnodes
|
||
msgid "Expand all nodes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudfile
|
||
msgid "File: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudfilter
|
||
msgid "(Filter)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudimplementationuses
|
||
msgid "Implementation Uses: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudimplementationuses2
|
||
msgid "implementation uses: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudinterfaceuses
|
||
msgid "Interface Uses: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudinterfaceuses2
|
||
msgid "interface uses: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudprojectsandpackages
|
||
msgid "Projects and packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudscanning
|
||
msgid "Scanning ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudscanningunits
|
||
msgid "Scanning: %s units ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearch
|
||
msgid "(Search)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
||
msgid "Find next occurrence of this phrase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
||
msgid "Find next unit with this phrase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
||
msgid "Find previous occurrence of this phrase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
||
msgid "Find previous unit with this phrase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudselectedunits
|
||
msgid "Selected units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudshownodesfordirectories
|
||
msgid "Show nodes for directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
||
msgid "Show nodes for project and packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudunits
|
||
msgid "Units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudunits2
|
||
msgid "Units: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudusedbyimplementations
|
||
msgid "Used by Implementations: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudusedbyimplementations2
|
||
msgid "used by implementations: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudusedbyinterfaces
|
||
msgid "Used by Interfaces: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
||
msgid "used by interfaces: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr "No volver a mostrar este mensaje."
|
||
|
||
#: lazarusidestrconsts.lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr "Error en expresión regular"
|
||
|
||
#: lazarusidestrconsts.lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr "Fuente sin UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisuegotoline
|
||
#| msgid "Goto line :"
|
||
msgid "Goto line:"
|
||
msgstr "Ir a línea:"
|
||
|
||
#: lazarusidestrconsts.lisuemodeseparator
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: lazarusidestrconsts.lisuenotfound
|
||
msgid "Not found"
|
||
msgstr "No encontrado"
|
||
|
||
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
||
msgstr "¿Reemplazar esta coincidencia de %s%s%s%s con %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr "Buscando: %s"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
||
msgid "Continue search from the beginning?"
|
||
msgstr "Continuar busqueda desde el principio?"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
||
msgid "Continue search from the end?"
|
||
msgstr "Continuar busqueda desde el final?"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr "¡Cadena de búsqueda '%s' no encontrada!"
|
||
|
||
#: lazarusidestrconsts.lisuethecurre
|
||
#, fuzzy
|
||
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
||
msgstr "La fuente actual del editor no soporta UTF-8, pero su sistema parece que lo usa.%sEsto significa que los caracteres no ASCII probablemente se muestren de manera incorrecta.%sPuede seleccionar otra fuente en las opciones del editor."
|
||
|
||
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr "Limpiar cache de includes"
|
||
|
||
#: lazarusidestrconsts.lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "%s bytes"
|
||
|
||
#: lazarusidestrconsts.lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr "Incluido por:"
|
||
|
||
#: lazarusidestrconsts.lisuidinproject
|
||
msgid "in Project:"
|
||
msgstr "en Proyecto:"
|
||
|
||
#: lazarusidestrconsts.lisuidlines
|
||
msgctxt "lazarusidestrconsts.lisuidlines"
|
||
msgid "Lines:"
|
||
msgstr "Líneas:"
|
||
|
||
#: lazarusidestrconsts.lisuidname
|
||
msgctxt "lazarusidestrconsts.lisuidname"
|
||
msgid "Name:"
|
||
msgstr "Nombre:"
|
||
|
||
#: lazarusidestrconsts.lisuidno
|
||
msgid "no"
|
||
msgstr "no"
|
||
|
||
#: lazarusidestrconsts.lisuidsize
|
||
msgid "Size:"
|
||
msgstr "Tamaño:"
|
||
|
||
#: lazarusidestrconsts.lisuidtype
|
||
msgid "Type:"
|
||
msgstr "Tipo:"
|
||
|
||
#: lazarusidestrconsts.lisuidunit
|
||
msgctxt "lazarusidestrconsts.lisuidunit"
|
||
msgid "Unit"
|
||
msgstr "Unidad"
|
||
|
||
#: lazarusidestrconsts.lisuidyes
|
||
msgid "yes"
|
||
msgstr "si"
|
||
|
||
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr "Mostrar Valores de CodeTools"
|
||
|
||
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr "No se puede convertir la corriente binaria a texto"
|
||
|
||
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr "No se puede copiar los componentes al portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "No se ha podido añadir un comentario de cabecera de recurso al archivo recurso %s%s%s%s%sProbablemente sea un error de sintaxis."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "No se ha podido añadir el recurso T%s:FORMDATA al archivo recurso %s%s%s%s%sProbablemente sea un error de sintaxis."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
||
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
|
||
msgstr "No se puede añadir la dependencia %s, porque el paquete %s ya tiene una dependencia %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread2
|
||
msgid "Unable to add the dependency %s, because the package %s has already a dependency to %s"
|
||
msgstr "No se puede añadir la dependencia %s, porque el paquete %s ya tiene una dependencia a %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
||
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
|
||
msgstr "No se puede añadir la dependencia %s, ya que esto crearía una dependencia circular. Dependencia %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr "No se ha podido añadir %s al proyecto, porque en el Proyecto ya hay una unidad con el mismo nombre."
|
||
|
||
#: lazarusidestrconsts.lisunabletobackupfileto
|
||
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
||
msgstr "¡No se ha podido hacer copia de seguridad del archivo %s%s%s a %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr "%s%sNo se ha podido cambiar clase de %s a %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
||
msgid "Unable to change project title in source.%s%s"
|
||
msgstr "No se puede cambiar el título del proyecto en la fuente.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr "No se ha podido limpiar el directorio destino"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
||
msgstr "No se ha podido limpiar %s%s%s.%s Por favor verifique los permisos."
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr "No se puede convertir el texto del componente al formato binario:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
||
msgid "Unable to convert file %s%s%s%sError: %s"
|
||
msgstr "No se ha podido convertir el archivo %s%s%s%s Error: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
||
msgstr "No se ha podido convertir los datos en forma de texto del archivo %s%s%s%s%s en un flujo binario (%s)"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr "No se puede copiar el archivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
||
msgstr "No se ha podido copiar el archivo %s%s%s%s a %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto2
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
||
msgstr "No se puede copiar el archivo %s%s%s%sa %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory %s%s%s."
|
||
msgstr "No se ha podido crear el directorio de copia de seguridad %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory
|
||
msgid "Unable to create directory %s%s%s."
|
||
msgstr "No se ha podido crear el directorio %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory2
|
||
msgid "Unable to create directory %s%s%s"
|
||
msgstr "No se ha podido crear el directorio %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr "No se ha podido crear el archivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile2
|
||
msgid "Unable to create file %s%s%s"
|
||
msgstr "No se ha podido crear el archivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile3
|
||
msgid "Unable to create file%s%s%s%s"
|
||
msgstr "No se puede crear el archivo%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile4
|
||
msgid "Unable to create file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefilename
|
||
msgid "Unable to create file %s%s%s."
|
||
msgstr "No se ha podido crear el archivo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
||
msgid "Unable to create link %s%s%s with target %s%s%s"
|
||
msgstr "No se puede crear el enlace %s%s%s con destino %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
||
msgid "Unable to create new file, because there is already a directory with this name."
|
||
msgstr "No se puede crear archivo nuevo, porque ya existe un directorio con este nombre."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
||
msgid "Unable to create new method."
|
||
msgstr "No se puede crear nuevo método."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr "No se ha podido crear el buffer temporal lfm."
|
||
|
||
#: lazarusidestrconsts.lisunabletodelete
|
||
msgid "Unable to delete"
|
||
msgstr "No se puede borrar"
|
||
|
||
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file %s%s%s"
|
||
msgstr "No se ha podido borrar el archivo ambiguo %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr "No se encontró una sección ResourceString en ésta o en cualquier de las Unidades usadas."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in %s%s%s"
|
||
msgstr "No se podido encontrar una clase válida en %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfile
|
||
msgid "Unable to find file %s%s%s."
|
||
msgstr "No se ha podido encontrar el archivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
#, fuzzy
|
||
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
||
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
||
msgstr "No se halló el archivo %s%s%s.%sSi pertenece a su proyecto, verifique la ruta busqueda en%sProyecto->Opciones del Compilador ->Rutas->Otros Archivos de Unidad. Si este archivo pertenece a un paquete, verifique las opciones del compilador del propio paquete. Si este archivo pertenece a Lazarus, asegúrese de efectuar una compilación limpia. Si el archivo pertenece a FPC entonces verifique el archivo fpc.cfg. Si no esta seguro, pruebe con, Proyecto -> Opciones del Compilador ... -> Probar"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr "No se ha podido encontrar %s en la corriente LFM."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindmethod
|
||
msgid "Unable to find method."
|
||
msgstr "No se puede encontrar método."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
||
#, fuzzy
|
||
#| msgid "Unable to find Pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
|
||
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s%s%s%s"
|
||
msgstr "No fue posible encontrar la Unidad pascal (.pas,.pp) para el archivo .lfm %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
||
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
||
msgstr "No se puede encontrar la clase del componente \"%s\".%sEsta no está registrada a través de RegisterClass y no se encontró lfm.%sEsta es necesaria por la unidad(unit):%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr "No se han podido recoger los cambios en el editor."
|
||
|
||
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr "No se haa podido coger el fuente para el diseñador."
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadfile
|
||
msgid "Unable to load file:%s%s"
|
||
msgstr "No se puede cargar archivo:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadfile2
|
||
msgid "unable to load file %s: %s"
|
||
msgstr "no se puede cargar el archivo %s: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadpackage
|
||
msgid "Unable to load package %s%s%s"
|
||
msgstr "No fué posible cargar el paquete %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
||
msgstr "No se ha podido cargar la clase del componente %s%s%s porque depende de sí misma."
|
||
|
||
#: lazarusidestrconsts.lisunabletoopen
|
||
msgid "Unable to open \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
||
msgid "Unable to open ancestor component"
|
||
msgstr "No fué posible abrir el componente ancestro"
|
||
|
||
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr "No se podido abrir el diseñador.%sLa clase %s no desciende de una clase diseñable como TForm o TDataModule."
|
||
|
||
#: lazarusidestrconsts.lisunabletoread
|
||
msgid "Unable to read %s"
|
||
msgstr "No se puede leer %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr "No se ha podido leer el archivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile2
|
||
msgid "Unable to read file %s%s%s!"
|
||
msgstr "¡No se ha podido leer el archivo %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfileerror
|
||
msgid "Unable to read file %s%s%s%sError: %s"
|
||
msgstr "No se ha podido leer el archivo %s%s%s%s Error: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfilename
|
||
msgid "Unable to read file %s%s%s."
|
||
msgstr "No se ha podido leer el archivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadlpi
|
||
msgid "Unable to read lpi"
|
||
msgstr "No se puede leer lpi"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
||
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
||
msgid "Unable to read the project info file%s%s%s%s."
|
||
msgstr "No se puede leer el archivo de información del proyecto%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
|
||
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
|
||
msgid "Unable to read the project info file%s%s%s%s."
|
||
msgstr "No se puede leer el archivo de información del proyecto%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file %s%s%s!"
|
||
msgstr "¡No se ha podido eliminar el archivo de copia de seguridad antiguo %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
||
msgid "Unable to remove project title from source.%s%s"
|
||
msgstr "No se puede eliminar el título del proyecto de la fuente.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
||
msgstr "No se ha podido renombrar el archivo ambiguo %s%s%s%sa %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr "No se puede renombrar el archivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto
|
||
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
||
msgstr "¡No se ha podido renombrar el archivo %s%s%s a %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto2
|
||
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
||
msgstr "No se puede renombrar el archivo %s%s%s%sa %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr "No se ha podido renombrar el formulario en la fuente."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr "No se ha podido renombrar método. Por favor corrija el error mostrado en la ventana de mensaje."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr "No se ha podido renombrar la variable en la fuente."
|
||
|
||
#: lazarusidestrconsts.lisunabletorun
|
||
msgid "Unable to run"
|
||
msgstr "No es posible ejecutar"
|
||
|
||
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr "No se puede establecer el control AnchorSide"
|
||
|
||
#: lazarusidestrconsts.lisunabletoshowmethod
|
||
msgid "Unable to show method."
|
||
msgstr "No se puede mostrar método."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr "No se han podido establecer flujos de los componentes seleccionados"
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr "No se han podido establecer flujos de los componentes seleccionados."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr "No se ha podido establecer flujo%s:T%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr "No se ha podido transformar un flujo de componente binario de %s:T%s en texto."
|
||
|
||
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr "No se ha podido actualizar la declaración CreateForm en la fuente del proyecto"
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite
|
||
msgid "Unable to write %s%s%s%s%s."
|
||
msgstr "No se ha podido escribir %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite2
|
||
msgid "Unable to write %s%s%s"
|
||
msgstr "No es posible escribir %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr "No se ha podido escribir el archivo"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefileerror
|
||
msgid "Unable to write file %s%s%s%sError: %s"
|
||
msgstr "No se ha podido escribir el archivo %s%s%s%s Error: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
||
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
|
||
msgstr "No se puede escribir el archivo de información del proyecto%s%s%s%s.%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
||
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
||
msgstr "No se puede escribir el archivo de sesión del proyecto%s\"%s\".%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile
|
||
#| msgid "Unable to write to file %s%s%s!"
|
||
msgid "Unable to write to file %s%s%s."
|
||
msgstr "No se ha podido escribir al archivo %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile2
|
||
msgid "Unable to write to file \"%s\"."
|
||
msgstr "No se puede escribir en el archivo \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr "No es posible escribir el stream xml en %s%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisuncheckall
|
||
msgid "Uncheck All"
|
||
msgstr "Deschequear Todo"
|
||
|
||
#: lazarusidestrconsts.lisundo
|
||
msgctxt "lazarusidestrconsts.lisundo"
|
||
msgid "Undo"
|
||
msgstr "Deshacer"
|
||
|
||
#: lazarusidestrconsts.lisuninstall
|
||
msgid "Uninstall %s"
|
||
msgstr "Desinstalar %s"
|
||
|
||
#: lazarusidestrconsts.lisuninstallimpossible
|
||
msgid "Uninstall impossible"
|
||
msgstr "Desinstalación imposible"
|
||
|
||
#: lazarusidestrconsts.lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr "Desinstalar selección"
|
||
|
||
#: lazarusidestrconsts.lisunithaschangedsave
|
||
msgid "Unit %s%s%s has changed. Save?"
|
||
msgstr "La Unidad %s%s%s ha cambiado. ¿Guardar?"
|
||
|
||
#: lazarusidestrconsts.lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr "Existe identificador de unidad"
|
||
|
||
#: lazarusidestrconsts.lisunitinpackage
|
||
msgid "%s unit %s in package %s%s"
|
||
msgstr "%s La unidad %s está en el paquete %s%s"
|
||
|
||
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr "El Nombre de unidad ya está en el proyecto"
|
||
|
||
#: lazarusidestrconsts.lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr "El nombre de la unidad empieza con ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr "El nombre de la unidad contiene ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnotfoundinproject
|
||
msgid "A unit not found in project %s"
|
||
msgstr "Una unidad(unit) no se encuentra en proyecto %s"
|
||
|
||
#: lazarusidestrconsts.lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr "Directorio de salida de la unidad"
|
||
|
||
#: lazarusidestrconsts.lisunitpath
|
||
msgid "unit path"
|
||
msgstr "ruta de unidad"
|
||
|
||
#: lazarusidestrconsts.lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr "Rutas de unidad"
|
||
|
||
#: lazarusidestrconsts.lisunitsnotfoundinproject
|
||
msgid "Units not found in project %s"
|
||
msgstr "Las unidades(Units) no se encuentran en proyecto %s"
|
||
|
||
#: lazarusidestrconsts.lisunsigned
|
||
msgid "Unsigned"
|
||
msgstr "Sin firmar"
|
||
|
||
#: lazarusidestrconsts.lisunusedunitsof
|
||
msgid "Unused units of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
||
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
||
msgstr "Inusual nombre de archivo del compilador. Por lo general, comienza con la fpc, ppc o ppcross."
|
||
|
||
#: lazarusidestrconsts.lisup
|
||
msgctxt "lazarusidestrconsts.lisup"
|
||
msgid "Up"
|
||
msgstr "Arriba"
|
||
|
||
#: lazarusidestrconsts.lisupdateinfo
|
||
msgid "Update info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
||
msgid "Update other procedure signatures when only letter case has changed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdatereferences
|
||
msgid "Update references?"
|
||
msgstr "¿Actualizar referencias?"
|
||
|
||
#: lazarusidestrconsts.lisupgrade
|
||
msgid "Upgrade"
|
||
msgstr "Actualiza"
|
||
|
||
#: lazarusidestrconsts.lisupgradeconfiguration
|
||
msgid "Upgrade configuration"
|
||
msgstr "Actualiza la configuración"
|
||
|
||
#: lazarusidestrconsts.lisuppercasestring
|
||
msgid "uppercase string"
|
||
msgstr "Cadena en mayúsculas"
|
||
|
||
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
||
msgid "Uppercase string given as parameter"
|
||
msgstr "Cadena dada como parámetro en mayúsculas"
|
||
|
||
#: lazarusidestrconsts.lisusagemessagehoption
|
||
msgid "Usage message (-h option)"
|
||
msgstr "Mensaje de uso (opción -h)"
|
||
|
||
#: lazarusidestrconsts.lisuseandclose
|
||
msgid "Use and close"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseansistrings
|
||
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
||
msgid "Use Ansistrings"
|
||
msgstr "Usar Ansistrings"
|
||
|
||
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
||
msgid "Use comments in custom options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusedesigntimepackages
|
||
msgid "Use design time packages"
|
||
msgstr "Usar paquetes en tiempo de diseño"
|
||
|
||
#: lazarusidestrconsts.lisuseexcludefilter
|
||
#, fuzzy
|
||
#| msgid "Use Exclude Filter"
|
||
msgid "Use exclude filter"
|
||
msgstr "Usar fitro de exclusión"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifier
|
||
msgid "Use identifier"
|
||
msgstr "Usar identificador"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifierinat
|
||
msgid "Use identifier %s in %s at %s"
|
||
msgstr "Usar identificador %s en %s para %s"
|
||
|
||
#: lazarusidestrconsts.lisuseincludefilter
|
||
#, fuzzy
|
||
#| msgid "Use Include Filter"
|
||
msgid "Use include filter"
|
||
msgstr "Usar filtro de inclusión"
|
||
|
||
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr "Lanzador de aplicaciones"
|
||
|
||
#: lazarusidestrconsts.lisusemessagefile
|
||
msgid "Use message file:"
|
||
msgstr "Usar archivo de mensaje:"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage
|
||
msgid "Use package %s in package %s"
|
||
msgstr "Usar paquete %s en paquete %s"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage2
|
||
msgid "Use package in package"
|
||
msgstr "Usar paquete en paquete"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject
|
||
msgid "Use package %s in project"
|
||
msgstr "Usar paquete %s en proyecto"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject2
|
||
msgid "Use package in project"
|
||
msgstr "Usar paquete en proyecto"
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
||
msgid "Add to list \"%s\""
|
||
msgstr "Añadir a la lista \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
||
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
||
msgid "User defined text markup"
|
||
msgstr "Marcado de texto definidos por el usuario"
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
||
msgid "Remove from list \"%s\""
|
||
msgstr "Quitar de la lista \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
||
msgid "Toggle on list \"%s\""
|
||
msgstr "Cambiar en la lista \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisusershomedirectory
|
||
msgid "User's home directory"
|
||
msgstr "Directorio (home) del usuario"
|
||
|
||
#: lazarusidestrconsts.lisusesub
|
||
msgctxt "lazarusidestrconsts.lisusesub"
|
||
msgid "Use >>"
|
||
msgstr "Usar >>"
|
||
|
||
#: lazarusidestrconsts.lisuseunit
|
||
#, fuzzy
|
||
#| msgid "Add unit to uses section"
|
||
msgctxt "lazarusidestrconsts.lisuseunit"
|
||
msgid "Add Unit to Uses Section"
|
||
msgstr "Añadir unidad a la sección uses"
|
||
|
||
#: lazarusidestrconsts.lisuseunitinunit
|
||
msgid "Use unit %s in unit %s"
|
||
msgstr "Usar unidad %s en unidad %s"
|
||
|
||
#: lazarusidestrconsts.lisutf8withbom
|
||
msgid "UTF-8 with BOM"
|
||
msgstr "UTF-8 con BOM"
|
||
|
||
#: lazarusidestrconsts.lisvalue
|
||
#, fuzzy
|
||
#| msgid "Value:"
|
||
msgctxt "lazarusidestrconsts.lisvalue"
|
||
msgid "Value"
|
||
msgstr "Valor:"
|
||
|
||
#: lazarusidestrconsts.lisvalue2
|
||
msgid "Value%s"
|
||
msgstr "Valor%s"
|
||
|
||
#: lazarusidestrconsts.lisvalue3
|
||
msgid "Value: "
|
||
msgstr "Valor:"
|
||
|
||
#: lazarusidestrconsts.lisvalues
|
||
msgid "Values"
|
||
msgstr "Valores"
|
||
|
||
#: lazarusidestrconsts.lisvariable
|
||
msgctxt "lazarusidestrconsts.lisvariable"
|
||
msgid "Variable"
|
||
msgstr "Variable"
|
||
|
||
#: lazarusidestrconsts.lisverifymethodcalls
|
||
msgid "Verify method calls"
|
||
msgstr "Verificar llamadas de método"
|
||
|
||
#: lazarusidestrconsts.lisversion
|
||
msgid "Version"
|
||
msgstr "Versión"
|
||
|
||
#: lazarusidestrconsts.lisversionmismatch
|
||
msgid "Version mismatch"
|
||
msgstr "Desajuste versión"
|
||
|
||
#: lazarusidestrconsts.lisvertical
|
||
msgid "Vertical"
|
||
msgstr "Vertical"
|
||
|
||
#: lazarusidestrconsts.lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr "Copiar información de la versión al portapapeles"
|
||
|
||
#: lazarusidestrconsts.lisviewbreakpointproperties
|
||
#, fuzzy
|
||
#| msgid "Breakpoint Properties..."
|
||
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
|
||
msgid "Breakpoint Properties ..."
|
||
msgstr "Ver propiedades del Punto de Interrupción"
|
||
|
||
#: lazarusidestrconsts.lisviewsource
|
||
msgid "View Source"
|
||
msgstr "Ver Fuente"
|
||
|
||
#: lazarusidestrconsts.lisviewsourcedisass
|
||
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
|
||
msgid "View Assembler"
|
||
msgstr "Cambiar a vista ensamblador"
|
||
|
||
#: lazarusidestrconsts.lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr "Ver Fuente (.lfm)"
|
||
|
||
#: lazarusidestrconsts.liswarning
|
||
msgid "Warning: "
|
||
msgstr "Advertencia: "
|
||
|
||
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
||
msgstr "Advertencia: encontrado archivo ambiguo : %s%s%s. El archivo fuente es: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
||
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
||
msgstr "%sAdvertencia: Esta es la unidad principal. La nueva unidad principal será %s.pas."
|
||
|
||
#: lazarusidestrconsts.liswatch
|
||
msgid "&Watch"
|
||
msgstr "&Observar"
|
||
|
||
#: lazarusidestrconsts.liswatchdata
|
||
msgid "Watch:"
|
||
msgstr "Observar:"
|
||
|
||
#: lazarusidestrconsts.liswatchkind
|
||
msgid "Watch action"
|
||
msgstr "Observar acción"
|
||
|
||
#: lazarusidestrconsts.liswatchkindread
|
||
msgid "Read"
|
||
msgstr "Leer"
|
||
|
||
#: lazarusidestrconsts.liswatchkindreadwrite
|
||
msgid "Read/Write"
|
||
msgstr "Leer/Escribir"
|
||
|
||
#: lazarusidestrconsts.liswatchkindwrite
|
||
msgid "Write"
|
||
msgstr "Escribir"
|
||
|
||
#: lazarusidestrconsts.liswatchpoint
|
||
msgid "&Data/Watch Breakpoint ..."
|
||
msgstr "&Datos/Observacion punto de ruptura ..."
|
||
|
||
#: lazarusidestrconsts.liswatchpointbreakpoint
|
||
msgid "&Data/watch Breakpoint ..."
|
||
msgstr "&Datos/Observacion punto de ruptura ..."
|
||
|
||
#: lazarusidestrconsts.liswatchpropert
|
||
msgid "Watch Properties"
|
||
msgstr "Propiedades del punto de observación"
|
||
|
||
#: lazarusidestrconsts.liswatchscope
|
||
msgid "Watch scope"
|
||
msgstr "Ver ámbito de aplicación"
|
||
|
||
#: lazarusidestrconsts.liswatchscopeglobal
|
||
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
|
||
msgid "Global"
|
||
msgstr "Global"
|
||
|
||
#: lazarusidestrconsts.liswatchscopelocal
|
||
msgid "Declaration"
|
||
msgstr "Declaración"
|
||
|
||
#: lazarusidestrconsts.liswatchtowatchpoint
|
||
msgid "Create &Data/Watch Breakpoint ..."
|
||
msgstr "Crear &Datos/Observacion punto de ruptura ..."
|
||
|
||
#: lazarusidestrconsts.liswelcometolazaruside
|
||
msgid "Welcome to Lazarus IDE %s"
|
||
msgstr "Bienvenido a IDE Lazarus %s"
|
||
|
||
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
||
msgid "Welcome to Lazarus %s%s%sThere is already a configuration from version %s in%s%s%s"
|
||
msgstr "Bienvenido a IDE Lazarus %s%s%sYa existe una configuración de la versión %s en%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liswhatneedsbuilding
|
||
msgid "What needs building"
|
||
msgstr "Qué necesita la construcción"
|
||
|
||
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
||
#, fuzzy
|
||
#| msgid "When a unit is renamed, update references ..."
|
||
msgid "When a unit is renamed, update references"
|
||
msgstr "Cuando una Unidad es renombrada, actualizar referencias ..."
|
||
|
||
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
||
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
|
||
msgstr "Cuando esta activado las opciones actuales son guardadas en una plantilla, la cual es usada cuando se crean nuevos proyectos"
|
||
|
||
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
||
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
||
msgstr "Cuando se mueva el cursor en el editor de código fuente, mostrar el nodo actual en el explorador de código"
|
||
|
||
#: lazarusidestrconsts.liswithincludes2
|
||
msgid ", with includes "
|
||
msgstr ", con includes "
|
||
|
||
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
||
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
||
msgstr "Sin un buen compilador la navegación de código y la compilación será decepcionante."
|
||
|
||
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
||
msgid "Without a proper debugger, debugging will be disappointing."
|
||
msgstr "Sin un adecuado depurador, la depuración será decepcionante."
|
||
|
||
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
||
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
||
msgstr "Sin un adecuado directorio de Lazarus obtendrá una gran cantidad de advertencias."
|
||
|
||
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
||
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
||
msgstr "Sin un adecuado ejecutable \"make\" la compilación del IDE no es posible."
|
||
|
||
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
||
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
||
msgstr "Sin el correcto código fuente de FPC la navegacion de código y autocompletado será muy limitado."
|
||
|
||
#: lazarusidestrconsts.liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr "Con los paquetes requeridos"
|
||
|
||
#: lazarusidestrconsts.liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr "&Borrar todo"
|
||
|
||
#: lazarusidestrconsts.liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr "D&esactivar todo"
|
||
|
||
#: lazarusidestrconsts.liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr "Ac&tivar todo"
|
||
|
||
#: lazarusidestrconsts.liswlexpression
|
||
msgid "Expression"
|
||
msgstr "Expresión"
|
||
|
||
#: lazarusidestrconsts.liswlinspectpane
|
||
msgid "Inspect pane"
|
||
msgstr "Panel inspección"
|
||
|
||
#: lazarusidestrconsts.liswlproperties
|
||
msgid "&Properties"
|
||
msgstr "&Propiedades"
|
||
|
||
#: lazarusidestrconsts.liswlwatchlist
|
||
#, fuzzy
|
||
#| msgid "Watch list"
|
||
msgid "Watch List"
|
||
msgstr "Lista de puntos de observación"
|
||
|
||
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr "Palabra en el cursor en el editor actual"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr "Directorio de trabajo para construcción"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr "Directorio de trabajo para ejecución"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectorynotfound
|
||
msgid "Working directory %s not found"
|
||
msgstr "Directorio de trabajo %s no encontrado"
|
||
|
||
#: lazarusidestrconsts.liswriteerror
|
||
msgid "Write Error"
|
||
msgstr "Error de escritura"
|
||
|
||
#: lazarusidestrconsts.liswriteerrorfile
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr "Error de escritura: %s%sArchivo: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liswrongversionin
|
||
msgid "wrong version in %s: %s"
|
||
msgstr "version incorrecta en %s: %s"
|
||
|
||
#: lazarusidestrconsts.lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr "Error XML"
|
||
|
||
#: lazarusidestrconsts.lisxmlfiles
|
||
msgid "XML files"
|
||
msgstr "Archivos XML"
|
||
|
||
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr "Error de análisis en archivo XML %s%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
||
msgid "You can disable this for individual forms via the package editor"
|
||
msgstr "Puede desactivar esta para las formularios(forms) individuales a través del editor de paquetes"
|
||
|
||
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
||
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
||
msgstr "Puede desactivar esto para formularios individuales a través de la ventana emergente en el inspector de proyectos"
|
||
|
||
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
||
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
#, fuzzy
|
||
#| msgid "You can not build lazarus while debugging or compiling."
|
||
msgid "You cannot build Lazarus while debugging or compiling."
|
||
msgstr "No puede construir lazarus mientras está depurando o compilando."
|
||
|
||
#: lazarusidestrconsts.locwndsrceditor
|
||
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
||
msgid "Source Editor"
|
||
msgstr "Editor de código fuente"
|
||
|
||
#: lazarusidestrconsts.lrsplddeleteselected
|
||
msgid "Delete selected"
|
||
msgstr "Eliminar seleccionado"
|
||
|
||
#: lazarusidestrconsts.lrspldinvalid
|
||
msgid "invalid"
|
||
msgstr "No válido"
|
||
|
||
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
||
msgid "lpk file invalid (%s)"
|
||
msgstr "archivo lpk (%s) inválido"
|
||
|
||
#: lazarusidestrconsts.lrspldlpkfilevalid
|
||
msgid "lpk file valid (%s)"
|
||
msgstr "archivo lpk (%s) válido "
|
||
|
||
#: lazarusidestrconsts.lrspldunabletodeletefile
|
||
msgid "Unable to delete file \"%s\""
|
||
msgstr "No se puede eliminar el archivo \"%s\""
|
||
|
||
#: lazarusidestrconsts.lrspldvalid
|
||
msgid "valid"
|
||
msgstr "válido"
|
||
|
||
#: lazarusidestrconsts.lrsrescanlplfiles
|
||
msgid "Rescan lpl files"
|
||
msgstr "Reexaminar archivos de lpl"
|
||
|
||
#: lazarusidestrconsts.podaddpackageunittousessection
|
||
msgid "Add package unit to uses section"
|
||
msgstr "Añadir la Unidad del paquete a la sección Uses"
|
||
|
||
#: lazarusidestrconsts.regdlgbinary
|
||
msgctxt "lazarusidestrconsts.regdlgbinary"
|
||
msgid "Binary"
|
||
msgstr "Binario"
|
||
|
||
#: lazarusidestrconsts.regdlgdecimal
|
||
msgctxt "lazarusidestrconsts.regdlgdecimal"
|
||
msgid "Decimal"
|
||
msgstr "Decimal"
|
||
|
||
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
|
||
msgid "Display type for selected Registers"
|
||
msgstr "Mostrar tipos de Registros seleccionados"
|
||
|
||
#: lazarusidestrconsts.regdlgformat
|
||
msgid "Format"
|
||
msgstr "Formato"
|
||
|
||
#: lazarusidestrconsts.regdlghex
|
||
msgid "Hex"
|
||
msgstr "Hex"
|
||
|
||
#: lazarusidestrconsts.regdlgoctal
|
||
msgid "Octal"
|
||
msgstr "Octal"
|
||
|
||
#: lazarusidestrconsts.regdlgraw
|
||
msgid "Raw"
|
||
msgstr "Raw"
|
||
|
||
#: lazarusidestrconsts.rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr "Añadir Inverso"
|
||
|
||
#: lazarusidestrconsts.rsattachto
|
||
msgid "Attach to"
|
||
msgstr "Adjuntar(Attach) a"
|
||
|
||
#: lazarusidestrconsts.rsattributes
|
||
msgid "Attributes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr "Incrementar automáticamente el número de construcción"
|
||
|
||
#: lazarusidestrconsts.rsavailablescanners
|
||
msgid "Available scanners"
|
||
msgstr "Escáners disponibles"
|
||
|
||
#: lazarusidestrconsts.rsbuild
|
||
#| msgid "Build:"
|
||
msgid "&Build:"
|
||
msgstr "Construcción:"
|
||
|
||
#: lazarusidestrconsts.rscharacterset
|
||
msgid "Character set:"
|
||
msgstr "Conjunto de caracteres:"
|
||
|
||
#: lazarusidestrconsts.rsclosecurrentpage
|
||
msgid "Close current page"
|
||
msgstr "Cerrar página actual"
|
||
|
||
#: lazarusidestrconsts.rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr "Defines condicionales"
|
||
|
||
#: lazarusidestrconsts.rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr "Crear un nuevo define"
|
||
|
||
#: lazarusidestrconsts.rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr "Activar internacionalización"
|
||
|
||
#: lazarusidestrconsts.rsenterpid
|
||
msgid "Enter PID"
|
||
msgstr "Entrar PID"
|
||
|
||
#: lazarusidestrconsts.rsfilterthelistwithstring
|
||
msgid "Filter the lines in list with a string"
|
||
msgstr "Filtrar las líneas de la lista con una cadena"
|
||
|
||
#: lazarusidestrconsts.rsformdatafiledfm
|
||
msgid "Form data file (*.dfm)|*.dfm"
|
||
msgstr "Fichero de datos del formulario (*.dfm)|*.dfm"
|
||
|
||
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
||
msgid "Found, but not listed here: "
|
||
msgstr "Hallado, pero no listado aquí:"
|
||
|
||
#: lazarusidestrconsts.rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr "Opciones de internacionalización"
|
||
|
||
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
||
#, fuzzy
|
||
#| msgid "Include Version Info in executable"
|
||
msgid "Include version info in executable"
|
||
msgstr "Incluir Información de la Versión en el ejecutable"
|
||
|
||
#: lazarusidestrconsts.rsiwpcolumnnameshint
|
||
msgid "Column Names"
|
||
msgstr "Nombres de columna"
|
||
|
||
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
|
||
msgid "Strategy for saving Columns"
|
||
msgstr "Estrategia para el ahorro de columnas"
|
||
|
||
#: lazarusidestrconsts.rsiwpcolumnwidthhint
|
||
msgid "Column Width"
|
||
msgstr "Ancho de columna"
|
||
|
||
#: lazarusidestrconsts.rsiwpcustomgeometry
|
||
msgid "Custom geometry"
|
||
msgstr "Geometría personalizada"
|
||
|
||
#: lazarusidestrconsts.rsiwpcustomgeometryhint
|
||
msgid "User can define window's position and size"
|
||
msgstr "Usuario puede definir la posición y el tamaño de la ventana"
|
||
|
||
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
|
||
msgid "Fixed default geometry"
|
||
msgstr "Geometría fija predeterminada"
|
||
|
||
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
|
||
msgid "Always the same fixed position and size"
|
||
msgstr "Siempre la misma posición y tamaño fija"
|
||
|
||
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
|
||
msgid "Let windowmanager decide"
|
||
msgstr "Dejó administrador de ventanas decidir"
|
||
|
||
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
|
||
msgid "System windowmanagers have different strategies for positioning windows"
|
||
msgstr "Sistema administrador de ventanas tienen diferentes estrategias para el posicionamiento de ventanas"
|
||
|
||
#: lazarusidestrconsts.rsiwppositionwindowlisthint
|
||
msgid "Windows that have been open. They may be closed now."
|
||
msgstr "Ventanas que han sido abiertas. Pueden ser cerradas ahora."
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Restaurar geometría de ventana"
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
|
||
msgid "Use previous position and size"
|
||
msgstr "Utilice el tamaño y la posición anterior"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplittercustomposition
|
||
msgid "Custom Size"
|
||
msgstr "Tamaño personalizado"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterdefault
|
||
msgid "Default Size"
|
||
msgstr "Tamaño por defecto"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
|
||
msgid "Restore with window"
|
||
msgstr "Restaurar con ventana"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
|
||
msgid "Restore Size"
|
||
msgstr "Restaurar Tamaño"
|
||
|
||
#: lazarusidestrconsts.rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr "Afrikaans"
|
||
|
||
#: lazarusidestrconsts.rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr "Árabe"
|
||
|
||
#: lazarusidestrconsts.rslanguageautomatic
|
||
#, fuzzy
|
||
#| msgid "Automatic (or english)"
|
||
msgid "Automatic (or English)"
|
||
msgstr "Automático (o inglés)"
|
||
|
||
#: lazarusidestrconsts.rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr "Catalán"
|
||
|
||
#: lazarusidestrconsts.rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "Chino"
|
||
|
||
#: lazarusidestrconsts.rslanguageczech
|
||
msgid "Czech"
|
||
msgstr "Checo"
|
||
|
||
#: lazarusidestrconsts.rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr "Holandés"
|
||
|
||
#: lazarusidestrconsts.rslanguageenglish
|
||
msgid "English"
|
||
msgstr "Inglés"
|
||
|
||
#: lazarusidestrconsts.rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr "Finlandés"
|
||
|
||
#: lazarusidestrconsts.rslanguagefrench
|
||
msgid "French"
|
||
msgstr "Francés"
|
||
|
||
#: lazarusidestrconsts.rslanguagegerman
|
||
msgid "German"
|
||
msgstr "Alemán"
|
||
|
||
#: lazarusidestrconsts.rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "Hebreo"
|
||
|
||
#: lazarusidestrconsts.rslanguagehungarian
|
||
msgid "Hungarian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr "Indonesio"
|
||
|
||
#: lazarusidestrconsts.rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "Italiano"
|
||
|
||
#: lazarusidestrconsts.rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr "Japonés"
|
||
|
||
#: lazarusidestrconsts.rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr "Lituano"
|
||
|
||
#: lazarusidestrconsts.rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr "Opciones del lenguaje"
|
||
|
||
#: lazarusidestrconsts.rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "Polaco"
|
||
|
||
#: lazarusidestrconsts.rslanguageportuguese
|
||
msgid "Portuguese"
|
||
msgstr "Portugués"
|
||
|
||
#: lazarusidestrconsts.rslanguageportuguesebr
|
||
msgid "Brazilian Portuguese"
|
||
msgstr "Portugués Brasileño"
|
||
|
||
#: lazarusidestrconsts.rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "Ruso"
|
||
|
||
#: lazarusidestrconsts.rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr "Selección de lenguaje:"
|
||
|
||
#: lazarusidestrconsts.rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr "Eslovaco"
|
||
|
||
#: lazarusidestrconsts.rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr "Español"
|
||
|
||
#: lazarusidestrconsts.rslanguageturkish
|
||
msgid "Turkish"
|
||
msgstr "Turco"
|
||
|
||
#: lazarusidestrconsts.rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr "Ucraniano"
|
||
|
||
#: lazarusidestrconsts.rsmajorversion
|
||
msgid "&Major version:"
|
||
msgstr "Versión &Mayor:"
|
||
|
||
#: lazarusidestrconsts.rsminorversion
|
||
msgid "Mi&nor version:"
|
||
msgstr "Versión Me&nor:"
|
||
|
||
#: lazarusidestrconsts.rsotherinfo
|
||
msgid "Other info"
|
||
msgstr "Más información"
|
||
|
||
#: lazarusidestrconsts.rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr "Directorio de salida del archivo PO:"
|
||
|
||
#: lazarusidestrconsts.rsresource
|
||
msgid "Resource"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsresourceclear
|
||
msgid "Delete all resources?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsresourcefilename
|
||
msgid "File name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsresourcetype
|
||
msgctxt "lazarusidestrconsts.rsresourcetype"
|
||
msgid "Type"
|
||
msgstr "Tipo"
|
||
|
||
#: lazarusidestrconsts.rsrevision
|
||
msgid "&Revision:"
|
||
msgstr "&Revisión:"
|
||
|
||
#: lazarusidestrconsts.rsscanners
|
||
msgid "Scanners"
|
||
msgstr "Scáners"
|
||
|
||
#: lazarusidestrconsts.rsselectaninheritedentry
|
||
msgid "Select an inherited entry"
|
||
msgstr "Seleccionar un elemento heredado"
|
||
|
||
#: lazarusidestrconsts.rsstartanewsearch
|
||
msgid "Start a new search"
|
||
msgstr "Comenzar una nueva busqueda"
|
||
|
||
#: lazarusidestrconsts.rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr "Numeración de versión"
|
||
|
||
#: lazarusidestrconsts.srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr "Comandos del menú de ayuda"
|
||
|
||
#: lazarusidestrconsts.srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr "Comandos de comando"
|
||
|
||
#: lazarusidestrconsts.srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr "Comandos de CodeTools"
|
||
|
||
#: lazarusidestrconsts.srkmcatcolselection
|
||
msgid "Text column selection commands"
|
||
msgstr "Comandos para selección de texto en modo columna"
|
||
|
||
#: lazarusidestrconsts.srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr "Comandos de movimiento del cursor"
|
||
|
||
#: lazarusidestrconsts.srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr "Comandos de edición de texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr "Comandos del menú archivo"
|
||
|
||
#: lazarusidestrconsts.srkmcatfold
|
||
msgid "Text folding commands"
|
||
msgstr "Comandos para plegado de código"
|
||
|
||
#: lazarusidestrconsts.srkmcatmacrorecording
|
||
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
||
msgid "Macros"
|
||
msgstr "Macros"
|
||
|
||
#: lazarusidestrconsts.srkmcatmarker
|
||
msgid "Text marker commands"
|
||
msgstr "Comandos de marcas de texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr "Comandos para el menu del Paquete"
|
||
|
||
#: lazarusidestrconsts.srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr "Comandos de menú de Proyecto"
|
||
|
||
#: lazarusidestrconsts.srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr "Ejecutar comandos de menú"
|
||
|
||
#: lazarusidestrconsts.srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr "Comandos de búsqueda y reemplazo de texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr "Comando de selección de texto"
|
||
|
||
#: lazarusidestrconsts.srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr "Comandos de bloc de notas fuente"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroedit
|
||
msgid "Syncron Editing"
|
||
msgstr "Edición Sincrónizada"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
||
msgid "Syncron Editing (not in Cell)"
|
||
msgstr "Edición Sincronizada (no en celda)"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
||
msgid "Syncron Editing (while selecting)"
|
||
msgstr "Edición Sincronizada (Durante la selección)"
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateedit
|
||
msgid "Template Editing"
|
||
msgstr "Edición de Plantilla"
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateeditoff
|
||
msgid "Template Editing (not in Cell)"
|
||
msgstr "Edición de Plantilla (no en celda)"
|
||
|
||
#: lazarusidestrconsts.srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr "Comandos de menú de herramientas"
|
||
|
||
#: lazarusidestrconsts.srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr "Comandos del menú Ver"
|
||
|
||
#: lazarusidestrconsts.srkmcommand
|
||
msgctxt "lazarusidestrconsts.srkmcommand"
|
||
msgid "Command:"
|
||
msgstr "Comando:"
|
||
|
||
#: lazarusidestrconsts.srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Conflicto "
|
||
|
||
#: lazarusidestrconsts.srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr "abortar construcción"
|
||
|
||
#: lazarusidestrconsts.srkmecabstractmethods
|
||
#, fuzzy
|
||
#| msgid "Abstract methods ..."
|
||
msgid "Abstract Methods ..."
|
||
msgstr "Métodos abstractos ..."
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpaddress
|
||
msgid "add address breakpoint"
|
||
msgstr "añadir dirección de punto de ruptura"
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpsource
|
||
msgid "add source breakpoint"
|
||
msgstr "añadir fuente de punto de ruptura"
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
||
msgid "add data/watchpoint"
|
||
msgstr "añadir dato/punto de observación"
|
||
|
||
#: lazarusidestrconsts.srkmecaddjumppoint
|
||
#, fuzzy
|
||
#| msgid "Add jump point"
|
||
msgid "Add Jump Point"
|
||
msgstr "Añadir punto de salto"
|
||
|
||
#: lazarusidestrconsts.srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr "añadir punto de observación"
|
||
|
||
#: lazarusidestrconsts.srkmecattach
|
||
msgid "Attach to program"
|
||
msgstr "Adjuntar(attach) al programa"
|
||
|
||
#: lazarusidestrconsts.srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr "Completar plantilla de código"
|
||
|
||
#: lazarusidestrconsts.srkmecblockcopy
|
||
msgid "Copy Block"
|
||
msgstr "Copiar Bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblockdelete
|
||
msgid "Delete Block"
|
||
msgstr "Eliminar Bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotobegin
|
||
msgid "Goto Block begin"
|
||
msgstr "Ir al begin del bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotoend
|
||
msgid "Goto Block end"
|
||
msgstr "ir al end del bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblockhide
|
||
msgid "Hide Block"
|
||
msgstr "Esconder Bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr "Sangrar bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblockmove
|
||
msgid "Move Block"
|
||
msgstr "Mover Bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetbegin
|
||
msgid "Set block begin"
|
||
msgstr "Establecer inicio de bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetend
|
||
msgid "Set block end"
|
||
msgstr "Establecer final de bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblockshow
|
||
msgid "Show Block"
|
||
msgstr "Mostra Bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblocktogglehide
|
||
msgid "Toggle block"
|
||
msgstr "Intercabiar Bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr "Desangrar Bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr "construir programa/proyecto"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr "construir archivo"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildlazarus
|
||
#, fuzzy
|
||
#| msgid "Build lazarus"
|
||
msgid "Build Lazarus"
|
||
msgstr "Construir lazarus"
|
||
|
||
#: lazarusidestrconsts.srkmecchar
|
||
msgid "Char"
|
||
msgstr "Caracter"
|
||
|
||
#: lazarusidestrconsts.srkmeccleanupcompiled
|
||
msgid "clean up build files"
|
||
msgstr "Limpiar archivos de construcción"
|
||
|
||
#: lazarusidestrconsts.srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr "Borrar texto entero"
|
||
|
||
#: lazarusidestrconsts.srkmecclearallbookmark
|
||
msgid "Clear all Bookmarks"
|
||
msgstr "Borrar todos los marcadores"
|
||
|
||
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
||
msgid "Clear Bookmarks for current file"
|
||
msgstr "Borrar marcadores de archivo actual"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseldown
|
||
msgid "Column Select Down"
|
||
msgstr "Selección de Columna Abajo"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
||
msgid "Column Select to absolute end"
|
||
msgstr "Selección de Columna a final absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditortop
|
||
msgid "Column Select to absolute beginning"
|
||
msgstr "Selección de Columna a comienzo absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselleft
|
||
msgid "Column Select Left"
|
||
msgstr "Selección de Columna izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellineend
|
||
msgid "Column Select Line End"
|
||
msgstr "Selección de Columna Fin de Línea"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinestart
|
||
msgid "Column Select Line Start"
|
||
msgstr "Selección de Columna Inicio de Línea"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
||
msgid "Column Select to text start in line"
|
||
msgstr "Columna Seleccionar hasta principio de la linea de texto"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagebottom
|
||
msgid "Column Select Page Bottom"
|
||
msgstr "Selección de Columna inferior de página"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagedown
|
||
msgid "Column Select Page Down"
|
||
msgstr "Selección de Columna página abajo"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagetop
|
||
msgid "Column Select Page Top"
|
||
msgstr "Selección de Columna página arriba"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpageup
|
||
msgid "Column Select Page Up"
|
||
msgstr "Selección de Columna página arriba"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselright
|
||
msgid "Column Select Right"
|
||
msgstr "Selección de Columna derecha"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselup
|
||
msgid "Column Select Up"
|
||
msgstr "Selección de Columna arriba"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordleft
|
||
msgid "Column Select Word Left"
|
||
msgstr "Selección de Columna Palabra Izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordright
|
||
msgid "Column Select Word Right"
|
||
msgstr "Selección de Columna Palabra Derecha"
|
||
|
||
#: lazarusidestrconsts.srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr "Modo de selección de columna"
|
||
|
||
#: lazarusidestrconsts.srkmeccompile
|
||
msgid "compile program/project"
|
||
msgstr "compilar programa/proyecto"
|
||
|
||
#: lazarusidestrconsts.srkmeccompletecode
|
||
#, fuzzy
|
||
#| msgid "Complete code"
|
||
msgctxt "lazarusidestrconsts.srkmeccompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Completar código"
|
||
|
||
#: lazarusidestrconsts.srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr "configurar archivo de construcción"
|
||
|
||
#: lazarusidestrconsts.srkmeccopy
|
||
msgid "Copy selection to clipboard"
|
||
msgstr "Copiar la selección al portapapeles"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
||
msgid "Copy editor to new window"
|
||
msgstr "Copiar editor a una nueva ventana"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
||
msgid "Copy editor to next free window"
|
||
msgstr "Copiar editor a la ventana libre siguiente"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
||
msgid "Copy editor to prior free window"
|
||
msgstr "Copiar editor a la ventana libre anterior"
|
||
|
||
#: lazarusidestrconsts.srkmeccut
|
||
msgid "Cut selection to clipboard"
|
||
msgstr "Corta selección al portapapeles"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr "Borrar al principio de la línea"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr "Borrar caracter en cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr "Borrar al final de la línea"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr "Borrar último Caracter"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr "Borrar al principio de la palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr "Borrar línea actual"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr "Borrar al final de la palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecdetach
|
||
msgid "Detach from program"
|
||
msgstr "Separar(Detach) del programa"
|
||
|
||
#: lazarusidestrconsts.srkmecdiff
|
||
msgctxt "lazarusidestrconsts.srkmecdiff"
|
||
msgid "Diff"
|
||
msgstr "Diff"
|
||
|
||
#: lazarusidestrconsts.srkmecdown
|
||
msgid "Move cursor down"
|
||
msgstr "Mover cursor abajo"
|
||
|
||
#: lazarusidestrconsts.srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr "Mover cursor al fin absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr "Mover cursor al principio absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmecemptymethods
|
||
#, fuzzy
|
||
#| msgid "Empty methods ..."
|
||
msgid "Empty Methods ..."
|
||
msgstr "Métodos Vácios ..."
|
||
|
||
#: lazarusidestrconsts.srkmecenvironmentoptions
|
||
msgid "IDE options"
|
||
msgstr "Opciones del IDE"
|
||
|
||
#: lazarusidestrconsts.srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr "evaluar/modificar"
|
||
|
||
#: lazarusidestrconsts.srkmecextractproc
|
||
#, fuzzy
|
||
#| msgid "Extract procedure"
|
||
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
||
msgid "Extract Procedure"
|
||
msgstr "Extraer procedimiento"
|
||
|
||
#: lazarusidestrconsts.srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr "Herramienta externa %d"
|
||
|
||
#: lazarusidestrconsts.srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr "Configuración de las herramientas externas"
|
||
|
||
#: lazarusidestrconsts.srkmecfind
|
||
#, fuzzy
|
||
#| msgid "Find text"
|
||
msgid "Find Text"
|
||
msgstr "Buscar texto"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr "Buscar otro fin de bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr "Buscar inicio de bloque"
|
||
|
||
#: lazarusidestrconsts.srkmecfinddeclaration
|
||
#, fuzzy
|
||
#| msgid "Find declaration"
|
||
msgid "Find Declaration"
|
||
msgstr "Buscar declaración"
|
||
|
||
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
||
#, fuzzy
|
||
#| msgid "Find identifier references"
|
||
msgid "Find Identifier References"
|
||
msgstr "Buscar referencias del identificador"
|
||
|
||
#: lazarusidestrconsts.srkmecfindinfiles
|
||
#, fuzzy
|
||
#| msgid "Find in files"
|
||
msgid "Find in Files"
|
||
msgstr "Buscar en archivos"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnext
|
||
#, fuzzy
|
||
#| msgid "Find next"
|
||
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
||
msgid "Find Next"
|
||
msgstr "Buscar siguiente"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
||
#, fuzzy
|
||
#| msgid "Find next word occurrence"
|
||
msgid "Find Next Word Occurrence"
|
||
msgstr "Buscar próxima coincidencia de palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloads
|
||
#, fuzzy
|
||
#| msgid "Find overloads"
|
||
msgid "Find Overloads"
|
||
msgstr "Encontrar recargadas"
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
||
#, fuzzy
|
||
#| msgid "Find overloads ..."
|
||
msgid "Find Overloads ..."
|
||
msgstr "Encontrar sobrecargas ..."
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevious
|
||
#, fuzzy
|
||
#| msgid "Find previous"
|
||
msgid "Find Previous"
|
||
msgstr "Buscar previo"
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
||
#, fuzzy
|
||
#| msgid "Find previous word occurrence"
|
||
msgid "Find Previous Word Occurrence"
|
||
msgstr "Buscar Anterior Concidencia de palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
||
#, fuzzy
|
||
#| msgid "Find procedure definiton"
|
||
msgid "Find Procedure Definiton"
|
||
msgstr "Buscar Definición de Procedimiento"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduremethod
|
||
#, fuzzy
|
||
#| msgid "Find procedure method"
|
||
msgid "Find Procedure Method"
|
||
msgstr "Buscar Método de Procedimiento"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldcurrent
|
||
msgid "Fold at Cursor"
|
||
msgstr "Plegar en cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldlevel
|
||
msgid "Fold to Level %d"
|
||
msgstr "Plegar al nivel %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr "Ir a editor %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoincludedirective
|
||
#, fuzzy
|
||
#| msgid "Go to to include directive of current include file"
|
||
msgid "Go to include directive of current include file"
|
||
msgstr "Ir a directiva de inclusión del archivo include actual"
|
||
|
||
#: lazarusidestrconsts.srkmecgotolinenumber
|
||
#, fuzzy
|
||
#| msgid "Go to line number"
|
||
msgid "Go to Line Number"
|
||
msgstr "Ir a Línea Número"
|
||
|
||
#: lazarusidestrconsts.srkmecgotomarker
|
||
msgid "Go to Marker %d"
|
||
msgstr "Ir a Marca %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr "Ir a XY"
|
||
|
||
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
||
#, fuzzy
|
||
#| msgid "Guess misplaced $IFDEF"
|
||
msgid "Guess Misplaced $IFDEF"
|
||
msgstr "Buscar $IFDEF Fuera de Lugar"
|
||
|
||
#: lazarusidestrconsts.srkmechalfwordleft
|
||
msgid "Move cursor half-word left"
|
||
msgstr "Mover cursor mitad palabra izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmechalfwordright
|
||
msgid "Move cursor half-word right"
|
||
msgstr "Mover cursor mitad palabra derecha"
|
||
|
||
#: lazarusidestrconsts.srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr "Ime Str"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr "Insertar entrada de Registro de cambios"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr "Insertar desde mapa de caracteres"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr "Insertar palabra clave CVS de Autor"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr "Insertar palabra clave CVS de Fecha"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr "Insertar palabra clave CVS de cabecera"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr "Insertar palabra clave CVS de ID"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr "Insertar palabra clave CVS de registro"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr "Insertar palabra clave CVS de nombre"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr "Insertar palabra clave CVS de Revisión"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr "Insertar palabra clave CVS de código"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr "Insertar fecha y hora actual"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertfilename
|
||
msgid "Insert Full Filename"
|
||
msgstr "Insertar Nombre de Archivo Completo"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr "Insertar aviso GPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr "Insertar un GUID"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr "Insertar aviso LGPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "Saltar línea, dejar el cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmitnotice
|
||
msgid "Insert MIT notice"
|
||
msgstr "Insertar advertencia MIT"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr "Insertar Modo"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr "Insertar aviso LGPL modificado"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr "Insertar nombre del usuario actual"
|
||
|
||
#: lazarusidestrconsts.srkmecinspect
|
||
msgid "inspect"
|
||
msgstr "inspeccionar"
|
||
|
||
#: lazarusidestrconsts.srkmecinvertassignment
|
||
#, fuzzy
|
||
#| msgid "Invert assignment"
|
||
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
||
msgid "Invert Assignment"
|
||
msgstr "Invertir Tarea"
|
||
|
||
#: lazarusidestrconsts.srkmecleft
|
||
msgid "Move cursor left"
|
||
msgstr "Mover cursor a la izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "Saltar línea y mover el cursor"
|
||
|
||
#: lazarusidestrconsts.srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr "Mover cursor al final de línea"
|
||
|
||
#: lazarusidestrconsts.srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr "Modo de selección de línea"
|
||
|
||
#: lazarusidestrconsts.srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr "Mover cursor a principio de línea"
|
||
|
||
#: lazarusidestrconsts.srkmeclinetextstart
|
||
msgid "Move cursor to text start in line"
|
||
msgstr "Mover el cursor al comienzo del texto en la línea"
|
||
|
||
#: lazarusidestrconsts.srkmeclockeditor
|
||
msgid "Lock Editor"
|
||
msgstr "Bloquear Editor"
|
||
|
||
#: lazarusidestrconsts.srkmecmakeresourcestring
|
||
#, fuzzy
|
||
#| msgid "Make resource string"
|
||
msgid "Make Resource String"
|
||
msgstr "Hacer Cadena de Recursos"
|
||
|
||
#: lazarusidestrconsts.srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr "Ir a matching bracket"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr "Mover ventana del editor a la izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr "Mover ventana del editor al primero"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
||
msgid "Move editor to new window"
|
||
msgstr "Movar editor a una nueva ventana"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
||
msgid "Move editor to next free window"
|
||
msgstr "Mover editor a la ventana libre siguiente"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
||
msgid "Move editor to prior free window"
|
||
msgstr "Mover editor a la ventana libre anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr "Mover ventana del editor a la derecha"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr "Mover ventana del editor al último"
|
||
|
||
#: lazarusidestrconsts.srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr "Siguiente Marcador"
|
||
|
||
#: lazarusidestrconsts.srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr "Ir a siguiente editor"
|
||
|
||
#: lazarusidestrconsts.srkmecnextsharededitor
|
||
msgid "Go to next editor with same Source"
|
||
msgstr "Ir al editor siguiente con la misma Fuente "
|
||
|
||
#: lazarusidestrconsts.srkmecnextwindow
|
||
msgid "Go to next window"
|
||
msgstr "ir a la ventana siguiente"
|
||
|
||
#: lazarusidestrconsts.srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr "Modo de selección normal"
|
||
|
||
#: lazarusidestrconsts.srkmecopenfileatcursor
|
||
#, fuzzy
|
||
#| msgid "Open file at cursor"
|
||
msgid "Open File at Cursor"
|
||
msgstr "Abrir Archivo en Cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr "Sobreescribir Modo"
|
||
|
||
#: lazarusidestrconsts.srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr "Mover cursor a la parte inferior de la página"
|
||
|
||
#: lazarusidestrconsts.srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr "Mover cursor una página abajo"
|
||
|
||
#: lazarusidestrconsts.srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr "Mover cursor una página a la izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr "Mover cursor una página a la derecha"
|
||
|
||
#: lazarusidestrconsts.srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr "Mover cursor al principio de la página"
|
||
|
||
#: lazarusidestrconsts.srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr "Mover cursor una página hacia arriba"
|
||
|
||
#: lazarusidestrconsts.srkmecpaste
|
||
msgid "Paste clipboard to current position"
|
||
msgstr "Pegar contenido del portapapeles en la posición actual"
|
||
|
||
#: lazarusidestrconsts.srkmecpause
|
||
msgid "pause program"
|
||
msgstr "pausar programa"
|
||
|
||
#: lazarusidestrconsts.srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr "Marcador Anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr "Ir a editor anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecprevsharededitor
|
||
msgid "Go to prior editor with same Source"
|
||
msgstr "Ir al editor anterior con la misma Fuente "
|
||
|
||
#: lazarusidestrconsts.srkmecprevwindow
|
||
msgid "Go to prior window"
|
||
msgstr "ir a la ventana anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr "compilado rápido, sin enlazado"
|
||
|
||
#: lazarusidestrconsts.srkmecremovebreakpoint
|
||
#, fuzzy
|
||
#| msgid "remove break point"
|
||
msgid "remove breakpoint"
|
||
msgstr "eliminar punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveemptymethods
|
||
#, fuzzy
|
||
#| msgid "Remove empty methods"
|
||
msgid "Remove Empty Methods"
|
||
msgstr "Eliminar métodos vacios"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveunusedunits
|
||
#, fuzzy
|
||
#| msgid "Remove unused units"
|
||
msgid "Remove Unused Units"
|
||
msgstr "Eliminar Unidades no Usadas"
|
||
|
||
#: lazarusidestrconsts.srkmecrenameidentifier
|
||
#, fuzzy
|
||
#| msgid "Rename identifier"
|
||
msgid "Rename Identifier"
|
||
msgstr "Renombrar Identificador"
|
||
|
||
#: lazarusidestrconsts.srkmecreplace
|
||
#, fuzzy
|
||
#| msgid "Replace text"
|
||
msgid "Replace Text"
|
||
msgstr "Reemplazar Texto"
|
||
|
||
#: lazarusidestrconsts.srkmecreportingbug
|
||
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
||
msgid "Reporting a bug"
|
||
msgstr "Comunicación de errores"
|
||
|
||
#: lazarusidestrconsts.srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr "reiniciar depurador"
|
||
|
||
#: lazarusidestrconsts.srkmecright
|
||
msgid "Move cursor right"
|
||
msgstr "Mueve cursor derecha"
|
||
|
||
#: lazarusidestrconsts.srkmecrun
|
||
msgid "run program"
|
||
msgstr "ejecutar programa"
|
||
|
||
#: lazarusidestrconsts.srkmecrunfile
|
||
msgid "run file"
|
||
msgstr "ejecutar archivo"
|
||
|
||
#: lazarusidestrconsts.srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr "parámetros de ejecución"
|
||
|
||
#: lazarusidestrconsts.srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr "Desplazar abajo una línea"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr "Desplazar a la izquierda un caracter"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr "Desplazar a la derecha un caracter"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr "Desplazar arriba una línea"
|
||
|
||
#: lazarusidestrconsts.srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr "Seleccionar Abajo"
|
||
|
||
#: lazarusidestrconsts.srkmecselectall
|
||
msgctxt "lazarusidestrconsts.srkmecselectall"
|
||
msgid "Select All"
|
||
msgstr "Seleccionar Todo"
|
||
|
||
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr "Convertir tabulaciones a espacios en la selección"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr "Seleccionar final absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr "Seleccionar principio absoluto"
|
||
|
||
#: lazarusidestrconsts.srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr "Seleccionar ir a XY"
|
||
|
||
#: lazarusidestrconsts.srkmecselhalfwordleft
|
||
msgid "Select half-word left"
|
||
msgstr "Seleccionar mitad de palabra izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmecselhalfwordright
|
||
msgid "Select half-word right"
|
||
msgstr "Seleccionar mitad de palabra derecha"
|
||
|
||
#: lazarusidestrconsts.srkmecselleft
|
||
#, fuzzy
|
||
#| msgid "SelLeft"
|
||
msgid "Select Left"
|
||
msgstr "Seleccionar Izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmecsellineend
|
||
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
||
msgid "Select Line End"
|
||
msgstr "Seleccionar fin de línea"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinestart
|
||
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
||
msgid "Select Line Start"
|
||
msgstr "Seleccionar Principio de Línea"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinetextstart
|
||
msgid "Select to text start in line"
|
||
msgstr "Seleccionar hasta principio de la linea de texto"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagebottom
|
||
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
||
msgid "Select Page Bottom"
|
||
msgstr "Seleccionar Última Página"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr "Seleccionar Página Abajo"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr "Selecciona Página Izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr "Seleccionar Página Derecha"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagetop
|
||
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
||
msgid "Select Page Top"
|
||
msgstr "Seleccionar Primera Página"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr "Seleccionar Página Arriba"
|
||
|
||
#: lazarusidestrconsts.srkmecselright
|
||
#, fuzzy
|
||
#| msgid "SelRight"
|
||
msgid "Select Right"
|
||
msgstr "Seleccionar Derecho"
|
||
|
||
#: lazarusidestrconsts.srkmecselsticky
|
||
msgid "Start sticky selecting"
|
||
msgstr "Comenzar seleccionado pegajoso"
|
||
|
||
#: lazarusidestrconsts.srkmecselstickycol
|
||
msgid "Start sticky selecting (Columns)"
|
||
msgstr "Comenzar seleccionado pegajoso (Columnas)"
|
||
|
||
#: lazarusidestrconsts.srkmecselstickyline
|
||
msgid "Start sticky selecting (Line)"
|
||
msgstr "Comenzar seleccionado pegajoso (Linea)"
|
||
|
||
#: lazarusidestrconsts.srkmecselstickystop
|
||
msgid "Stop sticky selecting"
|
||
msgstr "Parar seleccionado pegajoso"
|
||
|
||
#: lazarusidestrconsts.srkmecselup
|
||
msgid "Select Up"
|
||
msgstr "Seleccionar Arriba"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordendleft
|
||
msgid "Select word-end left"
|
||
msgstr "Seleccionar hasta el extremo izquierdo de la palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordendright
|
||
msgid "Select word-end right"
|
||
msgstr "Seleccionar hasta el extremo derecho de la palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordleft
|
||
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
||
msgid "Select Word Left"
|
||
msgstr "Seleccionar Palabra Izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordright
|
||
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
||
msgid "Select Word Right"
|
||
msgstr "Seleccionar Palabra Derecha"
|
||
|
||
#: lazarusidestrconsts.srkmecsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Establecer un Marcador libre"
|
||
|
||
#: lazarusidestrconsts.srkmecsetmarker
|
||
msgid "Set Marker %d"
|
||
msgstr "Establecer Marca %d"
|
||
|
||
#: lazarusidestrconsts.srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr "Mayus Tab"
|
||
|
||
#: lazarusidestrconsts.srkmecshowabstractmethods
|
||
#, fuzzy
|
||
#| msgid "Show abstract methods"
|
||
msgid "Show Abstract Methods"
|
||
msgstr "Mostrar Métodos Abstractos"
|
||
|
||
#: lazarusidestrconsts.srkmecshowcodecontext
|
||
#, fuzzy
|
||
#| msgid "Show code context"
|
||
msgid "Show Code Context"
|
||
msgstr "Mostrar Contexto del Código"
|
||
|
||
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
||
msgid "show execution point"
|
||
msgstr "ver punto de ejecución"
|
||
|
||
#: lazarusidestrconsts.srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr "Parar programa"
|
||
|
||
#: lazarusidestrconsts.srkmecsynmacroplay
|
||
msgid "Play Macro"
|
||
msgstr "Reproducir Macro"
|
||
|
||
#: lazarusidestrconsts.srkmecsynmacrorecord
|
||
msgid "Record Macro"
|
||
msgstr "Grabar Macro"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr "Ir a la ultima posición en celda"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr "Ir a la primer posición en celda"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
||
msgid "Select Cell"
|
||
msgstr "Seleccinar celda"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
||
msgid "Escape"
|
||
msgstr "Escape"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
||
msgid "Next Cell"
|
||
msgstr "Celda Siguiente"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr "Celda Siguiente (Seleccionar todo)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
||
msgid "Next Cell (firsts only)"
|
||
msgstr "Celda Siguiente (solo primeras)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
||
msgid "Next Cell (all selected / firsts only)"
|
||
msgstr "Celda Siguiente (Seleccionar todo / solo primeras)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr "Celda Anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr "Celda Anterior (Seleccionar Todo)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
||
msgid "Previous Cell (firsts only)"
|
||
msgstr "Celda Anterior (solo primeras)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
||
msgid "Previous Cell (all selected / firsts only)"
|
||
msgstr "Celda Anterior (Seleccionar Todo / solo primeras)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
||
msgid "Start Syncro edit"
|
||
msgstr "Iniciar Edición Sincronizada"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr "Ir a la última posición en la celda"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr "Ir a la primera posición en la celda"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
||
msgid "Select cell"
|
||
msgstr "Seleccionar Celda"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
||
msgid "Escape"
|
||
msgstr "Escape"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
||
msgid "Finish"
|
||
msgstr "Terminar"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
||
msgid "Next Cell"
|
||
msgstr "Celda Siguiente"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
||
msgid "Next Cell (rotate)"
|
||
msgstr "Celda Siguiente (rotar)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr "Celda Siguiente (todo seleccionado)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
||
msgid "Next Cell (rotate / all selected)"
|
||
msgstr "Celda Siguiente (rotar/todo seleccionado)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
||
msgid "Next Cell (firsts only)"
|
||
msgstr "Celda Siguiente (primeras solamente)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
||
msgid "Next Cell (rotate / firsts only)"
|
||
msgstr "Celda Siguiente (girar / primeras solamente)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
||
msgid "Next Cell (all selected / firsts only)"
|
||
msgstr "Celda Siguiente (girar / todas las seleccionadas / primeras solamente)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
||
msgid "Next Cell (rotate / all selected / firsts only)"
|
||
msgstr "Celda Siguiente (girar / todas las seleccionadas / primeras solamente)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr "Celda Anterior"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr "Celda Anterior (todo seleccionado)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
||
msgid "Previous Cell (firsts only)"
|
||
msgstr "Celda Anterior (primeras solamente)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
||
msgid "Previous Cell (all selected / firsts only)"
|
||
msgstr "Celda Anterior (todas las seleccionadas/primeras solamente)"
|
||
|
||
#: lazarusidestrconsts.srkmecsyntaxcheck
|
||
#, fuzzy
|
||
#| msgid "Syntax check"
|
||
msgid "Syntax Check"
|
||
msgstr "Verificar Sintaxis"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleassembler
|
||
msgid "View assembler"
|
||
msgstr "Ver ensamblador"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoint
|
||
#, fuzzy
|
||
#| msgid "toggle break point"
|
||
msgid "toggle breakpoint"
|
||
msgstr "intercambiar punto de interrupción"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr "Ver puntos de interrupción"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr "Ver pila(stack) de llamadas"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr "Ver explorador de código"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr "Ver Explorador de Código"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr "Ver paleta de componentes"
|
||
|
||
#: lazarusidestrconsts.srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr "Ver salida del depurador"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr "Escoger entre formulario y unidad"
|
||
|
||
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr "Ver editor de documentación"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
||
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
||
msgid "View IDE speed buttons"
|
||
msgstr "Ver botones del IDE"
|
||
|
||
#: lazarusidestrconsts.srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr "Ver variables locales"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarker
|
||
msgid "Toggle Marker %d"
|
||
msgstr "Intercambiar Marcador %d"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarkupword
|
||
msgid "Toggle Current-Word highlight"
|
||
msgstr "Intercambiar Resaltado de Palabra-Actual"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr "Ver mensajes"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr "Cambiar Modo"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr "Ver Inspector de Objetos"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleregisters
|
||
msgid "View registers"
|
||
msgstr "Ver registros"
|
||
|
||
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr "Ver Explorador de Restricciones"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr "Ver resultados de la búsqueda"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "Ver Editor de Fuente"
|
||
|
||
#: lazarusidestrconsts.srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr "Ver puntos de observación"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldall
|
||
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
||
msgid "Unfold all"
|
||
msgstr "Desplegar Todo"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldcurrent
|
||
msgid "Unfold at Cursor"
|
||
msgstr "Desplegar en Cursor"
|
||
|
||
#: lazarusidestrconsts.srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr "comando de editor desconocido"
|
||
|
||
#: lazarusidestrconsts.srkmecunusedunits
|
||
#, fuzzy
|
||
#| msgid "Unused units ..."
|
||
msgid "Unused Units ..."
|
||
msgstr "Unidades sin Usar ..."
|
||
|
||
#: lazarusidestrconsts.srkmecup
|
||
msgid "Move cursor up"
|
||
msgstr "Mueve cursor arriba"
|
||
|
||
#: lazarusidestrconsts.srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr "Ver editor de anclaje"
|
||
|
||
#: lazarusidestrconsts.srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr "Ver componentes"
|
||
|
||
#: lazarusidestrconsts.srkmecvieweditormacros
|
||
msgid "View editor macros"
|
||
msgstr "Ver editor macros"
|
||
|
||
#: lazarusidestrconsts.srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr "Ver formularios"
|
||
|
||
#: lazarusidestrconsts.srkmecviewhistory
|
||
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
||
msgid "View History"
|
||
msgstr "Ver Historial"
|
||
|
||
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
||
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
||
msgid "View Terminal Output"
|
||
msgstr "Ver Salida Terminal"
|
||
|
||
#: lazarusidestrconsts.srkmecviewtaborder
|
||
msgid "View Tab Order"
|
||
msgstr "Ver Orden Tab"
|
||
|
||
#: lazarusidestrconsts.srkmecviewthreads
|
||
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
||
msgid "View Threads"
|
||
msgstr "Ver Hilos(Threads)"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr "Ver dependencias de unidades"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr "Ver información de unidad"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunits
|
||
msgid "View units"
|
||
msgstr "Ver unidades"
|
||
|
||
#: lazarusidestrconsts.srkmecwordcompletion
|
||
#, fuzzy
|
||
#| msgid "Word completion"
|
||
msgid "Word Completion"
|
||
msgstr "Completado de Palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecwordendleft
|
||
msgid "Move cursor word-end left"
|
||
msgstr "Mueve el cursor al extremo izquierdo de la palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecwordendright
|
||
msgid "Move cursor word-end right"
|
||
msgstr "Mueve el cursor al extremo derecho de la palabra"
|
||
|
||
#: lazarusidestrconsts.srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr "Mover cursor una palabra a la izquierda"
|
||
|
||
#: lazarusidestrconsts.srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr "Mover cursor una palabra a la derecha"
|
||
|
||
#: lazarusidestrconsts.srkmeditforcmd
|
||
msgid "Edit keys of command"
|
||
msgstr "Editar teclas de comando"
|
||
|
||
#: lazarusidestrconsts.synffoldcomments
|
||
msgid "Fold comments"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldcommentsinselection
|
||
msgid "Fold comments in selection"
|
||
msgstr "Plegar los comentarios de la selección"
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdef
|
||
msgid "Fold inactive Ifdef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
||
msgid "Fold inactive Ifdef (exclude mixed state)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
||
msgid "Fold inactive Ifdef in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
||
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfhidecomments
|
||
msgid "Hide comments"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfhidecommentsinselection
|
||
msgid "Hide comments in selection"
|
||
msgstr "Ocultar los comentarios de la selección"
|
||
|
||
#: lazarusidestrconsts.synfunfoldactiveifdef
|
||
msgid "Unfold active Ifdef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
||
msgid "Unfold active Ifdef in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldall
|
||
msgctxt "lazarusidestrconsts.synfunfoldall"
|
||
msgid "Unfold all"
|
||
msgstr "Desplegar Todo"
|
||
|
||
#: lazarusidestrconsts.synfunfoldallifdef
|
||
msgid "Unfold all Ifdef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
||
msgid "Unfold all Ifdef in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldallinselection
|
||
#, fuzzy
|
||
#| msgid "Unfold all in Selection"
|
||
msgid "Unfold all in selection"
|
||
msgstr "Desplegar todo en la selección"
|
||
|
||
#: lazarusidestrconsts.synfunfoldcomments
|
||
msgid "Unfold comments"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
||
#, fuzzy
|
||
#| msgid "Unfold comments in Selection"
|
||
msgid "Unfold comments in selection"
|
||
msgstr "Desplegar comentarios en la selección"
|
||
|
||
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
||
msgid "Unfold inactive Ifdef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
||
msgid "Unfold inactive Ifdef in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr "El archivo es de sólo lectura"
|
||
|
||
#: lazarusidestrconsts.uefilerotext1
|
||
msgid "The file \""
|
||
msgstr "El archivo \""
|
||
|
||
#: lazarusidestrconsts.uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr "\" no se puede escribir."
|
||
|
||
#: lazarusidestrconsts.uelocked
|
||
msgid "Locked"
|
||
msgstr "Bloqueado"
|
||
|
||
#: lazarusidestrconsts.uemacrorecording
|
||
msgid "Recording"
|
||
msgstr "Grabando"
|
||
|
||
#: lazarusidestrconsts.uemacrorecordingpaused
|
||
msgid "Rec-pause"
|
||
msgstr "Pausar-Grabación"
|
||
|
||
#: lazarusidestrconsts.uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "Añadir &observación en cursor"
|
||
|
||
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
||
msgid "Add Watch&Point At Cursor"
|
||
msgstr "Añadir &Punto de observación en cursor"
|
||
|
||
#: lazarusidestrconsts.uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "Marcador"
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpages
|
||
msgid "Close All &Other Pages"
|
||
msgstr "Cerrar todas las &Otras páginas"
|
||
|
||
#: lazarusidestrconsts.uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "&Cerrar Página"
|
||
|
||
#: lazarusidestrconsts.uemcopyfilename
|
||
#| msgid "Copy filename"
|
||
msgid "Copy Filename"
|
||
msgstr "Copiar Nombre de archivo"
|
||
|
||
#: lazarusidestrconsts.uemcopytonewwindow
|
||
#, fuzzy
|
||
#| msgid "Clone to new Window"
|
||
msgid "Clone to New Window"
|
||
msgstr "Clonar a una Nueva Ventana"
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindow
|
||
#, fuzzy
|
||
#| msgid "Clone to other Window"
|
||
msgid "Clone to Other Window"
|
||
msgstr "Clonar a Otra Ventana"
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
||
msgid "New Window"
|
||
msgstr "Nueva Ventana"
|
||
|
||
#: lazarusidestrconsts.uemdebugword
|
||
msgid "Debug"
|
||
msgstr "Depurar"
|
||
|
||
#: lazarusidestrconsts.uemencoding
|
||
msgid "Encoding"
|
||
msgstr "Codificación"
|
||
|
||
#: lazarusidestrconsts.uemevaluatemodify
|
||
#, fuzzy
|
||
#| msgid "&Evaluate/Modify..."
|
||
msgid "&Evaluate/Modify ..."
|
||
msgstr "&Evaluar/Modificar ..."
|
||
|
||
#: lazarusidestrconsts.uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "&Buscar Declaración"
|
||
|
||
#: lazarusidestrconsts.uemfindinotherwindow
|
||
msgid "Find in other Window"
|
||
msgstr "Buscar en otra Ventana"
|
||
|
||
#: lazarusidestrconsts.uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "&Ir al Marcador"
|
||
|
||
#: lazarusidestrconsts.uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr "Resaltado"
|
||
|
||
#: lazarusidestrconsts.ueminspect
|
||
#, fuzzy
|
||
#| msgid "&Inspect..."
|
||
msgctxt "lazarusidestrconsts.ueminspect"
|
||
msgid "&Inspect ..."
|
||
msgstr "&Inspeccionar ..."
|
||
|
||
#: lazarusidestrconsts.ueminvertassignment
|
||
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
||
msgid "Invert Assignment"
|
||
msgstr "Invertir tarea"
|
||
|
||
#: lazarusidestrconsts.uemlineending
|
||
#, fuzzy
|
||
#| msgid "Line ending"
|
||
msgid "Line Ending"
|
||
msgstr "Fin de Línea"
|
||
|
||
#: lazarusidestrconsts.uemlockpage
|
||
msgid "&Lock Page"
|
||
msgstr "&Bloquear Página"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleft
|
||
#, fuzzy
|
||
#| msgid "Move page left"
|
||
msgid "Move Page Left"
|
||
msgstr "Mover Página a la Izquierda"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleftmost
|
||
#, fuzzy
|
||
#| msgid "Move page leftmost"
|
||
msgid "Move Page Leftmost"
|
||
msgstr "Mover Página hacia la Extrema Izquierda"
|
||
|
||
#: lazarusidestrconsts.uemmovepageright
|
||
#, fuzzy
|
||
#| msgid "Move page right"
|
||
msgid "Move Page Right"
|
||
msgstr "Mover Pagina a la Derecha"
|
||
|
||
#: lazarusidestrconsts.uemmovepagerightmost
|
||
#, fuzzy
|
||
#| msgid "Move page rightmost"
|
||
msgid "Move Page Rightmost"
|
||
msgstr "Mover Pagina hacia la Extrema Derecha"
|
||
|
||
#: lazarusidestrconsts.uemmovetonewwindow
|
||
#, fuzzy
|
||
#| msgid "Move to new Window"
|
||
msgid "Move to New Window"
|
||
msgstr "Mover a Nueva Ventana"
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindow
|
||
#, fuzzy
|
||
#| msgid "Move to other Window"
|
||
msgid "Move to Other Window"
|
||
msgstr "Mover a Otra Ventana"
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
||
msgid "New Window"
|
||
msgstr "Nueva Ventana"
|
||
|
||
#: lazarusidestrconsts.uemnextbookmark
|
||
#, fuzzy
|
||
#| msgid "Goto next Bookmark"
|
||
msgid "Goto Next Bookmark"
|
||
msgstr "Ir al Próximo Marcador"
|
||
|
||
#: lazarusidestrconsts.uemodified
|
||
msgid "Modified"
|
||
msgstr "Modificado"
|
||
|
||
#: lazarusidestrconsts.uemopenfileatcursor
|
||
#, fuzzy
|
||
#| msgid "&Open file at cursor"
|
||
msgid "&Open File at Cursor"
|
||
msgstr "&Abrir archivo en Cursor"
|
||
|
||
#: lazarusidestrconsts.uemprevbookmark
|
||
#, fuzzy
|
||
#| msgid "Goto previous Bookmark"
|
||
msgid "Goto Previous Bookmark"
|
||
msgstr "Ir al Marcador Anterior"
|
||
|
||
#: lazarusidestrconsts.uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr "Salto a procedimiento"
|
||
|
||
#: lazarusidestrconsts.uemreadonly
|
||
msgctxt "lazarusidestrconsts.uemreadonly"
|
||
msgid "Read Only"
|
||
msgstr "Sólo-Lectura"
|
||
|
||
#: lazarusidestrconsts.uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr "Refactorizar"
|
||
|
||
#: lazarusidestrconsts.uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "&Ejecutar hasta el Cursor"
|
||
|
||
#: lazarusidestrconsts.uemsetfreebookmark
|
||
#, fuzzy
|
||
#| msgid "Set a free Bookmark"
|
||
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
||
msgid "Set a Free Bookmark"
|
||
msgstr "Establecer un Marcador Libre"
|
||
|
||
#: lazarusidestrconsts.uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr "Mostrar Números de Línea"
|
||
|
||
#: lazarusidestrconsts.uemsource
|
||
msgctxt "lazarusidestrconsts.uemsource"
|
||
msgid "Source"
|
||
msgstr "Fuente"
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmark
|
||
msgid "&Toggle Bookmark"
|
||
msgstr "&Intercambiar Marcador"
|
||
|
||
#: lazarusidestrconsts.uemtogglebreakpoint
|
||
#, fuzzy
|
||
#| msgid "&Toggle Breakpoint"
|
||
msgid "Toggle &Breakpoint"
|
||
msgstr "Ac&tivar/desactivar Punto de Interrupción"
|
||
|
||
#: lazarusidestrconsts.uemviewcallstack
|
||
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
||
msgid "View Call Stack"
|
||
msgstr "Ver pila(stack) de llamadas"
|
||
|
||
#: lazarusidestrconsts.uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr "No implementado todavía"
|
||
|
||
#: lazarusidestrconsts.uepins
|
||
msgid "INS"
|
||
msgstr "INS"
|
||
|
||
#: lazarusidestrconsts.uepovr
|
||
msgid "OVR"
|
||
msgstr "SOB"
|
||
|
||
#: lazarusidestrconsts.uepreadonly
|
||
msgid "Readonly"
|
||
msgstr "Sólo lectura"
|
||
|
||
#: lazarusidestrconsts.versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr "Información de versión"
|
||
|