mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2026-01-05 20:50:39 +01:00
18680 lines
572 KiB
Plaintext
18680 lines
572 KiB
Plaintext
#
|
||
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: lazaruside\n"
|
||
"Report-Msgid-Bugs-To: \n"
|
||
"POT-Creation-Date: \n"
|
||
"PO-Revision-Date: 2011-02-26 15:24+0100\n"
|
||
"Last-Translator: paul <lesudiste11@gmail.com>\n"
|
||
"Language-Team: français\n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Poedit-Language: French\n"
|
||
"X-Poedit-Country: FRANCE\n"
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgcaptiondisable
|
||
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaptiondisable"
|
||
msgid "Select Groups"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgcaptionenable
|
||
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaptionenable"
|
||
msgid "Select Groups"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
|
||
msgid "Select groups to disable when breakpoint is hit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
|
||
msgid "Select groups to enable when breakpoint is hit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
|
||
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
||
msgid "Use predefined scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetall
|
||
msgid "Reset all settings"
|
||
msgstr "Réinitialiser toutes les préférences"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetgutter
|
||
msgid "Reset all gutter settings"
|
||
msgstr "Réinitialiser tous les paramètres de la gouttière"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresettext
|
||
msgid "Reset all text settings"
|
||
msgstr "Réinitialiser toutes les préférences de texte"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
||
msgid "Add history point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
||
msgid "Context Menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
||
msgid "Jumps to implementation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
||
msgid "Jumps to implementation/other block end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
||
msgid "History back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
||
msgid "History forward"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
||
msgid "Nothing/Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
||
msgid "Continue %0:s (Bound to: %1:s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
||
msgid "Continue %0:s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
||
msgid "Select text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
||
msgid "Select text (Columns)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
||
msgid "Select text (Lines)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
||
msgid "Set free bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
||
msgid "Select current Line (Full)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
||
msgid "Select current Line (Text)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
||
msgid "Select current Paragraph"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
||
msgid "Select current Word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
||
msgid "Reset zoom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplediff
|
||
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
||
msgstr "Cette page ne représente pas vos paramètres courants. Voir la page avancée. Utilisez cette page pour pour réinitialiser les modifications avancées"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
||
msgid "General"
|
||
msgstr "Général"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
||
#, fuzzy
|
||
#| msgid "Standard, All actions (breakpoint, fold) on Mouse down"
|
||
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
||
msgstr "Standard, toutes les actions (point d'arrêt, pliage) sur clic"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
||
#, fuzzy
|
||
#| msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
|
||
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
||
msgstr "Etendu, Actions (point d'arrêt, pliage) sur fin clic. Sélection sur clic et déplacement"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
||
msgid "Gutter"
|
||
msgstr "Gouttière"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
||
msgid "Right mouse includes caret move"
|
||
msgstr "Le clic droit implique le déplacement du curseur"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
||
msgid "Text"
|
||
msgstr "Texte"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectalt
|
||
msgid "Alt-Key sets column mode"
|
||
msgstr "Touche Alt active le mode colonne"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
||
msgid "Alt-Ctrl Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
||
msgid "Alt-Ctrl Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
||
msgid "Alt Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
||
msgid "Alt Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
||
msgid "Ctrl Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
||
msgid "Ctrl Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
||
#, fuzzy
|
||
#| msgid "Drag Selection (copy/paste)"
|
||
msgid "Drag selection (copy/paste)"
|
||
msgstr "Ctrl + souris copie/colle la sélection"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
||
msgid "Extra-1 Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
||
msgid "Extra-2 Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
||
msgid "Alt Double"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
||
msgid "Ctrl Double"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
||
msgid "Double"
|
||
msgstr "Double"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
||
msgid "Shift Double"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
||
msgid "Quad"
|
||
msgstr "Quadruple"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
||
msgid "Triple"
|
||
msgstr "Triple"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
||
msgid "Middle Button"
|
||
msgstr "La bouton du milieu ..."
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
||
msgid "Middle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
||
msgid "Extra 1"
|
||
msgstr "Extra 1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
||
msgid "Extra 2"
|
||
msgstr "Extra 2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
||
msgid "Left 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
||
msgid "Left 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
||
msgid "Right"
|
||
msgstr "Droite"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
||
msgid "Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
||
msgid "Right Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
||
msgid "Shift-Alt-Ctrl Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
||
msgid "Shift-Alt-Ctrl"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
||
msgid "Shift-Alt Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
||
msgid "Shift-Alt Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
||
msgid "Shift-Ctrl Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
||
msgid "Shift-Ctrl Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
||
msgid "Shift Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
||
msgid "Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
||
msgid "Shift Wheel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewarning
|
||
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
||
msgstr "Vous avez des modifications non enregistrées. L'utilisation de cette page annulera les modifications apportées sur la page avancée"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
||
msgid "Scroll horizontal (System speed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
||
msgid "Scroll horizontal (Single line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
||
msgid "Scroll horizontal (Page)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
||
msgid "Scroll horizontal (Half page)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
||
msgid "Scroll horizontal (Page, less one line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
||
msgid "Nothing/Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
||
msgid "Scroll (System speed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
||
msgid "Scroll (Single line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
||
msgid "Scroll (Page)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
||
msgid "Scroll (Half page)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
||
msgid "Scroll (Page, less one line)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
||
msgid "Zoom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfnopredefinedscheme
|
||
msgid "< None >"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfreadonlycolor
|
||
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
||
msgid "Read Only"
|
||
msgstr "Lecture seule"
|
||
|
||
#: lazarusidestrconsts.dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr "Minuscules, première lettre en majuscule"
|
||
|
||
#: lazarusidestrconsts.dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr "Ajouter opérateur d'affectation :="
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
||
#, fuzzy
|
||
msgid "Brackets highlight"
|
||
msgstr "Parenthèses"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
||
msgid "Code folding tree"
|
||
msgstr "Arbre de pliage de code"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdefault
|
||
msgid "Default Text"
|
||
msgstr "Texte par défaut"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
||
msgid "Disabled breakpoint"
|
||
msgstr "Désactiver le point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
||
msgid "Enabled breakpoint"
|
||
msgstr "Activer le point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
||
msgid "Error line"
|
||
msgstr "Erreur ligne"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
||
msgid "Execution point"
|
||
msgstr "point d'exécution"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
||
msgid "Folded code marker"
|
||
msgstr "marqueur de code pliée"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
||
msgid "Global"
|
||
msgstr "Global"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
||
msgid "Gutter"
|
||
msgstr "Gouttière"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
||
msgid "Line"
|
||
msgstr "Ligne"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
||
msgid "Syncron Edit"
|
||
msgstr "Edition synchronisée"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
||
msgid "Template Edit"
|
||
msgstr "Editer le modèle de code"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
||
msgid "Text"
|
||
msgstr "Texte"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
||
msgid "Gutter Separator"
|
||
msgstr "Séparateur de gouttière"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
||
#, fuzzy
|
||
msgid "Incremental others"
|
||
msgstr "Recherche incrémentale"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
||
msgid "Highlight current word"
|
||
msgstr "Mettre en surbrillance le mot courant"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
||
msgid "Incremental search"
|
||
msgstr "Recherche incrémentale"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
||
msgid "Invalid breakpoint"
|
||
msgstr "Point d'arrêt invalide"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
||
msgid "Current line highlight"
|
||
msgstr "surlignage de la ligne en cours"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
||
msgid "Line number"
|
||
msgstr "Numéro de la ligne"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
||
msgid "Modified line"
|
||
msgstr "Lligne modifiée"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
||
#, fuzzy
|
||
msgid "Mouse link"
|
||
msgstr "Style de lien :"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
||
msgid "Selected Area"
|
||
msgstr "Aire sélectionnée"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
||
msgid "Active Cell"
|
||
msgstr "Cellule active"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
||
msgid "Other Cells"
|
||
msgstr "Autres cellules"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr "Cellules synchronisées"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
||
msgid "Active Cell"
|
||
msgstr "Cellule active"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
||
msgid "Other Cells"
|
||
msgstr "Autres cellules"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr "Cellules synchronisées"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
||
msgid "Text block"
|
||
msgstr "bloc de texte"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
||
msgid "Unknown breakpoint"
|
||
msgstr "Point d'arrêt inconnu"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
||
msgid "Word-Brackets"
|
||
msgstr "Mot entre parenthèse"
|
||
|
||
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
||
msgid "Visualized Special Chars"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgadditionalsrcpath
|
||
#, fuzzy
|
||
#| msgid "Additional Source search path for all projects (.pp;.pas)"
|
||
msgid "Additional source search path for all projects (.pp;.pas)"
|
||
msgstr "Répertoire de recherche complémentaire pour tous les projets (.pp;.pas)"
|
||
|
||
#: lazarusidestrconsts.dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "Ajouter un point-virgule"
|
||
|
||
#: lazarusidestrconsts.dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "Ajuster la ligne supérieure au commentaire qui précède"
|
||
|
||
#: lazarusidestrconsts.dlgallfiles
|
||
msgid "All files"
|
||
msgstr "Tous les fichiers"
|
||
|
||
#: lazarusidestrconsts.dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "Alphabétiquement"
|
||
|
||
#: lazarusidestrconsts.dlgalreadyusesallotherunits
|
||
msgid "\"%s\" already uses all the units in this project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
||
msgid "Always visible cursor"
|
||
msgstr "Curseur toujours visible"
|
||
|
||
#: lazarusidestrconsts.dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr "Action sur fichier litigieux :"
|
||
|
||
#: lazarusidestrconsts.dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr "Prévenir à la compilation"
|
||
|
||
#: lazarusidestrconsts.dlgapplicationsettings
|
||
#, fuzzy
|
||
#| msgid "Application Settings"
|
||
msgid "Application settings"
|
||
msgstr "Paramètres de l'application"
|
||
|
||
#: lazarusidestrconsts.dlgassemblerdefault
|
||
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
|
||
msgid "Default"
|
||
msgstr "Valeur par défaut"
|
||
|
||
#: lazarusidestrconsts.dlgassertcode
|
||
#, fuzzy
|
||
#| msgid "Include Assertion Code"
|
||
msgid "Include assertion code"
|
||
msgstr "Inclure le code d'assertion"
|
||
|
||
#: lazarusidestrconsts.dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr "Créer les Fiches automatiquement:"
|
||
|
||
#: lazarusidestrconsts.dlgautocreatenewforms
|
||
msgid "When creating new forms, add them to auto-created forms"
|
||
msgstr "Ajouter les nouvelles fiches à celles créées automatiquement"
|
||
|
||
#: lazarusidestrconsts.dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "Supprimer le fichier automatiquement"
|
||
|
||
#: lazarusidestrconsts.dlgautohidecursor
|
||
msgid "Hide mouse when typing"
|
||
msgstr "Cacher la souris pendant la frappe"
|
||
|
||
#: lazarusidestrconsts.dlgautoindent
|
||
msgctxt "lazarusidestrconsts.dlgautoindent"
|
||
msgid "Auto indent"
|
||
msgstr "Indentation automatique"
|
||
|
||
#: lazarusidestrconsts.dlgautoindentlink
|
||
#, fuzzy
|
||
msgid "(Setup smart indent)"
|
||
msgstr "Indenter jusqu'à"
|
||
|
||
#: lazarusidestrconsts.dlgautoindenttype
|
||
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
||
msgid "Auto indent"
|
||
msgstr "Indentation automatique"
|
||
|
||
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
||
msgid "Auto remove empty methods"
|
||
msgstr "Supprimer automatiquement les méthodes vides"
|
||
|
||
#: lazarusidestrconsts.dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr "Renommer les fichiers en minuscule"
|
||
|
||
#: lazarusidestrconsts.dlgautosave
|
||
#, fuzzy
|
||
#| msgid "Auto save"
|
||
msgid "Auto Save"
|
||
msgstr "Enregistrement automatique"
|
||
|
||
#: lazarusidestrconsts.dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr "Fiches disponibles:"
|
||
|
||
#: lazarusidestrconsts.dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "Arrière-plan"
|
||
|
||
#: lazarusidestrconsts.dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(pas de sous-dossier)"
|
||
|
||
#: lazarusidestrconsts.dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr "Même nom (dans un sous-répertoire)"
|
||
|
||
#: lazarusidestrconsts.dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr "Derrière les méthodes"
|
||
|
||
#: lazarusidestrconsts.dlgblockgroupoptions
|
||
#, fuzzy
|
||
#| msgid "Selection:"
|
||
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
||
msgid "Selection"
|
||
msgstr "Sélection :"
|
||
|
||
#: lazarusidestrconsts.dlgblockindent
|
||
#, fuzzy
|
||
#| msgid "Block indent"
|
||
msgid "Block indent (spaces)"
|
||
msgstr "Indentation de bloc"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttype
|
||
#, fuzzy
|
||
msgid "Indent method"
|
||
msgstr "Sauts"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypecopy
|
||
msgid "Space/tab as prev Line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypepos
|
||
msgid "Position only"
|
||
msgstr "Position seulement"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypespace
|
||
msgid "Spaces"
|
||
msgstr "Espaces"
|
||
|
||
#: lazarusidestrconsts.dlgblocktabindent
|
||
msgid "Block indent (tabs)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbp7cptb
|
||
#, fuzzy
|
||
#| msgid "TP/BP 7.0 Compatible"
|
||
msgid "TP/BP 7.0 compatible"
|
||
msgstr "Compatibilité TP/BP 7.0"
|
||
|
||
#: lazarusidestrconsts.dlgbrackethighlight
|
||
msgid "Bracket highlight"
|
||
msgstr "Parenthèses"
|
||
|
||
#: lazarusidestrconsts.dlgbracketmatchgroup
|
||
msgid "Matching bracket pairs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbrowsemsgfilter
|
||
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
|
||
msgstr "Fichier des messages du compilateur Pascal (*.msg)|*.msg|Any Files (*.*)|*.*"
|
||
|
||
#: lazarusidestrconsts.dlgbuildmodes
|
||
msgid "Build Modes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbutapply
|
||
msgid "Apply"
|
||
msgstr "Appliquer"
|
||
|
||
#: lazarusidestrconsts.dlgcancel
|
||
msgctxt "lazarusidestrconsts.dlgcancel"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: lazarusidestrconsts.dlgcasesensitive
|
||
#, fuzzy
|
||
#| msgid "&Case Sensitive"
|
||
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
||
msgid "&Case sensitive"
|
||
msgstr "&Sensible à la casse"
|
||
|
||
#: lazarusidestrconsts.dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr "Vérification des options du compilateur"
|
||
|
||
#: lazarusidestrconsts.dlgccoresults
|
||
msgid "Results"
|
||
msgstr "Résultats"
|
||
|
||
#: lazarusidestrconsts.dlgccotest
|
||
msgctxt "lazarusidestrconsts.dlgccotest"
|
||
msgid "Test"
|
||
msgstr "Test"
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr "Test : Vérification compilateur ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr "Test : Vérification de la configuration du compilateur ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
|
||
msgid "Test: Checking fpc configs ..."
|
||
msgstr "Test : Vérification de la configuration fpc ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr "Test : Vérification de la date du compilateur ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr "Test : Compilation d'un fichier vide ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestmissingppu
|
||
msgid "Test: Checking missing fpc ppu ..."
|
||
msgstr "Test : Vérification ppu fpc manquante ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr "Test : Vérification des sources dans le chemin de recherche ppu fpc ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr "Test : Compilation d'un fichier vide"
|
||
|
||
#: lazarusidestrconsts.dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr "Ordre des classes"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "Fin"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr "minuscules"
|
||
|
||
#: lazarusidestrconsts.dlgcdtpreview
|
||
#, fuzzy
|
||
#| msgid "Preview (Max line length = 1)"
|
||
msgid "Preview (max line length = 1)"
|
||
msgstr "Aperçu (longueur de ligne max. = 1)"
|
||
|
||
#: lazarusidestrconsts.dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr "Préfixe \"Read\""
|
||
|
||
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr "Suffixe stocké"
|
||
|
||
#: lazarusidestrconsts.dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr "MAJUSCULE"
|
||
|
||
#: lazarusidestrconsts.dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr "Préfixe des champs"
|
||
|
||
#: lazarusidestrconsts.dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr "Préfixe \"Write\""
|
||
|
||
#: lazarusidestrconsts.dlgcentercursorline
|
||
#, fuzzy
|
||
#| msgid "Center Cursor Line"
|
||
msgid "Center cursor line"
|
||
msgstr "Centrer sur la ligne du curseur"
|
||
|
||
#: lazarusidestrconsts.dlgcharcasefileact
|
||
msgid "Save As - auto rename pascal files lower case"
|
||
msgstr "Enregistrer sous - renommer les fichiers pascal en minuscules"
|
||
|
||
#: lazarusidestrconsts.dlgcheckconsistency
|
||
msgid "Check consistency"
|
||
msgstr "Vérifier la cohérence"
|
||
|
||
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
||
msgid "Check packages on form create"
|
||
msgstr "Vérifier les paquets à la création de la fiche"
|
||
|
||
#: lazarusidestrconsts.dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr "Choisissez le fichier de modèle de code (*.dci)"
|
||
|
||
#: lazarusidestrconsts.dlgclassinsertpolicy
|
||
msgid "Class part insert policy"
|
||
msgstr "Politique d'insertion de portion de classe"
|
||
|
||
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr "Afficher les boutons fermer dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts.dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr "Profils des couleurs"
|
||
|
||
#: lazarusidestrconsts.dlgcmacro
|
||
#, fuzzy
|
||
#| msgid "C Style Macros (global)"
|
||
msgid "C style macros (global)"
|
||
msgstr "Macros de style C (globales)"
|
||
|
||
#: lazarusidestrconsts.dlgcoansistr
|
||
#, fuzzy
|
||
#| msgid "Use Ansi Strings"
|
||
msgid "Use ansi strings"
|
||
msgstr "Utiliser les chaînes ANSI"
|
||
|
||
#: lazarusidestrconsts.dlgcoasis
|
||
msgid "As-Is"
|
||
msgstr "Tel quel"
|
||
|
||
#: lazarusidestrconsts.dlgcoasmstyle
|
||
msgid "Assembler style:"
|
||
msgstr "Style d'assembleur :"
|
||
|
||
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
||
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
||
msgid "Messages"
|
||
msgstr "Messages"
|
||
|
||
#: lazarusidestrconsts.dlgcochecks
|
||
#, fuzzy
|
||
#| msgid "Checks:"
|
||
msgid "Checks"
|
||
msgstr "Contrôles :"
|
||
|
||
#: lazarusidestrconsts.dlgcocompilation
|
||
msgid "Compilation"
|
||
msgstr "Compilation"
|
||
|
||
#: lazarusidestrconsts.dlgcoconditionals
|
||
msgctxt "lazarusidestrconsts.dlgcoconditionals"
|
||
msgid "Conditionals"
|
||
msgstr "expressions conditionnelles"
|
||
|
||
#: lazarusidestrconsts.dlgcocops
|
||
#, fuzzy
|
||
#| msgid "C Style Operators (*=, +=, /= and -=)"
|
||
msgid "C style operators (*=, +=, /= and -=)"
|
||
msgstr "Opérateurs de style C (*=, +=, /= et -=)"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatechildnode
|
||
msgid "Create child node"
|
||
msgstr "Créer un nœud fils"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatemakefile
|
||
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Créer le Makefile"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatenodeabove
|
||
msgid "Create node above"
|
||
msgstr "Créer un noeud au-dessus"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatenodebelow
|
||
msgid "Create node below"
|
||
msgstr "Créer un noeud au-dessous"
|
||
|
||
#: lazarusidestrconsts.dlgcodbx
|
||
#, fuzzy
|
||
#| msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
||
msgid "Generate debugging info for DBX (slows compiling)"
|
||
msgstr "Générer des infos pour le débogueur DBX (ralentit la compilation)"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugging
|
||
#, fuzzy
|
||
#| msgid "Debugging Info"
|
||
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
||
msgid "Debugging info"
|
||
msgstr "Déboguage :"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugging2
|
||
#, fuzzy
|
||
#| msgid "Debugging:"
|
||
msgctxt "lazarusidestrconsts.dlgcodebugging2"
|
||
msgid "Debugging"
|
||
msgstr "Déboguage :"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "Ajout d'un chemin au débogueur (aucun):"
|
||
|
||
#: lazarusidestrconsts.dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr "Création de code"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenableboth
|
||
msgid "Both"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenablefold
|
||
msgid "Fold"
|
||
msgstr "Plier"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenablehide
|
||
msgid "Hide"
|
||
msgstr "Masquer"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldingmouse
|
||
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
|
||
msgid "Mouse"
|
||
msgstr "Souris"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
||
msgid "Reverse fold-order in Popup"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcodegeneration
|
||
#, fuzzy
|
||
#| msgid "Code generation"
|
||
msgid "Code Generation"
|
||
msgstr "Code"
|
||
|
||
#: lazarusidestrconsts.dlgcodetoolsopts
|
||
msgid "CodeTools Options"
|
||
msgstr "Options des Outils de code"
|
||
|
||
#: lazarusidestrconsts.dlgcofast
|
||
#, fuzzy
|
||
#| msgid "Faster Code"
|
||
msgid "Faster code"
|
||
msgstr "Code plus rapide"
|
||
|
||
#: lazarusidestrconsts.dlgcogdb
|
||
#, fuzzy
|
||
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
|
||
msgid "Generate debugging info for GDB (slower / increases exe-size)"
|
||
msgstr "Générer des infos pour le débogueur GDB (ralentit la compilation)"
|
||
|
||
#: lazarusidestrconsts.dlgcoheaptrc
|
||
#, fuzzy
|
||
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
|
||
msgid "Use Heaptrc unit (check for mem-leaks)"
|
||
msgstr "Utiliser l'unité \"Heaptrc\""
|
||
|
||
#: lazarusidestrconsts.dlgcoincfiles
|
||
#, fuzzy
|
||
#| msgid "Include Files (-Fi):"
|
||
msgid "Include files (-Fi):"
|
||
msgstr "Inclusion des fichiers (-Fi) :"
|
||
|
||
#: lazarusidestrconsts.dlgcoinherited
|
||
msgctxt "lazarusidestrconsts.dlgcoinherited"
|
||
msgid "Inherited"
|
||
msgstr "Hérité"
|
||
|
||
#: lazarusidestrconsts.dlgcokeepvarsreg
|
||
msgid "Keep certain variables in registers"
|
||
msgstr "Préserver certaines variables dans les registres"
|
||
|
||
#: lazarusidestrconsts.dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr "Librairies (-Fl):"
|
||
|
||
#: lazarusidestrconsts.dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "Edition des liens"
|
||
|
||
#: lazarusidestrconsts.dlgcoloadsave
|
||
msgid "Load/Save"
|
||
msgstr "Charger/Enregistrer"
|
||
|
||
#: lazarusidestrconsts.dlgcolor
|
||
msgid "Color"
|
||
msgstr "Couleur"
|
||
|
||
#: lazarusidestrconsts.dlgcolorexportbutton
|
||
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
|
||
msgid "Export"
|
||
msgstr "Exporter"
|
||
|
||
#: lazarusidestrconsts.dlgcolorlink
|
||
msgid "(Edit Color)"
|
||
msgstr "(Modifie la couleur)"
|
||
|
||
#: lazarusidestrconsts.dlgcolornotmodified
|
||
msgid "Not modified"
|
||
msgstr "non modifié"
|
||
|
||
#: lazarusidestrconsts.dlgcolors
|
||
msgctxt "lazarusidestrconsts.dlgcolors"
|
||
msgid "Colors"
|
||
msgstr "Couleurs"
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparameters
|
||
msgid "Command line parameters"
|
||
msgstr "Paramètres de ligne de commande"
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr "Paramètres de la ligne de commande (sans le nom de l'application)"
|
||
|
||
#: lazarusidestrconsts.dlgcomovedown
|
||
msgid "Move down"
|
||
msgstr "Descendre"
|
||
|
||
#: lazarusidestrconsts.dlgcomoveleveldown
|
||
msgid "Move level down"
|
||
msgstr "Déplacer d'un niveau vers le bas"
|
||
|
||
#: lazarusidestrconsts.dlgcomovelevelup
|
||
msgid "Move level up"
|
||
msgstr "Déplacer d'un niveau vers le haut"
|
||
|
||
#: lazarusidestrconsts.dlgcomoveup
|
||
msgid "Move up"
|
||
msgstr "Monter"
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessage
|
||
#, fuzzy
|
||
#| msgid "Compiler Messages"
|
||
msgid "Compiler messages"
|
||
msgstr "Messages du compilateur"
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessages
|
||
msgid "Compiler messages language file"
|
||
msgstr "fichier de langue des messages du compilateur"
|
||
|
||
#: lazarusidestrconsts.dlgcompileroptions
|
||
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
||
msgid "Compiler Options"
|
||
msgstr "Options du compilateur"
|
||
|
||
#: lazarusidestrconsts.dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr "Compléter les propriétés"
|
||
|
||
#: lazarusidestrconsts.dlgconfigfiles
|
||
#, fuzzy
|
||
#| msgid "Config Files:"
|
||
msgid "Config files"
|
||
msgstr "Fichiers de configuration:"
|
||
|
||
#: lazarusidestrconsts.dlgconormal
|
||
#, fuzzy
|
||
#| msgid "Normal Code"
|
||
msgid "Normal code"
|
||
msgstr "Code normal"
|
||
|
||
#: lazarusidestrconsts.dlgcoopts
|
||
msgid "Options: "
|
||
msgstr "Options : "
|
||
|
||
#: lazarusidestrconsts.dlgcoother
|
||
msgctxt "lazarusidestrconsts.dlgcoother"
|
||
msgid "Other"
|
||
msgstr "Autre"
|
||
|
||
#: lazarusidestrconsts.dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr "Débordement"
|
||
|
||
#: lazarusidestrconsts.dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr "Analyse"
|
||
|
||
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
||
msgid "Copy/Paste with fold info"
|
||
msgstr "Copier/coller avec infos de pliage"
|
||
|
||
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr "Copier le mot si rien à copier"
|
||
|
||
#: lazarusidestrconsts.dlgcorange
|
||
msgid "Range"
|
||
msgstr "Intervalle"
|
||
|
||
#: lazarusidestrconsts.dlgcorelocatable
|
||
msgid "Relocatable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcoshowerr
|
||
#, fuzzy
|
||
#| msgid "Show Errors"
|
||
msgid "Show errors"
|
||
msgstr "Affiche les erreurs"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowoptions
|
||
#| msgid "Show Options"
|
||
msgid "&Show Options"
|
||
msgstr "&Afficher les options"
|
||
|
||
#: lazarusidestrconsts.dlgcosmaller
|
||
#, fuzzy
|
||
#| msgid "Smaller Code"
|
||
msgid "Smaller code"
|
||
msgstr "Code plus petit"
|
||
|
||
#: lazarusidestrconsts.dlgcosmartlinkable
|
||
#, fuzzy
|
||
#| msgid "Smart Linkable"
|
||
msgid "Smart linkable"
|
||
msgstr "Table des liens intelligente"
|
||
|
||
#: lazarusidestrconsts.dlgcosources
|
||
#, fuzzy
|
||
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr "Autres sources (fichiers .pp/.pas; utilisé seulement par l'EDI, pas par le compilateur)"
|
||
|
||
#: lazarusidestrconsts.dlgcostack
|
||
msgid "Stack"
|
||
msgstr "Pile"
|
||
|
||
#: lazarusidestrconsts.dlgcostrip
|
||
#, fuzzy
|
||
#| msgid "Strip Symbols From Executable"
|
||
msgid "Strip symbols from executable"
|
||
msgstr "Eliminer les symboles de l'exécutable"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltype
|
||
msgid "Choose type of debug info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypeauto
|
||
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
||
msgid "Automatic"
|
||
msgstr "Automatique"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
||
msgid "Dwarf2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
||
msgid "Dwarf with sets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
||
msgid "Dwarf3 (beta)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypestabs
|
||
msgid "Stabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcounitstyle
|
||
#, fuzzy
|
||
#| msgid "Unit Style"
|
||
msgid "Unit style"
|
||
msgstr "Style de l'unité"
|
||
|
||
#: lazarusidestrconsts.dlgcouseasdefault
|
||
msgid "Use these compiler options as default for new projects"
|
||
msgstr "Utilisez ces options du compilateur par défaut pour les nouveaux projets"
|
||
|
||
#: lazarusidestrconsts.dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr "Générer le code pour valgrind"
|
||
|
||
#: lazarusidestrconsts.dlgcoverbosity
|
||
msgid "Verbosity"
|
||
msgstr "faire des commentaires"
|
||
|
||
#: lazarusidestrconsts.dlgcppinline
|
||
#, fuzzy
|
||
#| msgid "C++ Styled INLINE"
|
||
msgid "C++ styled INLINE"
|
||
msgstr "INLINE style C++"
|
||
|
||
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
|
||
msgid "Ctrl-middle-click on tab closes all others"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr "Curseur au-delà de la fin de ligne"
|
||
|
||
#: lazarusidestrconsts.dlgcursorgroupoptions
|
||
#, fuzzy
|
||
#| msgid "Cursor:"
|
||
msgid "Cursor"
|
||
msgstr "Curseur :"
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipsselection
|
||
msgid "Cursor skips selection"
|
||
msgstr "Le curseur saute la sélection"
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipstab
|
||
msgid "Cursor skips tabs"
|
||
msgstr "Curseur saute les tabulations"
|
||
|
||
#: lazarusidestrconsts.dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr "Extension utilisateur (.pp.xxx)"
|
||
|
||
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr "Editeur de chemin"
|
||
|
||
#: lazarusidestrconsts.dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr "Type de débogueur et chemin"
|
||
|
||
#: lazarusidestrconsts.dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr "Fonte par défaut pour l'éditeur"
|
||
|
||
#: lazarusidestrconsts.dlgdefvaluecolor
|
||
msgid "Default Value"
|
||
msgstr "Valeur par défaut"
|
||
|
||
#: lazarusidestrconsts.dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr "Supprimer le modèle de code"
|
||
|
||
#: lazarusidestrconsts.dlgdeplhicomp
|
||
#, fuzzy
|
||
#| msgid "Delphi Compatible"
|
||
msgid "Delphi compatible"
|
||
msgstr "Compatible Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgdesktop
|
||
msgid "Desktop"
|
||
msgstr "Bureau"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopbuttons
|
||
msgid "Buttons - "
|
||
msgstr "Boutons -"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopfiles
|
||
#, fuzzy
|
||
#| msgid "Desktop files"
|
||
msgid "Desktop Files"
|
||
msgstr "Fichiers du bureauu"
|
||
|
||
#: lazarusidestrconsts.dlgdesktophints
|
||
msgid "Hints"
|
||
msgstr "Conseils"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmenus
|
||
msgid "Menus - "
|
||
msgstr "Menus - "
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmisc
|
||
msgid "Misc Options"
|
||
msgstr "Options diverses"
|
||
|
||
#: lazarusidestrconsts.dlgdirection
|
||
msgid "Direction"
|
||
msgstr "Sens"
|
||
|
||
#: lazarusidestrconsts.dlgdirectorydoesnotexist
|
||
msgid "Directory does not exist"
|
||
msgstr "Le répertoire n'existe pas"
|
||
|
||
#: lazarusidestrconsts.dlgdisableantialiasing
|
||
msgid "Disable anti-aliasing"
|
||
msgstr "Désactiver l'anti-crénelage"
|
||
|
||
#: lazarusidestrconsts.dlgdividercolordefault
|
||
msgid "Use right margin color"
|
||
msgstr "Utilisez la couleur de la marge de droite"
|
||
|
||
#: lazarusidestrconsts.dlgdividerdrawdepth
|
||
#, fuzzy
|
||
msgid "Draw divider level"
|
||
msgstr "Niveau 2 (niveau 1 + optimisations rapide)"
|
||
|
||
#: lazarusidestrconsts.dlgdividernestcolor
|
||
msgid "Nested line color"
|
||
msgstr "couleurs de ligne imbriquées"
|
||
|
||
#: lazarusidestrconsts.dlgdivideronoff
|
||
#, fuzzy
|
||
msgid "Draw divider"
|
||
msgstr "Dessin des séparateurs"
|
||
|
||
#: lazarusidestrconsts.dlgdividertopcolor
|
||
msgid "Line color"
|
||
msgstr "Couleur de ligne"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasbeginendname
|
||
msgid "Begin/End"
|
||
msgstr "Begin/End"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasprocedurename
|
||
msgid "Procedure/Function"
|
||
msgstr "Procedure/Function"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
||
msgid "Class/Struct"
|
||
msgstr "Class/Struct"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
||
msgid "Class/Struct (local)"
|
||
msgstr "Class/Struct (local)"
|
||
|
||
#: lazarusidestrconsts.dlgdivpastryname
|
||
msgid "Try/Except"
|
||
msgstr "Try/Except"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
||
msgid "Unit sections"
|
||
msgstr "divisions de l'unité"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasusesname
|
||
msgid "Uses clause"
|
||
msgstr "clause Uses"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
||
msgid "Var/Type"
|
||
msgstr "Var/Type"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
||
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
||
msgid "Var/Type (local)"
|
||
msgstr "Var/Type (local)"
|
||
|
||
#: lazarusidestrconsts.dlgdownword
|
||
msgctxt "lazarusidestrconsts.dlgdownword"
|
||
msgid "Down"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts.dlgedadd
|
||
#, fuzzy
|
||
#| msgid "Add..."
|
||
msgid "Add ..."
|
||
msgstr "Ajouter"
|
||
|
||
#: lazarusidestrconsts.dlgedback
|
||
msgid "Back"
|
||
msgstr "Retour"
|
||
|
||
#: lazarusidestrconsts.dlgedbold
|
||
msgid "Bold"
|
||
msgstr "Gras"
|
||
|
||
#: lazarusidestrconsts.dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr "Sous-répertoire"
|
||
|
||
#: lazarusidestrconsts.dlgedcodetempl
|
||
#, fuzzy
|
||
#| msgid "Code templates"
|
||
msgid "Code Templates"
|
||
msgstr "Modèles de code"
|
||
|
||
#: lazarusidestrconsts.dlgedcompleteblocks
|
||
msgid "Add close statement for pascal blocks"
|
||
msgstr "Ajoute close aux blocs en pascal"
|
||
|
||
#: lazarusidestrconsts.dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr "Extension utilisateur"
|
||
|
||
#: lazarusidestrconsts.dlgeddelay
|
||
msgid "Delay"
|
||
msgstr "Délai"
|
||
|
||
#: lazarusidestrconsts.dlgeddelayinsec
|
||
msgid "(%s sec delay)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeddelete
|
||
msgctxt "lazarusidestrconsts.dlgeddelete"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: lazarusidestrconsts.dlgeddisplay
|
||
msgid "Display"
|
||
msgstr "Affichage"
|
||
|
||
#: lazarusidestrconsts.dlgededit
|
||
#, fuzzy
|
||
#| msgid "Edit..."
|
||
msgid "Edit ..."
|
||
msgstr "Editer"
|
||
|
||
#: lazarusidestrconsts.dlgedfiles
|
||
#, fuzzy
|
||
#| msgid "Editor files"
|
||
msgid "Editor Files"
|
||
msgstr "Editeur de fichiers"
|
||
|
||
#: lazarusidestrconsts.dlgedidcomlet
|
||
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
||
msgid "Identifier completion"
|
||
msgstr "Compléter l'identificateur"
|
||
|
||
#: lazarusidestrconsts.dlgedinvert
|
||
msgid "Invert"
|
||
msgstr "Inverser"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
||
msgid "Ignore Locks, use longest unused editor"
|
||
msgstr "Ignore les vérouillages, utilise le plus long éditeur non utilisé"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
||
msgid "Ignore Locks, if editor is current"
|
||
msgstr "Ignore les vérouillages, si l'éditeur est celui en cours"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
||
msgid "Ignore Locks, if editor in current window"
|
||
msgstr "Ignore les vérouillages, si l'éduteur est la fenêtre en cours"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
||
msgid "Locked, if text in view"
|
||
msgstr "Verrouillé, si le texte en vue"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
||
msgid "Unlocked"
|
||
msgstr "Dévérouillé"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
||
msgid "Unlocked, if text in centered view"
|
||
msgstr "Débloqué, si le texte en vue centré"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
||
msgid "New tab, existing or new window"
|
||
msgstr "Nouvel onglet,nouvelle fenêtre ou existante"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
||
msgid "New tab in new window"
|
||
msgstr "Nouvel onglet dans nouvelle fenêtre"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
||
msgid "New tab in existing window"
|
||
msgstr "Nouvel onglet dans la fenêtre existante"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
||
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
||
msgstr "Cette option utilise le plus long éditeur non utilisé pour le fichier, même s'il est verrouillé et/ou a besoins de défilement. La détermination du plus long éditeur non utilisé ne regarde pas l'ordre dans lequel les fenêtre ont reçu le focus, même si c'est le jeux avec le paramètre pour \"même critère d'ordre\". Cette option va toujours reussirr, d'autres options ne sont jamais testés."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
||
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
||
msgstr "Cette option va vérifier si l'éditeur actif en cours a le fichier cible et si c'est le cas, il va utiliser l'éditeur en cours, même s'il est vérouillé et/ou a besoin de défiler."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
||
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
||
msgstr "Cette option va vérifier s'il y a un éditeur pour le fichier cible dans la fenêtre en cours et si il y est, il utilisera cet éditeur, même s'il est vérouillé et/ou a besoin de défiler."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
||
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
||
msgstr "Cette option va utiliser un éditeur vérouillé(et seulement vérouillé), lequel n'a pas besoin de défiler dans le but d'afficher le point de saut cible(le point de saut "
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
||
msgid "This option will use any not locked Editor."
|
||
msgstr "Cette option utilisera n'importe quel éditeur non vérouillé."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
||
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
||
msgstr "Cette option n'utilisera pas un éditeur vérouillé, lequel n'a pas besoin de défiler dans le but d'afficher le point de saut cible(le point de saut cible est déjà dans la zone centre de l'écran visible, excluant 2-5 lignes en haut/bas)."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
||
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
||
msgstr "Cette option va ouvrir un nouvel onglet dans une fenêtre existante ou nouvelle, si aucun onglet dévérouillé est trouvé. Cette option va toujours réussir, les options supplémentaires ne sont jamais testées."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
||
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
||
msgstr "Si aucun onglet dévérouillé est trouvé, alors cette option va ouvrir un nouvel onglet dans une nouvelle fenêtre(même si d'autres fenêtres existantes pourraient être utilisées pour le nouvel onglet). Cette option va toujours réussir, des options supplémentaires ne sont jamais testées."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
||
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
|
||
msgstr "Si aucun onglet dévérouillé est trouvé, alors cette option va ouvrir un nouvel onglet dans une fenêtre existante(et seulement dans une existante). Un onglet est seulement ouvert si une fenêtre existe, cela n'a pas encore d'éditeur pour le fichier cible."
|
||
|
||
#: lazarusidestrconsts.dlgedital
|
||
msgid "Italic"
|
||
msgstr "Italique"
|
||
|
||
#: lazarusidestrconsts.dlgeditorfont
|
||
msgid "Editor font"
|
||
msgstr "Fonte de l'éditeur"
|
||
|
||
#: lazarusidestrconsts.dlgeditorfontsize
|
||
msgid "Editor font size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgeditoroptions
|
||
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
||
msgid "Editor options"
|
||
msgstr "Options de l'éditeur"
|
||
|
||
#: lazarusidestrconsts.dlgeditschemdefaults
|
||
#, fuzzy
|
||
msgid "Scheme globals"
|
||
msgstr "Profils des couleurs"
|
||
|
||
#: lazarusidestrconsts.dlgedmisc
|
||
msgid "Misc"
|
||
msgstr "Divers"
|
||
|
||
#: lazarusidestrconsts.dlgednoerr
|
||
msgid "No errors in key mapping found."
|
||
msgstr "Pas d'erreurs trouvées dans l'assignation des touches"
|
||
|
||
#: lazarusidestrconsts.dlgedoff
|
||
msgid "Off"
|
||
msgstr "Off"
|
||
|
||
#: lazarusidestrconsts.dlgedon
|
||
msgid "On"
|
||
msgstr "On"
|
||
|
||
#: lazarusidestrconsts.dlgedunder
|
||
msgid "Underline"
|
||
msgstr "Souligner"
|
||
|
||
#: lazarusidestrconsts.dlgelementattributes
|
||
msgid "Element Attributes"
|
||
msgstr "Attributs des éléments"
|
||
|
||
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
||
msgid "End key jumps to nearest end"
|
||
msgstr "Touche Fin va à la fin la plus proche"
|
||
|
||
#: lazarusidestrconsts.dlgenvask
|
||
msgid "Ask"
|
||
msgstr "Demander"
|
||
|
||
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr "Note : les fichiers du projet sont tous ceux figurant dans son répertoire"
|
||
|
||
#: lazarusidestrconsts.dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "Sauvegarde"
|
||
|
||
#: lazarusidestrconsts.dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "Fichiers"
|
||
|
||
#: lazarusidestrconsts.dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "Grille"
|
||
|
||
#: lazarusidestrconsts.dlgenvlanguage
|
||
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
||
msgid "Language"
|
||
msgstr "Langue"
|
||
|
||
#: lazarusidestrconsts.dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr "Lignes directrices"
|
||
|
||
#: lazarusidestrconsts.dlgenvmisc
|
||
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Divers"
|
||
|
||
#: lazarusidestrconsts.dlgenvnone
|
||
msgctxt "lazarusidestrconsts.dlgenvnone"
|
||
msgid "None"
|
||
msgstr "Aucun"
|
||
|
||
#: lazarusidestrconsts.dlgenvotherfiles
|
||
#, fuzzy
|
||
#| msgid "Other files"
|
||
msgid "Other Files"
|
||
msgstr "Autres fichiers"
|
||
|
||
#: lazarusidestrconsts.dlgenvproject
|
||
msgid "Project"
|
||
msgstr "Projet"
|
||
|
||
#: lazarusidestrconsts.dlgenvtype
|
||
msgctxt "lazarusidestrconsts.dlgenvtype"
|
||
msgid "Type"
|
||
msgstr "Type"
|
||
|
||
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
|
||
msgid "Focus messages after compilation"
|
||
msgstr "Focus sur la fenêtre de messages après compilation"
|
||
|
||
#: lazarusidestrconsts.dlgextracharspacing
|
||
msgid "Extra char spacing"
|
||
msgstr "Espace entre les caractères"
|
||
|
||
#: lazarusidestrconsts.dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr "Interligne supplémentaire"
|
||
|
||
#: lazarusidestrconsts.dlgextsymb
|
||
msgid "Use external gdb debug symbols file"
|
||
msgstr "Utilisez un fichier de symboles de débogage externe pour gdb"
|
||
|
||
#: lazarusidestrconsts.dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr "Extensions de fichier"
|
||
|
||
#: lazarusidestrconsts.dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr "Chercher le texte sous le curseur"
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunk
|
||
msgid "Chunk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunksect
|
||
#, fuzzy
|
||
msgid "Chunk section"
|
||
msgstr "Section Resourcestring :"
|
||
|
||
#: lazarusidestrconsts.dlgfolddifffile
|
||
msgctxt "lazarusidestrconsts.dlgfolddifffile"
|
||
msgid "File"
|
||
msgstr "Fichier"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlasp
|
||
msgid "ASP"
|
||
msgstr "ASP"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
||
msgid "Comment"
|
||
msgstr "Commentaire"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
||
msgid "Node"
|
||
msgstr "Noeud"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmitem
|
||
msgid "Item"
|
||
msgstr "élément"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmlist
|
||
msgid "List <>"
|
||
msgstr "Liste <>"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmobject
|
||
#, fuzzy
|
||
msgid "Object (inherited, inline)"
|
||
msgstr "Copie depuis hérité "
|
||
|
||
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
||
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
||
msgid "Var/Type (local)"
|
||
msgstr "Var/Type (local)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasansicomment
|
||
msgid "Comment (* *)"
|
||
msgstr "Commentaire (* *)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasasm
|
||
msgid "Asm"
|
||
msgstr "Asm"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasbeginend
|
||
msgid "Begin/End (nested)"
|
||
msgstr "Begin/End (imbriqué)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasborcomment
|
||
msgid "Comment { }"
|
||
msgstr "Commentaire { }"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpascase
|
||
msgid "Case"
|
||
msgstr "Case"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclass
|
||
msgid "Class/Object"
|
||
msgstr "Class/Object"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclasssection
|
||
msgid "public/private"
|
||
msgstr "public/private"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasexcept
|
||
msgid "Except/Finally"
|
||
msgstr "Except/Finally"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifdef
|
||
msgid "{$IfDef}"
|
||
msgstr "{$IfDef}"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
||
msgid "Nested Comment"
|
||
msgstr "Commentaires imbriqués"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
||
msgid "Begin/End (procedure)"
|
||
msgstr "Begin/End (procedure)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocedure
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Procédure"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprogram
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
||
msgid "Program"
|
||
msgstr "Programme"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrecord
|
||
msgid "Record"
|
||
msgstr "Enregistrement"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrepeat
|
||
msgid "Repeat"
|
||
msgstr "Repeat"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
||
msgid "Comment //"
|
||
msgstr "Commentaire //"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpastry
|
||
msgid "Try"
|
||
msgstr "Try"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunit
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
||
msgid "Unit"
|
||
msgstr "Unité"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunitsection
|
||
msgid "Unit section"
|
||
msgstr "Section Unit"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuserregion
|
||
msgid "{%Region}"
|
||
msgstr "{%Region}"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuses
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
||
msgid "Uses"
|
||
msgstr "Uses"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasvartype
|
||
msgid "Var/Type (global)"
|
||
msgstr "Var/Type (global)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcdata
|
||
msgid "CData"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
||
msgid "Comment"
|
||
msgstr "Commentaire"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmldoctype
|
||
msgid "DocType"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
||
msgid "Node"
|
||
msgstr "Noeud"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlprocess
|
||
msgid "Processing Instruction"
|
||
msgstr "Instruction de traitement"
|
||
|
||
#: lazarusidestrconsts.dlgforecolor
|
||
msgid "Foreground"
|
||
msgstr "Couleur d'avant-plan"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr "Politique d'insertion de procédure"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr "Préserver l'ordre des procédures"
|
||
|
||
#: lazarusidestrconsts.dlgfpcpath
|
||
msgid "Compiler path (e.g. %s)"
|
||
msgstr "Chemin du compilateur (%s)"
|
||
|
||
#: lazarusidestrconsts.dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr "Répertoire des sources de FPC"
|
||
|
||
#: lazarusidestrconsts.dlgframecolor
|
||
#, fuzzy
|
||
#| msgid "Frame color"
|
||
msgid "Text-mark"
|
||
msgstr "Couleur de cadre"
|
||
|
||
#: lazarusidestrconsts.dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "Editeur de fiches"
|
||
|
||
#: lazarusidestrconsts.dlgfrombeginning
|
||
msgid "From b&eginning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfromcursor
|
||
#, fuzzy
|
||
#| msgid "&From Cursor"
|
||
msgid "&From cursor"
|
||
msgstr "&Depuis le curseur"
|
||
|
||
#: lazarusidestrconsts.dlgfropts
|
||
msgctxt "lazarusidestrconsts.dlgfropts"
|
||
msgid "Options"
|
||
msgstr "Options"
|
||
|
||
#: lazarusidestrconsts.dlggetposition
|
||
msgid "Get position"
|
||
msgstr "Lire la position"
|
||
|
||
#: lazarusidestrconsts.dlgglobal
|
||
msgid "&Global"
|
||
msgstr "&Global"
|
||
|
||
#: lazarusidestrconsts.dlggpccomp
|
||
#, fuzzy
|
||
#| msgid "GPC (GNU Pascal Compiler) Compatible"
|
||
msgid "GPC (GNU Pascal Compiler) compatible"
|
||
msgstr "Compatibilité GPC (GNU Pascal Compiler)"
|
||
|
||
#: lazarusidestrconsts.dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr "Générer du code pour gprof"
|
||
|
||
#: lazarusidestrconsts.dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr "Couleur d'accroches"
|
||
|
||
#: lazarusidestrconsts.dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr "Couleur de la grille"
|
||
|
||
#: lazarusidestrconsts.dlggridx
|
||
msgid "Grid size X"
|
||
msgstr "Taille de grille X"
|
||
|
||
#: lazarusidestrconsts.dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr "Espacement horizontal de la grille"
|
||
|
||
#: lazarusidestrconsts.dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr "Taille de grille Y"
|
||
|
||
#: lazarusidestrconsts.dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr "Espacement vertical de la grille"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodeexplorer
|
||
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorateur de code"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodetools
|
||
msgid "Codetools"
|
||
msgstr "Outils de code"
|
||
|
||
#: lazarusidestrconsts.dlggroupdebugger
|
||
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Débogueur"
|
||
|
||
#: lazarusidestrconsts.dlggroupeditor
|
||
msgid "Editor"
|
||
msgstr "Editeur"
|
||
|
||
#: lazarusidestrconsts.dlggroupenvironment
|
||
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
||
msgid "Environment"
|
||
msgstr "Environnement"
|
||
|
||
#: lazarusidestrconsts.dlggrouphelp
|
||
msgctxt "lazarusidestrconsts.dlggrouphelp"
|
||
msgid "Help"
|
||
msgstr "Aide"
|
||
|
||
#: lazarusidestrconsts.dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr "Grouper Défaire"
|
||
|
||
#: lazarusidestrconsts.dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr "Afficher les lignes directrices"
|
||
|
||
#: lazarusidestrconsts.dlggutter
|
||
msgctxt "lazarusidestrconsts.dlggutter"
|
||
msgid "Gutter"
|
||
msgstr "Gouttière"
|
||
|
||
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
||
msgid "Collapsed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgguttercolor
|
||
msgid "Gutter Color"
|
||
msgstr "Couleur de gouttière"
|
||
|
||
#: lazarusidestrconsts.dlggutteredgecolor
|
||
msgid "Gutter Edge Color"
|
||
msgstr "Couleur du bord de gouttière"
|
||
|
||
#: lazarusidestrconsts.dlggutterseparatorindex
|
||
msgid "Gutter separator index"
|
||
msgstr "Index du séparateur de gouttière"
|
||
|
||
#: lazarusidestrconsts.dlggutterwidth
|
||
msgid "Gutter width"
|
||
msgstr "Largeur de gouttière"
|
||
|
||
#: lazarusidestrconsts.dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr "Défilement d'une demi-page"
|
||
|
||
#: lazarusidestrconsts.dlgheapandstacksize
|
||
msgid "Heap and stack sizes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgheapsize
|
||
#, fuzzy
|
||
#| msgid "Heap Size"
|
||
msgid "Heap size"
|
||
msgstr "Taille de pile"
|
||
|
||
#: lazarusidestrconsts.dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "Hauteur:"
|
||
|
||
#: lazarusidestrconsts.dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr "Cacher l'EDI à l'exécution"
|
||
|
||
#: lazarusidestrconsts.dlghidemessagesicons
|
||
msgid "Hide Messages Icons"
|
||
msgstr "Cacher les icônes des messages"
|
||
|
||
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
||
msgid "Hide tab in single page windows"
|
||
msgstr "Cacher l'onglet dans les fenêtres d'une seule page"
|
||
|
||
#: lazarusidestrconsts.dlghighlightcolor
|
||
msgid "Highlight Color"
|
||
msgstr "Couleur de surlignage"
|
||
|
||
#: lazarusidestrconsts.dlghighlightfontcolor
|
||
msgid "Highlight Font Color"
|
||
msgstr "Couleur de surlignage pour la police"
|
||
|
||
#: lazarusidestrconsts.dlghighlightleftofcursor
|
||
msgid "Left Of Cursor"
|
||
msgstr "Gauche du curseur"
|
||
|
||
#: lazarusidestrconsts.dlghighlightrightofcursor
|
||
msgid "Right Of Cursor"
|
||
msgstr "Droite du curseur"
|
||
|
||
#: lazarusidestrconsts.dlghintsparametersendernotused
|
||
#, fuzzy
|
||
#| msgid "Show Hints for parameter \"Sender\" not used"
|
||
msgid "Show hints for parameter \"Sender\" not used"
|
||
msgstr "Afficher les conseils pour le paramètre \"Sender\" non utilisé"
|
||
|
||
#: lazarusidestrconsts.dlghintsunused
|
||
#, fuzzy
|
||
#| msgid "Show Hints for unused units in main source"
|
||
msgid "Show hints for unused units in main"
|
||
msgstr "Afficher les conseils pour les unités non utilisées"
|
||
|
||
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr "La touche Home va au plus proche début"
|
||
|
||
#: lazarusidestrconsts.dlghostapplication
|
||
msgid "Host application"
|
||
msgstr "Application hôte"
|
||
|
||
#: lazarusidestrconsts.dlgidentifiercompletion
|
||
#, fuzzy
|
||
#| msgid "Identifier completion"
|
||
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
||
msgid "Identifier Completion"
|
||
msgstr "Complétion de l'identificateur"
|
||
|
||
#: lazarusidestrconsts.dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr "Politique des identificateurs"
|
||
|
||
#: lazarusidestrconsts.dlgideoptions
|
||
msgid "IDE Options"
|
||
msgstr "Options IDE"
|
||
|
||
#: lazarusidestrconsts.dlgignoreverb
|
||
msgid "Ignore"
|
||
msgstr "Ignorer"
|
||
|
||
#: lazarusidestrconsts.dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr "Inclure les variables système"
|
||
|
||
#: lazarusidestrconsts.dlgindentcodeto
|
||
msgid "Indent code to"
|
||
msgstr "Indenter jusqu'à"
|
||
|
||
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
||
#, fuzzy
|
||
#| msgid "Indent and Tabs:"
|
||
msgid "Indent and Tabs"
|
||
msgstr "Indentations et tabulations :"
|
||
|
||
#: lazarusidestrconsts.dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr "Devant les méthodes"
|
||
|
||
#: lazarusidestrconsts.dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr "Le nom du constructeur doit être 'init' (le destructeur doit être 'done')"
|
||
|
||
#: lazarusidestrconsts.dlginsertimplementation
|
||
msgid "Implementation"
|
||
msgstr "Implementation"
|
||
|
||
#: lazarusidestrconsts.dlginsertinterface
|
||
msgid "Interface"
|
||
msgstr "Interface"
|
||
|
||
#: lazarusidestrconsts.dlginsertsection
|
||
msgid "Insert into Uses section of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr "Insérer un espace après"
|
||
|
||
#: lazarusidestrconsts.dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr "Insérer un espace devant"
|
||
|
||
#: lazarusidestrconsts.dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr "Intervalle en secondes"
|
||
|
||
#: lazarusidestrconsts.dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr "Sauts"
|
||
|
||
#: lazarusidestrconsts.dlgkeepcursorx
|
||
msgid "Keep cursor X position"
|
||
msgstr "Préserver la position X du curseur"
|
||
|
||
#: lazarusidestrconsts.dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr "Assignation des touches"
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr "Erreurs d'assignation de touches"
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingscheme
|
||
msgid "Key Mapping Scheme"
|
||
msgstr "Modèle de clavier"
|
||
|
||
#: lazarusidestrconsts.dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr "Politique de mot-clé"
|
||
|
||
#: lazarusidestrconsts.dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "Autoriser LABEL et GOTO"
|
||
|
||
#: lazarusidestrconsts.dlglang
|
||
msgctxt "lazarusidestrconsts.dlglang"
|
||
msgid "Language"
|
||
msgstr "Langue"
|
||
|
||
#: lazarusidestrconsts.dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr "Fin (du source)"
|
||
|
||
#: lazarusidestrconsts.dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr "Répertoire de Lazarus (défaut pour tous les projets)"
|
||
|
||
#: lazarusidestrconsts.dlgleftpos
|
||
msgid "Left:"
|
||
msgstr "Gauche :"
|
||
|
||
#: lazarusidestrconsts.dlglefttopclr
|
||
#, fuzzy
|
||
#| msgid "color for left, top"
|
||
msgid "Guid lines Left,Top"
|
||
msgstr "Couleur pour haut, gauche"
|
||
|
||
#: lazarusidestrconsts.dlglevel1opt
|
||
msgid "Level 1 (quick and debugger friendly)"
|
||
msgstr "Niveau 1 (rapide et débogueur amical)"
|
||
|
||
#: lazarusidestrconsts.dlglevel2opt
|
||
msgid "Level 2 (Level 1 + quick optimizations)"
|
||
msgstr "Niveau 2 (niveau 1 + optimisations rapide)"
|
||
|
||
#: lazarusidestrconsts.dlglevel3opt
|
||
msgid "Level 3 (Level 2 + slow optimizations)"
|
||
msgstr "Niveau 3 (niveau 2 + optimisations lentes)"
|
||
|
||
#: lazarusidestrconsts.dlglevelnoneopt
|
||
#, fuzzy
|
||
#| msgid "Level 0 (no extra Optimizations)"
|
||
msgid "Level 0 (no extra optimizations)"
|
||
msgstr "Niveau 0 (pas d'optimisations additionnelles)"
|
||
|
||
#: lazarusidestrconsts.dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr "Coupure de ligne"
|
||
|
||
#: lazarusidestrconsts.dlglinklibraries
|
||
#, fuzzy
|
||
#| msgid "Link Style"
|
||
msgid "Link style"
|
||
msgstr "Style de lien :"
|
||
|
||
#: lazarusidestrconsts.dlglinksmart
|
||
#, fuzzy
|
||
#| msgid "Link Smart"
|
||
msgid "Link smart"
|
||
msgstr "Lier intelligemment"
|
||
|
||
#: lazarusidestrconsts.dlglnumsbct
|
||
#, fuzzy
|
||
#| msgid "Display Line Numbers in Run-time Error Backtraces"
|
||
msgid "Display line numbers in run-time error backtraces"
|
||
msgstr "Afficher les numéros de ligne dans les traces d'erreurs à l'exécution"
|
||
|
||
#: lazarusidestrconsts.dlgloaddfile
|
||
msgid "Load desktop settings from file"
|
||
msgstr "Charger les paramètres du bureau"
|
||
|
||
#: lazarusidestrconsts.dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr "Menu principal"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewforms
|
||
#, fuzzy
|
||
#| msgid "View project forms"
|
||
msgid "View Project Forms"
|
||
msgstr "Afficher les fiches du projet"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewframes
|
||
#, fuzzy
|
||
#| msgid "View project frames"
|
||
msgid "View Project Frames"
|
||
msgstr "Afficher les cadres du projet"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewunits
|
||
#, fuzzy
|
||
#| msgid "View project units"
|
||
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
||
msgid "View Project Units"
|
||
msgstr "Afficher les unités du projet"
|
||
|
||
#: lazarusidestrconsts.dlgmakepath
|
||
msgid "Make path"
|
||
msgstr "Chemin de 'make'"
|
||
|
||
#: lazarusidestrconsts.dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr "Marge et gouttière"
|
||
|
||
#: lazarusidestrconsts.dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr "Couleur de signet"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupgroup
|
||
#, fuzzy
|
||
#| msgid "Word under Caret Highlight"
|
||
msgid "Highlight of Word under Caret"
|
||
msgstr "Mot sous le curseur surligné"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
||
msgid "Match word boundaries for words up to this length:"
|
||
msgstr "trouver les limites de mot pour les mots jusqu'à cette longueur:"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
||
#, fuzzy
|
||
#| msgid "Ignore Keywords"
|
||
msgid "Ignore keywords"
|
||
msgstr "Ignore les mots clefs"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
||
msgid "Disable timer for markup current word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordtrim
|
||
#, fuzzy
|
||
#| msgid "Trim Spaces (when highlighting current selection)"
|
||
msgid "Trim spaces (when highlighting current selection)"
|
||
msgstr "Retire les espaces(quand on surligne la sélection courante)"
|
||
|
||
#: lazarusidestrconsts.dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr "Nombre maximum"
|
||
|
||
#: lazarusidestrconsts.dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr "Longueur max d'une ligne:"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr "Fichiers récents max."
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr "Fichiers projet récents max."
|
||
|
||
#: lazarusidestrconsts.dlgmethodinspolicy
|
||
msgid "Method insert policy"
|
||
msgstr "Politique d'insertion des méthodes"
|
||
|
||
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr "Mélanger méthodes et propriétés"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbutton
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
|
||
msgid "Button"
|
||
msgstr "Bouton"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonleft
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
|
||
msgid "Left"
|
||
msgstr "Gauche"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
|
||
msgid "Middle"
|
||
msgstr "Milieu"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonright
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
|
||
msgid "Right"
|
||
msgstr "Droite"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolfoldall
|
||
msgid "Fold All (Some Colapsed)"
|
||
msgstr "Plie tout (quelques-uns réduits)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolfoldone
|
||
msgid "Fold One (Some Colapsed)"
|
||
msgstr "En plie un (quelques-uns réduits)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolunfoldall
|
||
msgid "Unfold All (Some Colapsed)"
|
||
msgstr "Déplie tout(quelques-uns réduits)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolunfoldone
|
||
msgid "Unfold One (Some Colapsed)"
|
||
msgstr "En déplie un (quelques-uns réduits)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldenabled
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
|
||
msgid "Enabled"
|
||
msgstr "Permis "
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldexpfoldall
|
||
msgid "Fold All (All Expanded)"
|
||
msgstr "Plie tout (tout développé)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldexpfoldone
|
||
msgid "Fold One (All Expanded)"
|
||
msgstr "En plie un(tout développé)"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldgroup1
|
||
msgid "Setting 1"
|
||
msgstr "Préférences 1"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldgroup2
|
||
msgid "Setting 2"
|
||
msgstr "Préférences 2"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifieralt
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifierctrl
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifiershift
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmousegroupoptions
|
||
#| msgid "Mouse options:"
|
||
msgid "Mouse:"
|
||
msgstr "Souris :"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn1
|
||
msgid "Single"
|
||
msgstr "Simple"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn2
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
||
msgid "Double"
|
||
msgstr "Double"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn3
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
||
msgid "Triple"
|
||
msgstr "Triple"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn4
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
||
msgid "Quad"
|
||
msgstr "Quadruple"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnadd
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
|
||
msgid "Add"
|
||
msgstr "Ajouter"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnany
|
||
msgid "Any"
|
||
msgstr "Tous"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtncancel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtndel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtndown
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
|
||
msgid "Down"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnexport
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
|
||
msgid "Export"
|
||
msgstr "Exporter"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
||
msgid "Extra 1"
|
||
msgstr "Extra 1"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
||
msgid "Extra 2"
|
||
msgstr "Extra 2"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnimport
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnimport"
|
||
msgid "Import"
|
||
msgstr "Importer"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
||
msgid "Left"
|
||
msgstr "Gauche"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
||
msgid "Middle"
|
||
msgstr "Milieu"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
||
#, fuzzy
|
||
msgid "Make Fallback"
|
||
msgstr "Chemin de 'make'"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnok
|
||
#| msgid "Ok"
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
|
||
msgid "OK"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnright
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
||
msgid "Right"
|
||
msgstr "Droite"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnudp
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
|
||
msgid "Change"
|
||
msgstr "Changer"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnup
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
|
||
msgid "Up"
|
||
msgstr "Haut"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
||
msgid "Wheel down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
||
msgid "Wheel up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcapture
|
||
msgid "Capture"
|
||
msgstr "Capture"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
||
msgid "Move Caret (extra)"
|
||
msgstr "Déplace le curseur (extra)"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
||
msgid "Act on Mouse up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescaction
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
||
msgid "Action"
|
||
msgstr "Action"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
||
msgid "Click"
|
||
msgstr "Clic"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
||
msgid "Edit Mouse"
|
||
msgstr "Edite la souris"
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrordup
|
||
msgid "Duplicate Entry"
|
||
msgstr "Entrée dupliquée"
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
||
msgid "This entry conflicts with an existing entry"
|
||
msgstr "Cette entrée entre en conflit avec une entrée existante"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
||
msgid "Button"
|
||
msgstr "Bouton"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
||
msgid "Caret"
|
||
msgstr "Curseur"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
||
msgid "Context"
|
||
msgstr "Contexte"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcount
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
||
msgid "Click"
|
||
msgstr "Clic"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
||
msgid "Action"
|
||
msgstr "Action"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddir
|
||
msgid "Up/Down"
|
||
msgstr "Up/Down"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadopt
|
||
msgid "Option"
|
||
msgstr "Option"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadorder
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
||
msgid "Order"
|
||
msgstr "Ordre"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
||
msgid "Priority"
|
||
msgstr "Priorité"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptions
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
||
msgid "Mouse"
|
||
msgstr "Souris"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsadv
|
||
msgid "Advanced"
|
||
msgstr "Avancé"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
||
msgid "IDE-Command"
|
||
msgstr "Commande de l'IDE"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
||
msgid "n"
|
||
msgstr "n"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
||
msgid "Y"
|
||
msgstr "Y"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
||
msgid "Y"
|
||
msgstr "Y"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeall
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
||
msgid "All"
|
||
msgstr "Tout"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
||
msgid "Gutter"
|
||
msgstr "Gouttière"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
||
msgid "Fold Tree"
|
||
msgstr "Arbre de pliage"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
||
msgid "Collapsed [+]"
|
||
msgstr "Réduit [+]"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
||
msgid "Expanded [-]"
|
||
msgstr "Développé [-]"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
||
msgid "Line Numbers"
|
||
msgstr "numéros de ligne"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodemain
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
||
msgid "Text"
|
||
msgstr "Texte"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
||
msgid "Selection"
|
||
msgstr "Sélectionner"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptopt2label
|
||
msgid "Opt"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheract
|
||
msgid "Other actions using the same button"
|
||
msgstr "D'autres actions utilisent le même bouton"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
||
#, fuzzy
|
||
#| msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
|
||
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
||
msgstr "Ils peuvent être exécutés en fonction des touches de modification, des définitions fallthrough, simple / double, haut / bas"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
||
#, fuzzy
|
||
msgid "Filter Mod-Keys"
|
||
msgstr "Éditer les touches de la commande"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
||
msgid "Priority"
|
||
msgstr "Priorité"
|
||
|
||
#: lazarusidestrconsts.dlgmsgs
|
||
msgctxt "lazarusidestrconsts.dlgmsgs"
|
||
msgid "Messages"
|
||
msgstr "Messages"
|
||
|
||
#: lazarusidestrconsts.dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "Multi sélection"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
||
#, fuzzy
|
||
#| msgid "Find editor for jump targets"
|
||
msgid "Find Editor for Jump Targets"
|
||
msgstr "trouver"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
||
msgid "Order to use for editors matching the same criteria"
|
||
msgstr "Classement à utiliser pour les éditeurs répondant aux mêmes critères"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
||
msgid "Most recent focused editor for this file"
|
||
msgstr "Le plus récent éditeur ayant le focus pour ce fichier"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
||
msgid "Editor (for file) in most recent focused window"
|
||
msgstr "L'Editeur(pour fichier) dans la plus récente fenêtre ayant le focus"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
||
msgid "Priority list of criteria to choose an editor:"
|
||
msgstr "Liste prioritaire de critères pour choisir un éditeur:"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinoptions
|
||
msgid "Pages and Windows"
|
||
msgstr "Pages et fenêtres"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwintabgroup
|
||
#, fuzzy
|
||
#| msgid "Notebook Tabs:"
|
||
msgid "Notebook Tabs"
|
||
msgstr "position des onglets de l'éditeur de source"
|
||
|
||
#: lazarusidestrconsts.dlgnaming
|
||
msgid "Naming"
|
||
msgstr "Nommage"
|
||
|
||
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
||
#| msgid "no automatic renaming"
|
||
msgid "No automatic renaming"
|
||
msgstr "Pas de renommage automatique"
|
||
|
||
#: lazarusidestrconsts.dlgnoavailableunits
|
||
msgid "No available units to add."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnobrackethighlight
|
||
msgid "No Highlight"
|
||
msgstr "Pas de surlignage"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabpos
|
||
msgid "Source notebook tabs position"
|
||
msgstr "position des onglets l'éditeur de source"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabposbottom
|
||
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
|
||
msgid "Bottom"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabposleft
|
||
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
|
||
msgid "Left"
|
||
msgstr "Gauche"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabposright
|
||
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
|
||
msgid "Right"
|
||
msgstr "Droite"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabpostop
|
||
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
|
||
msgid "Top"
|
||
msgstr "Haut"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlineafter
|
||
#, fuzzy
|
||
#| msgid "Do not split line after:"
|
||
msgid "Do not split line after"
|
||
msgstr "Ne pas couper la ligne après :"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlinefront
|
||
#, fuzzy
|
||
#| msgid "Do not split line In front of:"
|
||
msgid "Do not split line in front of"
|
||
msgstr "Ne pas couper la ligne avant :"
|
||
|
||
#: lazarusidestrconsts.dlgobjinsp
|
||
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
||
msgid "Object Inspector"
|
||
msgstr "Inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts.dlgoiitemheight
|
||
msgid "Item height"
|
||
msgstr "Hauteur d'élément"
|
||
|
||
#: lazarusidestrconsts.dlgoimiscellaneous
|
||
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Divers"
|
||
|
||
#: lazarusidestrconsts.dlgoioptions
|
||
msgctxt "lazarusidestrconsts.dlgoioptions"
|
||
msgid "Options"
|
||
msgstr "Options"
|
||
|
||
#: lazarusidestrconsts.dlgoispeedsettings
|
||
msgid "Speed settings"
|
||
msgstr "Configuration rapide"
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
||
msgid "Use default Delphi settings"
|
||
msgstr "Utiliser les paramètres par défaut de Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
||
msgid "Use default Lazarus settings"
|
||
msgstr "Utiliser les paramètres par défaut de Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgoptimiz
|
||
#, fuzzy
|
||
#| msgid "Optimizations:"
|
||
msgid "Optimizations"
|
||
msgstr "Optimisations:"
|
||
|
||
#: lazarusidestrconsts.dlgotherunitfiles
|
||
#, fuzzy
|
||
#| msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
||
msgid "Other unit files (-Fu) (delimiter is semicolon):"
|
||
msgstr "Autres fichiers unité (-Fu) (le délimiteur est le point-virgule):"
|
||
|
||
#: lazarusidestrconsts.dlgoverwriteblock
|
||
#, fuzzy
|
||
#| msgid "Overwrite Block"
|
||
msgid "Overwrite block"
|
||
msgstr "Ecraser le bloc"
|
||
|
||
#: lazarusidestrconsts.dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr "Conseils pour la palette de composants"
|
||
|
||
#: lazarusidestrconsts.dlgpasext
|
||
msgid "Default pascal extension"
|
||
msgstr "Extension Pascal par défaut"
|
||
|
||
#: lazarusidestrconsts.dlgpasextkeywords
|
||
msgid "Highlight control statements as keywords"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
||
msgid "Extended Pascal Keyword Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpassoptslinker
|
||
#, fuzzy
|
||
#| msgid "Pass Options To The Linker (Delimiter is space)"
|
||
msgid "Pass options to linker (delimiter is space)"
|
||
msgstr "Passez des options à l'éditeur de liens (séparées par des espaces)"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywords
|
||
msgid "Highlight \"String\" keyword(s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
||
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
||
msgid "Default"
|
||
msgstr "Valeur par défaut"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
||
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
||
msgid "None"
|
||
msgstr "Aucun"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
||
msgid "Only \"String\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpersistentblock
|
||
#, fuzzy
|
||
#| msgid "Persistent Block"
|
||
msgid "Persistent block"
|
||
msgstr "Bloc persistant"
|
||
|
||
#: lazarusidestrconsts.dlgpersistentcursor
|
||
msgid "Persistent cursor"
|
||
msgstr "Curseur persistant"
|
||
|
||
#: lazarusidestrconsts.dlgpldpackagegroup
|
||
msgid "Package group"
|
||
msgstr "Groupe de paquets"
|
||
|
||
#: lazarusidestrconsts.dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "Application"
|
||
|
||
#: lazarusidestrconsts.dlgpoclearicon
|
||
msgid "Clear Icon"
|
||
msgstr "Effacer l'icônes"
|
||
|
||
#: lazarusidestrconsts.dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr "Créer un Bundle Application"
|
||
|
||
#: lazarusidestrconsts.dlgpodpiaware
|
||
msgid "Dpi aware application (for Vista+)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpofroms
|
||
msgid "Forms"
|
||
msgstr "Fiches"
|
||
|
||
#: lazarusidestrconsts.dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr "i18n"
|
||
|
||
#: lazarusidestrconsts.dlgpoicon
|
||
msgid "Icon:"
|
||
msgstr "Icône :"
|
||
|
||
#: lazarusidestrconsts.dlgpoicondesc
|
||
msgid "(size: %d:%d, bpp: %d)"
|
||
msgstr "(taille: %d:%d, bpp: %d)"
|
||
|
||
#: lazarusidestrconsts.dlgpoicondescnone
|
||
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
||
msgid "(none)"
|
||
msgstr "<Aucun>"
|
||
|
||
#: lazarusidestrconsts.dlgpoloadicon
|
||
msgid "Load Icon"
|
||
msgstr "Changer icône"
|
||
|
||
#: lazarusidestrconsts.dlgpomisc
|
||
msgctxt "lazarusidestrconsts.dlgpomisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Divers"
|
||
|
||
#: lazarusidestrconsts.dlgpooutputsettings
|
||
#, fuzzy
|
||
#| msgid "Output Settings"
|
||
msgid "Output settings"
|
||
msgstr "Réglages de sortie"
|
||
|
||
#: lazarusidestrconsts.dlgposaveicon
|
||
msgid "Save Icon"
|
||
msgstr "Enregistrer l'icône"
|
||
|
||
#: lazarusidestrconsts.dlgposavesession
|
||
msgid "Session"
|
||
msgstr "Session"
|
||
|
||
#: lazarusidestrconsts.dlgpotargetfilename
|
||
msgid "Target file name:"
|
||
msgstr "Fichier de destination:"
|
||
|
||
#: lazarusidestrconsts.dlgpotitle
|
||
msgid "Title:"
|
||
msgstr "Titre:"
|
||
|
||
#: lazarusidestrconsts.dlgpouseappbundle
|
||
#, fuzzy
|
||
#| msgid "Use Application Bundle for running and debugging (darwin only)"
|
||
msgid "Use Application Bundle for running and debugging (Darwin only)"
|
||
msgstr "Utiliser le paquet d'application pour exécuter et corriger (Darwin seulement)"
|
||
|
||
#: lazarusidestrconsts.dlgpousemanifest
|
||
#| msgid "Use manifest file to enable themes (windows only)"
|
||
msgid "Use manifest file to enable themes (Windows only)"
|
||
msgstr "Utiliser le fichier manifest pourautoriser les thèmes (Windows seulement)"
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr "Options du projet"
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptionsfor
|
||
msgid "Options for Project: %s"
|
||
msgstr "Options pour le projet: %s"
|
||
|
||
#: lazarusidestrconsts.dlgprojfiles
|
||
#, fuzzy
|
||
#| msgid "Project files"
|
||
msgid "Project Files"
|
||
msgstr "Fichiers projet"
|
||
|
||
#: lazarusidestrconsts.dlgpromptonreplace
|
||
#, fuzzy
|
||
#| msgid "&Prompt On Replace"
|
||
msgid "&Prompt on replace"
|
||
msgstr "&Confirmer les remplacements"
|
||
|
||
#: lazarusidestrconsts.dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr "Complétion de propriété"
|
||
|
||
#: lazarusidestrconsts.dlgpropnamecolor
|
||
msgid "Property Name"
|
||
msgstr "nom de propriété"
|
||
|
||
#: lazarusidestrconsts.dlgqautoclosecompiledialog
|
||
msgid "Auto close compile dialog"
|
||
msgstr "ferme automatiquement la boite de dialogue de compilation"
|
||
|
||
#: lazarusidestrconsts.dlgqopenlastprj
|
||
msgid "Open last project at start"
|
||
msgstr "Ouvrir le dernier projet au démarrage"
|
||
|
||
#: lazarusidestrconsts.dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr "Afficher l'espacement des bordures"
|
||
|
||
#: lazarusidestrconsts.dlgqshowcompiledialog
|
||
msgid "Show compile dialog"
|
||
msgstr "Afficher le dialogue de compilation"
|
||
|
||
#: lazarusidestrconsts.dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr "Afficher la grille"
|
||
|
||
#: lazarusidestrconsts.dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr "Aligner sur la grille"
|
||
|
||
#: lazarusidestrconsts.dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr "Référence"
|
||
|
||
#: lazarusidestrconsts.dlgregularexpressions
|
||
#, fuzzy
|
||
#| msgid "Regular E&xpressions"
|
||
msgid "Regular e&xpressions"
|
||
msgstr "&Expressions régulières"
|
||
|
||
#: lazarusidestrconsts.dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr "&Remplacer tout"
|
||
|
||
#: lazarusidestrconsts.dlgreplacewith
|
||
#, fuzzy
|
||
#| msgid "&Replace With"
|
||
msgid "&Replace with"
|
||
msgstr "&Remplacer par"
|
||
|
||
#: lazarusidestrconsts.dlgreport
|
||
msgid "Report"
|
||
msgstr "Rapport"
|
||
|
||
#: lazarusidestrconsts.dlgrightbottomclr
|
||
#, fuzzy
|
||
#| msgid "color for right, bottom"
|
||
msgid "Guide lines Right,Bottom"
|
||
msgstr "Aligner sur les lignes directrices"
|
||
|
||
#: lazarusidestrconsts.dlgrightclickselects
|
||
#, fuzzy
|
||
#| msgid "Right Click selects"
|
||
msgid "Right click selects"
|
||
msgstr "Clic droit pour sélectionner"
|
||
|
||
#: lazarusidestrconsts.dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr "Marge droite"
|
||
|
||
#: lazarusidestrconsts.dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr "Répertoire de travail"
|
||
|
||
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
||
#, fuzzy
|
||
msgid "Select grandchildren"
|
||
msgstr "Choisir un répertoire"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
||
#, fuzzy
|
||
#| msgid "Creation"
|
||
msgid "Rubberband Creation"
|
||
msgstr "Création de code"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
||
#, fuzzy
|
||
#| msgid "Selection"
|
||
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
||
msgid "Rubberband Selection"
|
||
msgstr "colle la sélection"
|
||
|
||
#: lazarusidestrconsts.dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr "Affichage (pas pour Win32; par exemple : 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
|
||
#: lazarusidestrconsts.dlgrunoenvironment
|
||
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
||
msgid "Environment"
|
||
msgstr "Environnement"
|
||
|
||
#: lazarusidestrconsts.dlgrunolocal
|
||
msgid "Local"
|
||
msgstr "Local"
|
||
|
||
#: lazarusidestrconsts.dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr "Variables système"
|
||
|
||
#: lazarusidestrconsts.dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr "Utiliser l'affichage"
|
||
|
||
#: lazarusidestrconsts.dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr "Surcharge utilisateur"
|
||
|
||
#: lazarusidestrconsts.dlgrunovalue
|
||
msgctxt "lazarusidestrconsts.dlgrunovalue"
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: lazarusidestrconsts.dlgrunovariable
|
||
msgid "Variable"
|
||
msgstr "Variable"
|
||
|
||
#: lazarusidestrconsts.dlgrunparameters
|
||
#, fuzzy
|
||
#| msgid "Run parameters"
|
||
msgid "Run Parameters"
|
||
msgstr "Paramètres d'exécution"
|
||
|
||
#: lazarusidestrconsts.dlgsavedfile
|
||
msgid "Save desktop settings to file"
|
||
msgstr "Enregistrer les paramètres du bureau"
|
||
|
||
#: lazarusidestrconsts.dlgsavedlinecolor
|
||
msgid "Saved line"
|
||
msgstr "Lgne enregistrée"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr "Enregistrer les infos de l'éditeur pour les fichiers fermés"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr "Enregistrer les infos de l'éditeur seulement pour les fichiers projet"
|
||
|
||
#: lazarusidestrconsts.dlgscope
|
||
msgid "Scope"
|
||
msgstr "Portée"
|
||
|
||
#: lazarusidestrconsts.dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr "faire défiler d'un de moins"
|
||
|
||
#: lazarusidestrconsts.dlgscrollgroupoptions
|
||
#, fuzzy
|
||
#| msgid "Scrolling:"
|
||
msgid "Scrolling"
|
||
msgstr "Défilement :"
|
||
|
||
#: lazarusidestrconsts.dlgscrollhint
|
||
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
||
msgid "Show scroll hint"
|
||
msgstr "Afficher les conseils de défilement"
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr "Défilement après la fin du fichier"
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendline
|
||
#| msgid "Scroll past end of line"
|
||
msgid "Caret past end of line"
|
||
msgstr "Curseur dépasse la fin de ligne"
|
||
|
||
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
||
msgid "Search directory \"%s\" not found."
|
||
msgstr "Répertoire de recherche \"%s\" non trouvé"
|
||
|
||
#: lazarusidestrconsts.dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr "Recherche interrompue par l'utilisateur."
|
||
|
||
#: lazarusidestrconsts.dlgsearchcaption
|
||
#, fuzzy
|
||
#| msgid "Searching..."
|
||
msgid "Searching ..."
|
||
msgstr "Recherche ..."
|
||
|
||
#: lazarusidestrconsts.dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr "Chemins"
|
||
|
||
#: lazarusidestrconsts.dlgselectedtext
|
||
#, fuzzy
|
||
#| msgid "&Selected Text"
|
||
msgid "&Selected text"
|
||
msgstr "&Texte sélectionné"
|
||
|
||
#: lazarusidestrconsts.dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr "Réinitialiser tous les éléments"
|
||
|
||
#: lazarusidestrconsts.dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr "Réinitialiser l'élément"
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr "Variable d'affectation"
|
||
|
||
#: lazarusidestrconsts.dlgshowallunits
|
||
msgid "Show all units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowcaps
|
||
msgid "Show component captions"
|
||
msgstr "Afficher les légendes des composants"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr "Afficher les procédures compilées"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompileroptions
|
||
msgid "Show compiler options"
|
||
msgstr "Afficher les options du compilateur"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Afficher les numéros de ligne"
|
||
|
||
#: lazarusidestrconsts.dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "Afficher les expressions conditionnelles"
|
||
|
||
#: lazarusidestrconsts.dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr "Afficher les informations de déboguage"
|
||
|
||
#: lazarusidestrconsts.dlgshowdefinedmacros
|
||
msgid "Show defined macros"
|
||
msgstr "Afficher les macros définies"
|
||
|
||
#: lazarusidestrconsts.dlgshowedrhints
|
||
msgid "Show editor hints"
|
||
msgstr "Afficher les conseils dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts.dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr "Tout afficher"
|
||
|
||
#: lazarusidestrconsts.dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr "Afficher les infos de l'exe (Win32 seulement)"
|
||
|
||
#: lazarusidestrconsts.dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr "Afficher les informations générales"
|
||
|
||
#: lazarusidestrconsts.dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr "Afficher les astuces de gouttière"
|
||
|
||
#: lazarusidestrconsts.dlgshowhint
|
||
#, fuzzy
|
||
#| msgid "Show Hints"
|
||
msgctxt "lazarusidestrconsts.dlgshowhint"
|
||
msgid "Show hints"
|
||
msgstr "Afficher les conseils"
|
||
|
||
#: lazarusidestrconsts.dlgshowlinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Afficher les numéros de ligne"
|
||
|
||
#: lazarusidestrconsts.dlgshownotes
|
||
#, fuzzy
|
||
#| msgid "Show Notes"
|
||
msgid "Show notes"
|
||
msgstr "Afficher les notes"
|
||
|
||
#: lazarusidestrconsts.dlgshownothing
|
||
msgid "Show nothing (only errors)"
|
||
msgstr "Ne rien afficher (sauf les erreurs)"
|
||
|
||
#: lazarusidestrconsts.dlgshowprocserror
|
||
msgid "Show all procs on error"
|
||
msgstr "Afficher les procédures en cas d'erreur"
|
||
|
||
#: lazarusidestrconsts.dlgshowscrollhint
|
||
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
|
||
msgid "Show scroll hint"
|
||
msgstr "Afficher les conseils de défilement"
|
||
|
||
#: lazarusidestrconsts.dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr "Afficher le récapitulatif"
|
||
|
||
#: lazarusidestrconsts.dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr "Afficher les fichiers essayés"
|
||
|
||
#: lazarusidestrconsts.dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr "Afficher les fichiers utilisés"
|
||
|
||
#: lazarusidestrconsts.dlgshowwarnings
|
||
#, fuzzy
|
||
#| msgid "Show Warnings"
|
||
msgid "Show warnings"
|
||
msgstr "Afficher les avertissements"
|
||
|
||
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
||
msgid "Show single button in TaskBar"
|
||
msgstr "Affiche un seul bouton dans la barre des tâches"
|
||
|
||
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
||
msgid "Skip forward class declarations"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr "Tabulations intelligentes"
|
||
|
||
#: lazarusidestrconsts.dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr "Symbole derrière (.pp~)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr "Compteur (.pp;1)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr "Symbole devant (.~pp)"
|
||
|
||
#: lazarusidestrconsts.dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr "Aligner sur les lignes directrices"
|
||
|
||
#: lazarusidestrconsts.dlgspacenotcosmos
|
||
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
||
msgid "Space"
|
||
msgstr "Espace"
|
||
|
||
#: lazarusidestrconsts.dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr "Conseils pour les principaux boutons rapides (Ouvrir, Enregistrer, ...) "
|
||
|
||
#: lazarusidestrconsts.dlgsrcedit
|
||
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
||
msgid "Source Editor"
|
||
msgstr "Editeur de source"
|
||
|
||
#: lazarusidestrconsts.dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr "Origine"
|
||
|
||
#: lazarusidestrconsts.dlgstacksize
|
||
msgid "Stack size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgstatickeyword
|
||
#, fuzzy
|
||
#| msgid "Static Keyword in Objects"
|
||
msgid "Static keyword in objects"
|
||
msgstr "Mot-clé \"static\" dans les objets"
|
||
|
||
#: lazarusidestrconsts.dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr "Arrêt après ce nombre d'erreurs:"
|
||
|
||
#: lazarusidestrconsts.dlgsubpropcolor
|
||
msgid "SubProperties"
|
||
msgstr "Sous Propriétés"
|
||
|
||
#: lazarusidestrconsts.dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr "Options des syntaxes"
|
||
|
||
#: lazarusidestrconsts.dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr "Tabulation indente les blocs"
|
||
|
||
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
||
msgid "Show tab numbers in notebook"
|
||
msgstr "Afficher les numéros d'onglet dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts.dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr "Tabulations en espaces"
|
||
|
||
#: lazarusidestrconsts.dlgtabwidths
|
||
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
||
msgid "Tab widths"
|
||
msgstr "Largeur de tabulation"
|
||
|
||
#: lazarusidestrconsts.dlgtargetcpufamily
|
||
msgid "Target CPU family"
|
||
msgstr "CPU de destination"
|
||
|
||
#: lazarusidestrconsts.dlgtargetos
|
||
msgctxt "lazarusidestrconsts.dlgtargetos"
|
||
msgid "Target OS"
|
||
msgstr "OS de destination"
|
||
|
||
#: lazarusidestrconsts.dlgtargetplatform
|
||
#, fuzzy
|
||
#| msgid "Target Platform"
|
||
msgid "Target platform"
|
||
msgstr "Plateformes cibles :"
|
||
|
||
#: lazarusidestrconsts.dlgtargetproc
|
||
msgid "Target processor"
|
||
msgstr "Processeur cible"
|
||
|
||
#: lazarusidestrconsts.dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr "Répertoire pour la création de projets test"
|
||
|
||
#: lazarusidestrconsts.dlgtexttofind
|
||
#, fuzzy
|
||
#| msgid "&Text to Find"
|
||
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
||
msgid "&Text to find"
|
||
msgstr "&Texte à trouver"
|
||
|
||
#: lazarusidestrconsts.dlgthedirectory
|
||
msgid "The directory \""
|
||
msgstr "Le répertoire \""
|
||
|
||
#: lazarusidestrconsts.dlgtimesecondunit
|
||
msgid "sec"
|
||
msgstr "Sec"
|
||
|
||
#: lazarusidestrconsts.dlgtooltipeval
|
||
msgid "Tooltip expression evaluation"
|
||
msgstr "Evaluation d'expression ToolTip"
|
||
|
||
#: lazarusidestrconsts.dlgtooltiptools
|
||
msgid "Tooltip symbol Tools"
|
||
msgstr "Outils des symboles Tooltip"
|
||
|
||
#: lazarusidestrconsts.dlgtoppos
|
||
msgid "Top:"
|
||
msgstr "Haut:"
|
||
|
||
#: lazarusidestrconsts.dlgtplfname
|
||
msgid "Template file name"
|
||
msgstr "Fichier modèle"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
||
#, fuzzy
|
||
#| msgid "Trim Spaces Style"
|
||
msgid "Trim spaces style"
|
||
msgstr "Style de suppression des espaces"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
||
msgid "Caret or Edit"
|
||
msgstr "Curseur ou Edition"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
||
msgid "Line Edited"
|
||
msgstr "Ligne modifiée"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
||
msgid "Leave line"
|
||
msgstr "Quitter ligne"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
||
msgid "Position Only"
|
||
msgstr "Position seulement"
|
||
|
||
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr "Enlever les espaces à la fin"
|
||
|
||
#: lazarusidestrconsts.dlguncertopt
|
||
#, fuzzy
|
||
#| msgid "Uncertain Optimizations"
|
||
msgid "Uncertain optimizations"
|
||
msgstr "Optimisations incertaines"
|
||
|
||
#: lazarusidestrconsts.dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "Défaire après enregistrement"
|
||
|
||
#: lazarusidestrconsts.dlgundogroupoptions
|
||
#, fuzzy
|
||
#| msgid "Undo / Redo:"
|
||
msgid "Undo / Redo"
|
||
msgstr "Défaire / Refaire :"
|
||
|
||
#: lazarusidestrconsts.dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "Mémoire max pour l'annulation"
|
||
|
||
#: lazarusidestrconsts.dlgunitdepbrowse
|
||
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: lazarusidestrconsts.dlgunitdepcaption
|
||
msgid "Unit dependencies"
|
||
msgstr "Dépendances de l'unité"
|
||
|
||
#: lazarusidestrconsts.dlgunitdeprefresh
|
||
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
||
msgid "Refresh"
|
||
msgstr "Rafraîchir"
|
||
|
||
#: lazarusidestrconsts.dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr "Répertoire de sortie pour les unités (-FU):"
|
||
|
||
#: lazarusidestrconsts.dlgunsavedlinecolor
|
||
msgid "Unsaved line"
|
||
msgstr "ligne non enregistrée"
|
||
|
||
#: lazarusidestrconsts.dlgupword
|
||
msgctxt "lazarusidestrconsts.dlgupword"
|
||
msgid "Up"
|
||
msgstr "Haut"
|
||
|
||
#: lazarusidestrconsts.dlgusecodefolding
|
||
#, fuzzy
|
||
#| msgid "Code folding"
|
||
msgid "Code Folding"
|
||
msgstr "Repliage de code"
|
||
|
||
#: lazarusidestrconsts.dlgusecustomconfig
|
||
#, fuzzy
|
||
#| msgid "Use additional Compiler Config File"
|
||
msgid "Use additional compiler config file"
|
||
msgstr "Utiliser un fichier de configuration supplémentaire du compilateur"
|
||
|
||
#: lazarusidestrconsts.dlgusedividerdraw
|
||
#, fuzzy
|
||
#| msgid "Divider drawing"
|
||
msgid "Divider Drawing"
|
||
msgstr "Dessin des séparateurs"
|
||
|
||
#: lazarusidestrconsts.dlgusefpccfg
|
||
#, fuzzy
|
||
#| msgid "Use standard Compiler Config File (fpc.cfg)"
|
||
msgid "Use standard compiler config file (fpc.cfg)"
|
||
msgstr "Utiliser le fichier de configuration standard du compilateur (fpc.cfg)"
|
||
|
||
#: lazarusidestrconsts.dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr "Utiliser une application de démarrage"
|
||
|
||
#: lazarusidestrconsts.dlgusemsgfile
|
||
msgid "Use messages file"
|
||
msgstr "Utilise un fichier de messages"
|
||
|
||
#: lazarusidestrconsts.dlguserschemeerror
|
||
msgid "Failed to load user-scheme file %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguseschemedefaults
|
||
#, fuzzy
|
||
#| msgid "Use global scheme settings"
|
||
msgid "Use (and edit) global scheme settings"
|
||
msgstr "Utiliser les paramètres globaux du programme"
|
||
|
||
#: lazarusidestrconsts.dlguseschemelocal
|
||
msgid "Use local scheme settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr "Utiliser la coloration syntaxique"
|
||
|
||
#: lazarusidestrconsts.dlgusetabshistory
|
||
msgid "Use tab history when closing tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlguseunitcaption
|
||
msgid "Add unit to Uses section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgvaluecolor
|
||
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: lazarusidestrconsts.dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr "Messages détaillés pendant la compilation:"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr "Gouttière visible"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr "Marge droite visible"
|
||
|
||
#: lazarusidestrconsts.dlgwholewordsonly
|
||
#, fuzzy
|
||
#| msgid "&Whole Words Only"
|
||
msgid "&Whole words only"
|
||
msgstr "&Mots entiers seulement"
|
||
|
||
#: lazarusidestrconsts.dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr "Largeur:"
|
||
|
||
#: lazarusidestrconsts.dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr "Application Win32 gui"
|
||
|
||
#: lazarusidestrconsts.dlgwindow
|
||
msgctxt "lazarusidestrconsts.dlgwindow"
|
||
msgid "Window"
|
||
msgstr "Fenêtre "
|
||
|
||
#: lazarusidestrconsts.dlgwinpos
|
||
#, fuzzy
|
||
#| msgid "Window Positions"
|
||
msgid "Window positions"
|
||
msgstr "Positions des fenêtres"
|
||
|
||
#: lazarusidestrconsts.dlgwordexceptions
|
||
msgid "Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwordspolicies
|
||
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
||
msgid "Words"
|
||
msgstr "Mots"
|
||
|
||
#: lazarusidestrconsts.dlgwrdpreview
|
||
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
||
msgid "Preview"
|
||
msgstr "Aperçu"
|
||
|
||
#: lazarusidestrconsts.dlgwritefpclogo
|
||
#, fuzzy
|
||
#| msgid "Write an FPC logo"
|
||
msgid "Write FPC logo"
|
||
msgstr "Insérer un logo FPC"
|
||
|
||
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr "Les composants sélectionnés doivent être sur une même fiche."
|
||
|
||
#: lazarusidestrconsts.fdmalignmenu
|
||
msgid "Align ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmdeleteselection
|
||
#| msgid "Delete selection"
|
||
msgid "Delete Selection"
|
||
msgstr "Effacer la sélection"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorhorizontal
|
||
#| msgid "Mirror horizontal"
|
||
msgid "Mirror Horizontal"
|
||
msgstr "Miroir Horizontal"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorvertical
|
||
#| msgid "Mirror vertical"
|
||
msgid "Mirror Vertical"
|
||
msgstr "Mirroir Vertical"
|
||
|
||
#: lazarusidestrconsts.fdmorder
|
||
msgctxt "lazarusidestrconsts.fdmorder"
|
||
msgid "Order"
|
||
msgstr "Ordre"
|
||
|
||
#: lazarusidestrconsts.fdmorderbackone
|
||
#| msgid "Back one"
|
||
msgid "Back One"
|
||
msgstr "Déplacer d'un vers arrière"
|
||
|
||
#: lazarusidestrconsts.fdmorderforwardone
|
||
#| msgid "Forward one"
|
||
msgid "Forward One"
|
||
msgstr "Déplacer d'un vers l'avant"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetoback
|
||
#| msgid "Move to back"
|
||
msgid "Move to Back"
|
||
msgstr "Déplacer vers l'arrière"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetofront
|
||
#| msgid "Move to front"
|
||
msgid "Move to Front"
|
||
msgstr "Déplacer vers l'avant"
|
||
|
||
#: lazarusidestrconsts.fdmsaveformasxml
|
||
#, fuzzy
|
||
#| msgid "Save form as XML"
|
||
msgid "Save Form as XML"
|
||
msgstr "Enregistrer le formulaire en xml"
|
||
|
||
#: lazarusidestrconsts.fdmscalemenu
|
||
msgid "Scale ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmscaleword
|
||
msgid "Scale"
|
||
msgstr "Ajuster"
|
||
|
||
#: lazarusidestrconsts.fdmselectall
|
||
msgctxt "lazarusidestrconsts.fdmselectall"
|
||
msgid "Select All"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: lazarusidestrconsts.fdmsizemenu
|
||
msgid "Size ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.fdmsizeword
|
||
msgid "Size"
|
||
msgstr "Taille"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr "Option : aligner sur la grille"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr "Option : aligner sur les lignes guides"
|
||
|
||
#: lazarusidestrconsts.fdmzorder
|
||
msgid "Z-order"
|
||
msgstr "Z-order"
|
||
|
||
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
||
msgid "On Both Sides"
|
||
msgstr "Des deux côtés"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnclearhint
|
||
msgid "Clear all snapshots"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgbtnenablehint
|
||
msgid "Toggle view snapshot or current"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgbtnexport
|
||
msgctxt "lazarusidestrconsts.histdlgbtnexport"
|
||
msgid "Export"
|
||
msgstr "Exporter"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnimport
|
||
msgctxt "lazarusidestrconsts.histdlgbtnimport"
|
||
msgid "Import"
|
||
msgstr "Importer"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnmakesnaphint
|
||
msgid "Take Snapshot"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgbtnpowerhint
|
||
msgid "Switch on/off automatic snapshots"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgbtnremovehint
|
||
msgid "Remove selected entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgbtnshowhisthint
|
||
msgid "View history"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgbtnshowsnaphint
|
||
msgid "View Snapshots"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgcolumnloc
|
||
msgid "Location"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgcolumntime
|
||
msgid "Time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.histdlgformname
|
||
msgctxt "lazarusidestrconsts.histdlgformname"
|
||
msgid "History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
||
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2paddfile
|
||
msgid "Add File"
|
||
msgstr "Ajouter un fichier"
|
||
|
||
#: lazarusidestrconsts.lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "Ajouter des fichiers"
|
||
|
||
#: lazarusidestrconsts.lisa2paddfilestopackage
|
||
msgid "Add files to package"
|
||
msgstr "Ajouter fichiers au paquet"
|
||
|
||
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
|
||
msgid "Add LFM, LRS files, if they exist"
|
||
msgstr "Ajouter les fichiers LFM et LRS, s'ils existent."
|
||
|
||
#: lazarusidestrconsts.lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "Ajouter au paquet"
|
||
|
||
#: lazarusidestrconsts.lisa2paddunit
|
||
msgid "Add Unit"
|
||
msgstr "Ajouter l'unité"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr "Type d'ancêtre ambigu"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr "Nom de classe ambigu"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr "Nom d'unité ambigu"
|
||
|
||
#: lazarusidestrconsts.lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "Type d'ancêtre"
|
||
|
||
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Une unité Pascal doit avoir l'extension .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr "Dépendances brisées"
|
||
|
||
#: lazarusidestrconsts.lisa2pchooseanexistingfile
|
||
msgid "<choose an existing file>"
|
||
msgstr "<choisir un fichier existant>"
|
||
|
||
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr "Nom de classe déjà existant"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewfile
|
||
msgid "Create new file"
|
||
msgstr "Créer un nouveau fichier"
|
||
|
||
#: lazarusidestrconsts.lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr "Dépendance"
|
||
|
||
#: lazarusidestrconsts.lisa2pexistingfile2
|
||
msgid "Existing file: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr "Fichier déjà existant"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
||
msgid "File %s%s%s already exists in the package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
|
||
msgid "File already in package"
|
||
msgstr "Fichier déjà dans le paquet"
|
||
|
||
#: lazarusidestrconsts.lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr "Fichier en cours d'utilisation"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename
|
||
msgid "File name:"
|
||
msgstr "Nom de fichier:"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr "Nom de fichier"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr "Le fichier n'est pas une unité"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr "Type d'ancêtre non valide"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
||
msgid "Invalid Circular Dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr "Nom de class non valide"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr "Fichier non valide"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Nom de fichier non valide"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr "Nom d'unité non valide"
|
||
|
||
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
||
msgid "%s%s%s is not a valid unit name."
|
||
msgstr "%s%s%s n'est pas un nom d'unité valide."
|
||
|
||
#: lazarusidestrconsts.lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr "Nouveau nom de class:"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewcomponent
|
||
msgid "New Component"
|
||
msgstr "Nouveau composant"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr "Nouveau fichier"
|
||
|
||
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
||
msgstr "Pas de paquet trouvé pour la dépendance %s%s%s.%sChoisissez un paquet existant svp."
|
||
|
||
#: lazarusidestrconsts.lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr "Nom de page trop long"
|
||
|
||
#: lazarusidestrconsts.lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr "Page de palette :"
|
||
|
||
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr "Les unités Pascal doivent avoir l'extension .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr "Dialogue de sauvegarde de fichier"
|
||
|
||
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr "Raccourcir ou augmenter le nom de fichier"
|
||
|
||
#: lazarusidestrconsts.lisa2pshowall
|
||
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
||
msgid "Show all"
|
||
msgstr "Afficher Tout"
|
||
|
||
#: lazarusidestrconsts.lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr "Echanger les chemins"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Le type parent %s%s%s a le même nom que%sl'unité %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
||
msgstr "Le type parent %s%s%s n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
||
msgstr "Le nom de classe %s%s%s et le type ancêtre %s%s%s sont identiques"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
||
msgstr "Le nom de classe %s%s%s existe déjà dans%sPaquet %s%sFichier : %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Le nom de classe %s%s%s est identique au nom de%sl'unité %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
||
msgid "The class name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Le nom de classe %s%s%s n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s is already in the package."
|
||
msgstr "Le fichier %s%s%s est déjà dans le paquet."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr "Le fichier %s%s%s fait partie du projet en cours.%sC'est une mauvaise idée de partager des fichiers entre projets et paquets."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr "Le nom de fichier %s%s%s est ambigu, parce que le paquet n'a aucun répertoire par défaut.%sVeuillez indiquer un nom de fichier avec le chemin complet."
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La version maximale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "La version maximale est inférieure à la version minimale."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La version minimale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
||
msgid "The package has already a dependency for the package %s%s%s."
|
||
msgstr "Le paquet a déjà une dépendance avec le paquet %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
|
||
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
||
msgstr "Le nom de paquet %s%s%s est invalide.%sVeuillez choisir un paquet existant."
|
||
|
||
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name %s%s%s is too long (max 100 chars)."
|
||
msgstr "Le nom de page %s%s%s est trop long (max 100 caractères)."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
||
msgstr "Le nom d'unité %s%s%s existe déjà dans le paquet:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname %s%s%s already exists in this package."
|
||
msgstr "Le nom d'unité %s%s%s existe déjà dans ce paquet."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
||
msgstr "Le nom d'unité %s%s%s%set nom de fichier %s%s%s diffèrent."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name %s%s%s does not correspond to the filename."
|
||
msgstr "Le nom d'unité %s%s%s ne correspond pas au nom de fichier."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
||
msgstr "Le nom d'unité %s%s%s est le même qu'un composant installé.%sUtiliser ce nom peut causer d'étranges messages erreurs."
|
||
|
||
#: lazarusidestrconsts.lisa2punitfilename
|
||
msgid "Unit file name:"
|
||
msgstr "Nom de fichier de l'unité:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr "Nom du fichier de l'unité:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr "Nom d'unité:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr "Nom d'unité déjà existant"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr "Nom d'unité non valide"
|
||
|
||
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
|
||
msgid "Scan Unit for Unit Name and Register procedure"
|
||
msgstr "Rechercher dans l'unité son nom et la procédure Register"
|
||
|
||
#: lazarusidestrconsts.lisabandonchanges
|
||
msgid "Abandon changes?"
|
||
msgstr "Annuler les changements ?"
|
||
|
||
#: lazarusidestrconsts.lisabcreationfailed
|
||
msgid "Error occured during Application Bundle creation: "
|
||
msgstr "Une erreur est survenue pendant la création du Bundle Application :"
|
||
|
||
#: lazarusidestrconsts.lisabortall
|
||
msgid "Abort all"
|
||
msgstr "Arrêter tout"
|
||
|
||
#: lazarusidestrconsts.lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "Arrêter tous les chargements"
|
||
|
||
#: lazarusidestrconsts.lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "Arrêter le chargement du projet"
|
||
|
||
#: lazarusidestrconsts.lisabortwholeloading
|
||
msgid "Abort whole loading"
|
||
msgstr "Arrêter tous les chargements"
|
||
|
||
#: lazarusidestrconsts.lisaboutdocumentation
|
||
msgid "Documentation:"
|
||
msgstr "Documentation :"
|
||
|
||
#: lazarusidestrconsts.lisaboutide
|
||
msgid "About IDE"
|
||
msgstr "A propos de l'IDE"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "A propos de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarusmsg
|
||
#, fuzzy
|
||
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgstr "Licence : GPL/LGPL%sLazarus est un EDI pour créer des applications (graphiques et consoles ) avec Free Pascal. Free Pascal est un compilateur (L)GPL Pascal et Pascal Objet fonctionnant sous Windows, Linux, Mac OS X, FreeBSD et plus .%sLazarus est une pièce maîtresse pour le développement d'applications multi-plateformes. A l'image de Delphi (uniquement sous Windows) cet EDI (Environnement de développement intégré ou IDE en anglais) est un outil de \"Développement rapide d'applications\" (ou RAD an anglais).%sComme Lazarus croît nous avons besoin de plus de développeurs."
|
||
|
||
#: lazarusidestrconsts.lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr "Ne peut trouver la liste des contributeurs"
|
||
|
||
#: lazarusidestrconsts.lisaboutofficial
|
||
msgid "Official:"
|
||
msgstr "Officiel :"
|
||
|
||
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
||
msgstr "Un %s ne peut contenir de TControls.%sVous pouvez seulement y mettre des composants non visuels."
|
||
|
||
#: lazarusidestrconsts.lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr "Remerciements"
|
||
|
||
#: lazarusidestrconsts.lisaction
|
||
msgid "Action:"
|
||
msgstr "Action :"
|
||
|
||
#: lazarusidestrconsts.lisactions
|
||
msgid "Actions:"
|
||
msgstr "Actions :"
|
||
|
||
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr "Activer la syntaxe d'expression régulière pour le texte et les remplacements (assez semblable à perl)"
|
||
|
||
#: lazarusidestrconsts.lisactive
|
||
msgid "Active"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisactivefilter
|
||
msgid "Active Filter"
|
||
msgstr "Filtre actif"
|
||
|
||
#: lazarusidestrconsts.lisadddirectory
|
||
msgid "Add directory"
|
||
msgstr "Ajouter un répertoire"
|
||
|
||
#: lazarusidestrconsts.lisaddfilesofdirectory
|
||
msgid "Add files of directory"
|
||
msgstr "Ajouter fichiers du répertoire"
|
||
|
||
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
|
||
msgid "Additional compiler options inherited from packages"
|
||
msgstr "Options de compilation additionnelles héritées des paquets"
|
||
|
||
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
||
msgid "Add new build mode, copying settings from \"%s\""
|
||
msgstr "Ajoute un nouveau mode de création, copie les paramètres de \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisaddnewmacro
|
||
msgid "Add new macro"
|
||
msgstr "Ajoute une nouvelle macro"
|
||
|
||
#: lazarusidestrconsts.lisaddnewset
|
||
msgid "Add new set"
|
||
msgstr "Ajouter un nouveau jeux"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagerequirement
|
||
msgid "Add package requirement?"
|
||
msgstr "condition requise pour l\"ajout de paquet ?"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject
|
||
msgid "Add package %s to project?"
|
||
msgstr "Ajoute le paquet %s au projet?"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject2
|
||
msgid "Add package to project"
|
||
msgstr "Ajoute un paquet au projet"
|
||
|
||
#: lazarusidestrconsts.lisaddparameterbrackets
|
||
msgid "Add parameter brackets"
|
||
msgstr "Ajouter un paramètre entre parenthèses"
|
||
|
||
#: lazarusidestrconsts.lisaddress
|
||
msgid "Address:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddressbreakpoint
|
||
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
|
||
msgid "&Address Breakpoint ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
||
msgid "Add to include search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "Ajouter %s au projet?"
|
||
|
||
#: lazarusidestrconsts.lisaddtounitsearchpath
|
||
msgid "Add to unit search path?"
|
||
msgstr "Ajouter l'unité au chemin de recherche?"
|
||
|
||
#: lazarusidestrconsts.lisaddunitinterfaces
|
||
msgid "Add unit interfaces"
|
||
msgstr "Ajoutez les interfaces d'unité"
|
||
|
||
#: lazarusidestrconsts.lisaddunitnotrecommended
|
||
msgid "Add unit (not recommended)"
|
||
msgstr "Ajoutez une unité(non recommandé)"
|
||
|
||
#: lazarusidestrconsts.lisaddvalue
|
||
msgid "Add value:"
|
||
msgstr "Ajoute une valeur"
|
||
|
||
#: lazarusidestrconsts.lisaddvaluetomacro
|
||
msgid "Add value to macro %s"
|
||
msgstr "Ajoute une valeur à la macro %s"
|
||
|
||
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
||
#, fuzzy
|
||
#| msgid "Add file to a package"
|
||
msgid "Add File to Package"
|
||
msgstr "Ajouter un fichier au paquet"
|
||
|
||
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
||
#, fuzzy
|
||
#| msgid "Destination Package"
|
||
msgid "Destination package"
|
||
msgstr "Paquet de destination"
|
||
|
||
#: lazarusidestrconsts.lisaf2pfiletype
|
||
#, fuzzy
|
||
#| msgid "File Type"
|
||
msgid "File type"
|
||
msgstr "Type de fichier"
|
||
|
||
#: lazarusidestrconsts.lisaf2phasregisterprocedure
|
||
msgid "Has Register procedure"
|
||
msgstr "A une procédure Register"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr "Paquet non valide"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: %s%s%s"
|
||
msgstr "ID de paquet non valide : %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisaf2pisvirtualunit
|
||
msgid "Virtual unit (source is not in package)"
|
||
msgstr "Unité virtuelle (source pas dans le paquet)"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr "Le paquet est en lecture seule"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
||
msgid "Package %s%s%s not found."
|
||
msgstr "Paquet %s%s%s non trouvé"
|
||
|
||
#: lazarusidestrconsts.lisaf2pshowall
|
||
#, fuzzy
|
||
#| msgid "Show All"
|
||
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
||
msgid "Show all"
|
||
msgstr "Afficher tout"
|
||
|
||
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "Le fichier %s%s%s%s est déjà dans le paquet %s."
|
||
|
||
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr "Le paquet %s est en lecture seule."
|
||
|
||
#: lazarusidestrconsts.lisaf2punitname
|
||
#, fuzzy
|
||
#| msgid "Unit Name: "
|
||
msgid "Unit name: "
|
||
msgstr "Nom d'unité: "
|
||
|
||
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
||
msgid "A file %s%s%s already exists.%sReplace it?"
|
||
msgstr "Le fichier %s%s%s existe déjà. %Le remplacer ?"
|
||
|
||
#: lazarusidestrconsts.lisalignment
|
||
msgid "Alignment"
|
||
msgstr "Alignement"
|
||
|
||
#: lazarusidestrconsts.lisallblockslooksok
|
||
#, fuzzy
|
||
#| msgid "All blocks looks ok."
|
||
msgid "All blocks look ok."
|
||
msgstr "Tous les blocs sont ok."
|
||
|
||
#: lazarusidestrconsts.lisallfiles
|
||
msgid "All Files"
|
||
msgstr "Tous les fichiers"
|
||
|
||
#: lazarusidestrconsts.lisallinheritedoptions
|
||
msgid "All inherited options"
|
||
msgstr "Toutes les options héritées"
|
||
|
||
#: lazarusidestrconsts.lisallowfunctio
|
||
msgid "Allow Function Calls"
|
||
msgstr "Autoriser les appels de fonctions"
|
||
|
||
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr "Autoriser la recherche de lignes multiples"
|
||
|
||
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
||
msgid "All parameters of this function are already set at this call. Nothing to add."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
||
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
||
msgstr "Toutes vos modifications %s%s%s%s seront perdues et le fichier réouvert."
|
||
|
||
#: lazarusidestrconsts.lisalternativekey
|
||
msgid "Alternative key"
|
||
msgstr "Touche alternative"
|
||
|
||
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
||
msgid "Alternative key (or 2 key sequence)"
|
||
msgstr "Touche alternative (ou une séquence de 2 touches)"
|
||
|
||
#: lazarusidestrconsts.lisalways
|
||
msgid "Always"
|
||
msgstr "Toujours"
|
||
|
||
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
||
msgid "Always convert suggested default file name to lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalwaysignore
|
||
msgid "Always ignore"
|
||
msgstr "Ignore toujours"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr "Fichier litigieux trouvé"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
||
msgstr "Fichier litigieux trouvé: %s%s%s%sCe fichier peut être confondu avec %s%s%s%s%sSupprimer le fichier litigieux ?"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr "Fichiers ambigus trouvés"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound
|
||
msgid "Ambiguous Unit found"
|
||
msgstr "Unité ambigüe trouvée"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound2
|
||
msgid "Ambiguous unit found"
|
||
msgstr "Unité ambigüe trouvée"
|
||
|
||
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr "Editeur d'ancre - aucune commande choisie"
|
||
|
||
#: lazarusidestrconsts.lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr "Activer = Inclure %s dans les ancres"
|
||
|
||
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr "Ancres des commandes sélectionnées "
|
||
|
||
#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
|
||
msgid "Anchor to bottom side of sibling, keep border space"
|
||
msgstr "Ancrer au côté inférieur du contrôle, préserver l'espace de bordure"
|
||
|
||
#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
|
||
msgid "Anchor to left side of sibling, keep border space"
|
||
msgstr "Ancrer au côté gauche du contrôle, préserver l'espace de bordure"
|
||
|
||
#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
|
||
msgid "Anchor to right side of sibling, keep border space"
|
||
msgstr "Ancrer au côté droit du contrôle, préserver l'espace de bordure"
|
||
|
||
#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
|
||
msgid "Anchor to top side of sibling, keep border space"
|
||
msgstr "Ancrer au côté supérieur du contrôle, préserver l'espace de bordure"
|
||
|
||
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
||
msgstr "Un erreur a eu lieu au démarrage précédent pendant le chargement %s!%s%sCharger ce projet à nouveau ?"
|
||
|
||
#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
|
||
msgid "Append short description to long description"
|
||
msgstr "Ajouter une brève description à la longue description"
|
||
|
||
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
|
||
#, fuzzy
|
||
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
||
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
|
||
msgstr "Application%sUn programme graphique LCL/FreePascal. Le fichier programme est automatiquement géré par Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisapplicationclassname
|
||
msgid "&Application class name"
|
||
msgstr "Nom de class &Application"
|
||
|
||
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
||
msgid "apply build flags (-B) to dependencies too"
|
||
msgstr "applique l'indicateur de création (-B) aux dépendances aussi"
|
||
|
||
#: lazarusidestrconsts.lisapplyconventions
|
||
msgid "Apply conventions"
|
||
msgstr "Applique les conventions"
|
||
|
||
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
||
msgid "A project unit can not be used by other packages/projects"
|
||
msgstr "Une unité du projet ne peut pas être utilisée par d'autres paquets/projets"
|
||
|
||
#: lazarusidestrconsts.lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr "L'espace de bordure autour de la commande. Les quatre autres espaces de bordures sont ajoutés à cette valeur."
|
||
|
||
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
||
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
||
msgstr "Un simple fichier programme en pascal. %sCela peut être utilisé pour un essai rapide. %sCréez plutôt un nouveau projet."
|
||
|
||
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr "Demander avant de remplacer chaque texte trouvé"
|
||
|
||
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
||
msgid "Ask for component name after putting it on a designer form"
|
||
msgstr "demande le nom du composant après l'avoir déposé sur le concepteur de fiche"
|
||
|
||
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
||
msgid "Ask for file name on new file"
|
||
msgstr "Demander le nom de fichier pour les nouveaux fichiers"
|
||
|
||
#: lazarusidestrconsts.lisasknameoncreate
|
||
msgid "Ask name on create"
|
||
msgstr "Demande le nom de fichier pendant la création"
|
||
|
||
#: lazarusidestrconsts.lisautocompletionoff
|
||
msgid "Auto completion: off"
|
||
msgstr "complétion automatique: off"
|
||
|
||
#: lazarusidestrconsts.lisautocompletionon
|
||
msgid "Auto completion: on"
|
||
msgstr "Auto complétion: on"
|
||
|
||
#: lazarusidestrconsts.lisautocontinue
|
||
msgid "Auto Continue"
|
||
msgstr "Continue automatiquement"
|
||
|
||
#: lazarusidestrconsts.lisautocontinueafter
|
||
msgid "Auto continue after:"
|
||
msgstr "Continue automatiquement après:"
|
||
|
||
#: lazarusidestrconsts.lisautomarkup
|
||
msgid "Markup and Matches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomatic
|
||
msgctxt "lazarusidestrconsts.lisautomatic"
|
||
msgid "Automatic"
|
||
msgstr "Automatique"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
|
||
msgid "Automatically convert .lfm files to .lrs include files"
|
||
msgstr "converti automatiquement les fichiers .lfm vers les fichiers d'inclusion .lrs"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
||
msgid "Automatically invoke after point"
|
||
msgstr "Appelé automatiquement après le point"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr "Saut de ligne"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr "Espace"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr "Fin de mot"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr "N'ajoutez pas de caractère"
|
||
|
||
#: lazarusidestrconsts.lisautomaticfeatures
|
||
#, fuzzy
|
||
#| msgid "Automatic features"
|
||
msgid "Completion and Hints"
|
||
msgstr "Dispositifs automatiques "
|
||
|
||
#: lazarusidestrconsts.lisautoshowobjectinspector
|
||
msgid "Auto show"
|
||
msgstr "Afficher automatiquement l'Inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts.lisavailablepackages
|
||
msgid "Available packages"
|
||
msgstr "Paquets disponibles"
|
||
|
||
#: lazarusidestrconsts.lisbackupchangedfiles
|
||
msgid "Make backup of changed files"
|
||
msgstr "Faire la sauvegarde des fichiers ayant changé"
|
||
|
||
#: lazarusidestrconsts.lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "La sauvegarde du fichier a échoué"
|
||
|
||
#: lazarusidestrconsts.lisbackuphint
|
||
msgid "Creates a Backup directory under project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr "Le changement du nom ou de la version d'un paquet brise les dépendances. Est-ce que ces dépendances doivent être changées aussi?%sOui pour modifier toutes les dépendances listées. %Ignorer pour briser les dépendances et continuer."
|
||
|
||
#: lazarusidestrconsts.lisbegins
|
||
msgid "begins"
|
||
msgstr "commence"
|
||
|
||
#: lazarusidestrconsts.lisbehindrelated
|
||
#, fuzzy
|
||
msgid "Behind related"
|
||
msgstr "Derrière les méthodes"
|
||
|
||
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
||
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
||
#, fuzzy
|
||
#| msgid "Always Build before Run"
|
||
msgid "Always build before run"
|
||
msgstr "Toujours lancer la création avant l'exécution"
|
||
|
||
#: lazarusidestrconsts.lisbfbuild
|
||
msgctxt "lazarusidestrconsts.lisbfbuild"
|
||
msgid "Build"
|
||
msgstr "Créer"
|
||
|
||
#: lazarusidestrconsts.lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr "Commande de création"
|
||
|
||
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr "A la création du projet, lancer la commande création de fichier à la place"
|
||
|
||
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr "A l'éxécution du projet, lancer la commande Exécurer Fichier à la place"
|
||
|
||
#: lazarusidestrconsts.lisbfrun
|
||
msgctxt "lazarusidestrconsts.lisbfrun"
|
||
msgid "Run"
|
||
msgstr "Exécuter"
|
||
|
||
#: lazarusidestrconsts.lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr "Exécuter une commande"
|
||
|
||
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
||
#, fuzzy
|
||
#| msgid "When this file is active in source editor ..."
|
||
msgid "When this file is active in source editor"
|
||
msgstr "Quand ce fichier est en cours d'utilisation dans l'éditeur de source ..."
|
||
|
||
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
||
#, fuzzy
|
||
#| msgid "Working directory (Leave empty for file path)"
|
||
msgid "Working directory (leave empty for file path)"
|
||
msgstr "Répertoire de travail (laisser vide pour le chemin de fichier)"
|
||
|
||
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
||
msgid "Bold non default values"
|
||
msgstr "Valeurs modifiées en gras"
|
||
|
||
#: lazarusidestrconsts.lisborderspace
|
||
#, fuzzy
|
||
#| msgid "BorderSpace"
|
||
msgid "Border space"
|
||
msgstr "Espace de bordure"
|
||
|
||
#: lazarusidestrconsts.lisbottom
|
||
msgctxt "lazarusidestrconsts.lisbottom"
|
||
msgid "Bottom"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr "L'espace inférieur de bordure. Cette valeur est ajoutée à l'espace bas de bordure et employée pour l'espace au-dessous de la commande."
|
||
|
||
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr "Ancrage au bas de page"
|
||
|
||
#: lazarusidestrconsts.lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
||
msgstr "C'est le contrôle à laquelle le côté inférieur est ancré. Laisser vide pour le parent."
|
||
|
||
#: lazarusidestrconsts.lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr "Espacement égal au bas"
|
||
|
||
#: lazarusidestrconsts.lisbreak
|
||
msgctxt "lazarusidestrconsts.lisbreak"
|
||
msgid "Break"
|
||
msgstr "Pause"
|
||
|
||
#: lazarusidestrconsts.lisbreakpointproperties
|
||
msgid "Breakpoint Properties"
|
||
msgstr "Propriétés du point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.lisbrowseforcompiler
|
||
msgid "Browse for Compiler (%s)"
|
||
msgstr "Rechercher le compilateur (%s)"
|
||
|
||
#: lazarusidestrconsts.lisbtnbreak
|
||
msgctxt "lazarusidestrconsts.lisbtnbreak"
|
||
msgid "Break"
|
||
msgstr "Pause"
|
||
|
||
#: lazarusidestrconsts.lisbtncontinue
|
||
msgctxt "lazarusidestrconsts.lisbtncontinue"
|
||
msgid "Continue"
|
||
msgstr "Continuer"
|
||
|
||
#: lazarusidestrconsts.lisbtnfind
|
||
msgid "&Find"
|
||
msgstr "&Rechercher"
|
||
|
||
#: lazarusidestrconsts.lisbtnreplace
|
||
msgid "&Replace"
|
||
msgstr "&Remplacer"
|
||
|
||
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
||
msgid "build all files of project/package/IDE"
|
||
msgstr "Créer tous les fichiers de project/package/IDE"
|
||
|
||
#: lazarusidestrconsts.lisbuildidewithpackages
|
||
msgid "build IDE with packages"
|
||
msgstr "Créer l' IDE avec les paquets"
|
||
|
||
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
||
msgid "Building Lazarus failed"
|
||
msgstr "La création de Lazarus a échouée"
|
||
|
||
#: lazarusidestrconsts.lisbuildmode
|
||
msgid "Build mode"
|
||
msgstr "Mode création"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
||
msgid "Differences between build modes"
|
||
msgstr "Différences entre les modes de création"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
||
msgid "Differences to other build modes"
|
||
msgstr "Différences avec d'autres modes de création"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffmode
|
||
msgid "Mode:"
|
||
msgstr "Mode:"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodes
|
||
msgid "Build modes"
|
||
msgstr "Modes de création"
|
||
|
||
#: lazarusidestrconsts.lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "Création d'un nouveau projet"
|
||
|
||
#: lazarusidestrconsts.lisbuildnumber
|
||
#, fuzzy
|
||
#| msgid "Build Number"
|
||
msgid "Build number"
|
||
msgstr "Numéro de création"
|
||
|
||
#: lazarusidestrconsts.lisbuildproject
|
||
msgid "Build project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
||
msgid "Calling %s to create Makefile from %s failed."
|
||
msgstr "L'appel de %s pour créer le Makefile depuis %s a échoué."
|
||
|
||
#: lazarusidestrconsts.liscallstacknotevaluated
|
||
msgid "Stack not evaluated"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscancel
|
||
msgctxt "lazarusidestrconsts.liscancel"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr "Annuler le chargement de ce composant"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr "Abandonner le chargement d'unité"
|
||
|
||
#: lazarusidestrconsts.liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr "Abandonner le renommage"
|
||
|
||
#: lazarusidestrconsts.liscannotcompileproject
|
||
msgid "Cannot compile project"
|
||
msgstr "Ne peut pas compiler le projet"
|
||
|
||
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
||
msgid "Can not copy top level component."
|
||
msgstr "Ne peut copier le composant de niveau supérieur"
|
||
|
||
#: lazarusidestrconsts.liscannotcreatefile
|
||
msgid "Can not create file %s%s%s"
|
||
msgstr "Impossible de créer le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
||
msgid "Cannot find lazarus starter:%s%s"
|
||
msgstr "Lanceur Lazarus introuvable:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr "Peut seulement changer la classe de TComponents."
|
||
|
||
#: lazarusidestrconsts.liscaptiondiff
|
||
msgctxt "lazarusidestrconsts.liscaptiondiff"
|
||
msgid "Diff"
|
||
msgstr "Différences"
|
||
|
||
#: lazarusidestrconsts.liscbpfiles
|
||
msgid "%s (%s files)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
||
msgid "Really delete %s source files%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccdchangeclassof
|
||
msgid "Change Class of %s"
|
||
msgstr "Changer la classes de %s"
|
||
|
||
#: lazarusidestrconsts.lisccdnoclass
|
||
msgid "no class"
|
||
msgstr "Aucune classe"
|
||
|
||
#: lazarusidestrconsts.lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr "Compilateur Ambigu"
|
||
|
||
#: lazarusidestrconsts.lisccochecktestdir
|
||
#, fuzzy
|
||
#| msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
||
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
||
msgstr "Veuillez vérifier le répertoire de Test dans %sEnvironment -> Options d'environnement -> Fichiers -> Répertoire pour création de projets tests"
|
||
|
||
#: lazarusidestrconsts.lisccocompilernotanexe
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr "Le compilateur \"%s\" n'est pas un fichier exécutable. %s Détails : %s"
|
||
|
||
#: lazarusidestrconsts.lisccocontains
|
||
msgid "contains "
|
||
msgstr "contient "
|
||
|
||
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr "Copier la sortie vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.lisccodatesdiffer
|
||
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr "Les dates des fichiers .ppu de FPC diffèrent de plus d'une heure. %s Cela peut signifier, qu'elles proviennent de deux installations différentes. %s Fichier1 : %s%s Fichier 2 : %s"
|
||
|
||
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
|
||
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
||
msgstr "Fichier de message Anglais fpc est manquant : composants/codetools/fpc.errore.msg"
|
||
|
||
#: lazarusidestrconsts.lisccoerrorcaption
|
||
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
||
msgid "Error"
|
||
msgstr "Erreur"
|
||
|
||
#: lazarusidestrconsts.lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr "ERREUR :"
|
||
|
||
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr "Chemin des unités FPC contient une source :"
|
||
|
||
#: lazarusidestrconsts.lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr "Symboles de retour à la ligne"
|
||
|
||
#: lazarusidestrconsts.lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr "CONSEIL :"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr "Compilateur non valide"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr "Chemin de recherche non valide"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr "Répertoire Test non valide"
|
||
|
||
#: lazarusidestrconsts.lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr "Unité manquante"
|
||
|
||
#: lazarusidestrconsts.lisccomsgppunotfound
|
||
msgid "compiled FPC unit not found: %s.ppu"
|
||
msgstr "Unité FPC compilée introuvable : %s.ppu"
|
||
|
||
#: lazarusidestrconsts.lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr "Multiples configurations de compilateur trouvées :"
|
||
|
||
#: lazarusidestrconsts.liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr "Aucun fpc.cfg trouvé"
|
||
|
||
#: lazarusidestrconsts.lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr "Sans ASCII"
|
||
|
||
#: lazarusidestrconsts.lisccoppuexiststwice
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr "PPU existe deux fois: %s, %s"
|
||
|
||
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
||
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
||
msgstr "L'unité FPC compilée %s.ppu n'a pas été retrouvée.%s Ce message signifie généralement que votre fpc.cfg a un bug. Ou que votre installation FPC est cassée."
|
||
|
||
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr "Il y a un fichier .ppu plus ancien que le compilateur lui-même: %s%s"
|
||
|
||
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
|
||
msgid "relative unit path found in fpc cfg: %s"
|
||
msgstr "Chemin relatif de l'unité trouvé dans fpc cfg:%s"
|
||
|
||
#: lazarusidestrconsts.lisccoseveralcompilers
|
||
#, fuzzy
|
||
#| msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr "Il y a plusieurs FreePascal Compilateurs dans votre chemin. %s%s%s Peut-être avez-vous oublié de supprimer un vieux compilateur ?"
|
||
|
||
#: lazarusidestrconsts.lisccoskip
|
||
msgid "Skip"
|
||
msgstr "Ignorer"
|
||
|
||
#: lazarusidestrconsts.lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr "Caractères spéciaux"
|
||
|
||
#: lazarusidestrconsts.lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr "Tous les tests ont réussi."
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr "Impossible de créer le fichier de test"
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
||
msgid "Unable to create Test pascal file \"%s\"."
|
||
msgstr "Impossible de créer le fichier de test Pascal \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisccounabletogetfiledate
|
||
msgid "Unable to get file date of %s."
|
||
msgstr "Impossible d'obtenir la date du fichier %s."
|
||
|
||
#: lazarusidestrconsts.lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr "Caractères insolites"
|
||
|
||
#: lazarusidestrconsts.lisccowarningcaption
|
||
msgid "Warning"
|
||
msgstr "Attention"
|
||
|
||
#: lazarusidestrconsts.lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr "ATTENTION :"
|
||
|
||
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr "Mauvais chemin du délimiteur"
|
||
|
||
#: lazarusidestrconsts.liscecategories
|
||
msgid "Categories"
|
||
msgstr "Catégories"
|
||
|
||
#: lazarusidestrconsts.liscecomplexitygroup
|
||
msgid "Complexity"
|
||
msgstr "Complexité"
|
||
|
||
#: lazarusidestrconsts.lisceconstants
|
||
msgid "Constants"
|
||
msgstr "Constantes"
|
||
|
||
#: lazarusidestrconsts.lisceemptyblocks
|
||
msgid "Empty blocks"
|
||
msgstr "blocs vides"
|
||
|
||
#: lazarusidestrconsts.lisceemptyclasssections
|
||
msgid "Empty class sections"
|
||
msgstr "Sections de classe vide"
|
||
|
||
#: lazarusidestrconsts.lisceemptygroup
|
||
msgid "Empty constructs"
|
||
msgstr "Vider les constructions"
|
||
|
||
#: lazarusidestrconsts.lisceemptyprocedures
|
||
msgid "Empty procedures"
|
||
msgstr "Procédures vides"
|
||
|
||
#: lazarusidestrconsts.liscefilter
|
||
msgid "(Filter)"
|
||
msgstr "(Filtre)"
|
||
|
||
#: lazarusidestrconsts.liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr "Suivre le curseur"
|
||
|
||
#: lazarusidestrconsts.liscein
|
||
msgctxt "lazarusidestrconsts.liscein"
|
||
msgid "%s in %s"
|
||
msgstr "%s dans %s"
|
||
|
||
#: lazarusidestrconsts.lisceisarootcontrol
|
||
#, fuzzy
|
||
msgid "Is a root control"
|
||
msgstr "Le contrôle nécessite un parent"
|
||
|
||
#: lazarusidestrconsts.liscelongparamlistcount
|
||
#, fuzzy
|
||
#| msgid "Parameters count treating as \"many\""
|
||
msgid "Parameters count treated as \"many\""
|
||
msgstr "Nombre de paramètres traités comme \"beaucoup\""
|
||
|
||
#: lazarusidestrconsts.liscelongprocedures
|
||
msgid "Long procedures"
|
||
msgstr "Procédures longues"
|
||
|
||
#: lazarusidestrconsts.liscelongproclinecount
|
||
msgid "Line count of procedure treated as \"long\""
|
||
msgstr "Nombre de lignes de la procédure traité comme \"long\""
|
||
|
||
#: lazarusidestrconsts.liscemanynestedprocedures
|
||
msgid "Many nested procedures"
|
||
msgstr "plusieurs procédures imbriquées"
|
||
|
||
#: lazarusidestrconsts.liscemanyparameters
|
||
msgid "Many parameters"
|
||
msgstr "Beaucoup de paramètres"
|
||
|
||
#: lazarusidestrconsts.liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr "Afficher les catégories"
|
||
|
||
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr "Afficher les nœuds sources"
|
||
|
||
#: lazarusidestrconsts.liscenestedproccount
|
||
#, fuzzy
|
||
#| msgid "Nested procedures count treating as \"many\""
|
||
msgid "Nested procedures count treated as \"many\""
|
||
msgstr "procédures imbriquées avec un nombre qualifié de \"beaucoup\""
|
||
|
||
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling"
|
||
msgstr "Commande centrale horizontale relative au contrôle donné"
|
||
|
||
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling"
|
||
msgstr "Commande centrale verticale relative au contrôle donné"
|
||
|
||
#: lazarusidestrconsts.liscenterform
|
||
#, fuzzy
|
||
#| msgid "Center form"
|
||
msgid "Center Form"
|
||
msgstr "Centre la fiche"
|
||
|
||
#: lazarusidestrconsts.liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "Centrer dans la fenêtre"
|
||
|
||
#: lazarusidestrconsts.liscenters
|
||
msgid "Centers"
|
||
msgstr "Centres"
|
||
|
||
#: lazarusidestrconsts.lisceomode
|
||
#, fuzzy
|
||
#| msgid "Preferred Exhibition Mode"
|
||
msgid "Preferred exhibition mode"
|
||
msgstr "Mode d'exposition préféré"
|
||
|
||
#: lazarusidestrconsts.lisceomodecategory
|
||
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
||
msgid "Category"
|
||
msgstr "Catégorie"
|
||
|
||
#: lazarusidestrconsts.lisceomodesource
|
||
msgctxt "lazarusidestrconsts.lisceomodesource"
|
||
msgid "Source"
|
||
msgstr "Source"
|
||
|
||
#: lazarusidestrconsts.lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr "Jamais, seulement manuellement"
|
||
|
||
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr "Seulement utilisé dans le mode catégorie"
|
||
|
||
#: lazarusidestrconsts.lisceoonidle
|
||
msgid "On idle"
|
||
msgstr "Quand inoccupée."
|
||
|
||
#: lazarusidestrconsts.lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr "Rafraîchir automatiquement"
|
||
|
||
#: lazarusidestrconsts.lisceothergroup
|
||
msgctxt "lazarusidestrconsts.lisceothergroup"
|
||
msgid "Other"
|
||
msgstr "Autre"
|
||
|
||
#: lazarusidestrconsts.lisceoupdate
|
||
msgid "Update"
|
||
msgstr "Mise à jour "
|
||
|
||
#: lazarusidestrconsts.lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr "En commutant le fichier dans l'éditeur de source "
|
||
|
||
#: lazarusidestrconsts.lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr "Procédures"
|
||
|
||
#: lazarusidestrconsts.lisceproperties
|
||
msgctxt "lazarusidestrconsts.lisceproperties"
|
||
msgid "Properties"
|
||
msgstr "Propriétés "
|
||
|
||
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
||
msgid "Published properties without default"
|
||
msgstr "Propriétés published sans défaut"
|
||
|
||
#: lazarusidestrconsts.lisceshowcodeobserver
|
||
msgid "Show observerations about"
|
||
msgstr "montre les observations à propos"
|
||
|
||
#: lazarusidestrconsts.liscestylegroup
|
||
msgctxt "lazarusidestrconsts.liscestylegroup"
|
||
msgid "Style"
|
||
msgstr "Style"
|
||
|
||
#: lazarusidestrconsts.liscesurrounding
|
||
msgid "Surrounding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscetodos
|
||
msgid "ToDos"
|
||
msgstr "ToDos"
|
||
|
||
#: lazarusidestrconsts.liscetypes
|
||
msgid "Types"
|
||
msgstr "Types"
|
||
|
||
#: lazarusidestrconsts.lisceunnamedconstants
|
||
msgid "Unnamed constants"
|
||
msgstr "constantes sans nom"
|
||
|
||
#: lazarusidestrconsts.lisceunsortedmembers
|
||
msgid "Unsorted members"
|
||
msgstr "membres non triés"
|
||
|
||
#: lazarusidestrconsts.lisceunsortedvisibility
|
||
msgid "Unsorted visibility"
|
||
msgstr "Visibilité non triée"
|
||
|
||
#: lazarusidestrconsts.lisceuses
|
||
msgctxt "lazarusidestrconsts.lisceuses"
|
||
msgid "Uses"
|
||
msgstr "Uses"
|
||
|
||
#: lazarusidestrconsts.liscevariables
|
||
msgid "Variables"
|
||
msgstr "Variables"
|
||
|
||
#: lazarusidestrconsts.liscewrongindentation
|
||
msgid "Wrong indentation"
|
||
msgstr "Mauvaise indentation"
|
||
|
||
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
|
||
msgid "An exception occured during deletion of%s\"%s:%s\"%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfecancelloadingthisresource
|
||
msgid "Cancel loading this resource"
|
||
msgstr "Annuler le téléchargement de cette ressource"
|
||
|
||
#: lazarusidestrconsts.liscfeclassnotfound
|
||
msgid "%s%sClass \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfecomponent
|
||
msgid "%s%sComponent: %s:%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfecomponentclass
|
||
msgid "%s%sComponent Class: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfecontinueloading
|
||
msgid "Continue loading"
|
||
msgstr "Continuer le téléchargement"
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
||
msgid "Do not know how to copy this form editing selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
||
msgid "Do not know how to cut this form editing selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
||
msgid "Do not know how to delete this form editing selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
||
msgid "Error creating component"
|
||
msgstr "Erreur de création du composant"
|
||
|
||
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
||
msgid "Error creating component: %s%s%s"
|
||
msgstr "Erreur de création du composant : %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
||
msgid "Error destroying component"
|
||
msgstr "Erreur de destruction du composant"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
||
msgid "Error destroying component of type %s of unit %s:%s%s"
|
||
msgstr "Erreur de destruction du composant de type %s de l'unité %s:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
||
msgid "Error destroying mediator"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
||
msgid "Error destroying mediator %s of unit %s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeerrorreading
|
||
msgid "Error reading %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeinfile
|
||
msgid "%sIn file %s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
||
msgid "Invalid component owner"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscferoot
|
||
msgid "%sRoot=%s:%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfestopallloading
|
||
msgid "Stop all loading"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfestream
|
||
msgid "%sStream=%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfestreamposition
|
||
msgid "%s%sStream position: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
||
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
||
msgstr "TCustomFormEditor.CreateNonFormForm existe déjà"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
||
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
||
msgstr "TCustomFormEditor.CreateNonFormForm type inconnu %s"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
||
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
||
msgstr "TCustomFormEditor.DeleteComponent Où est le TCustomNonFormDesignerForm? %s"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
||
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
||
msgstr "TCustomFormEditor.RegisterDesignerMediator déjà enregistré: %s"
|
||
|
||
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
||
msgid "The component of type %s failed to set its owner to %s:%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
||
msgid "Unable to clear the form editing selection%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangebuildmode
|
||
msgid "Change build mode"
|
||
msgstr "Change le mode de création"
|
||
|
||
#: lazarusidestrconsts.lischangeclass
|
||
msgid "Change Class"
|
||
msgstr "Modifier la classe"
|
||
|
||
#: lazarusidestrconsts.lischangeencoding
|
||
msgid "Change Encoding"
|
||
msgstr "Changer l'encodage"
|
||
|
||
#: lazarusidestrconsts.lischangefile
|
||
msgid "Change file"
|
||
msgstr "Changer de fichier"
|
||
|
||
#: lazarusidestrconsts.lischangeparent
|
||
#, fuzzy
|
||
#| msgid "Change Parent..."
|
||
msgid "Change Parent"
|
||
msgstr "Changer le parent..."
|
||
|
||
#: lazarusidestrconsts.lischangeswerenotsaved
|
||
msgid "Changes were not saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangetounix
|
||
msgid "Change to Unix /"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangetowindows
|
||
msgid "Change to Windows \\"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischaracter
|
||
msgid "Character"
|
||
msgstr "Caractère"
|
||
|
||
#: lazarusidestrconsts.lischaractermap
|
||
msgid "Character Map"
|
||
msgstr "Table des caractères"
|
||
|
||
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontentratherthantimesta
|
||
msgid "Check for disk file changes via content rather than timestamp"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
||
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckoptions
|
||
msgid "Check options"
|
||
msgstr "Vérifiez les options"
|
||
|
||
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
||
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr "Choisissez un nom différent"
|
||
|
||
#: lazarusidestrconsts.lischooseafpdoclink
|
||
msgid "Choose a FPDoc link"
|
||
msgstr "Choisissez un lien FPDoc"
|
||
|
||
#: lazarusidestrconsts.lischooseakey
|
||
msgid "Choose a key ..."
|
||
msgstr "Choisir une touche ..."
|
||
|
||
#: lazarusidestrconsts.lischooseanameforthenewcomponent
|
||
msgid "Choose a name for the new component"
|
||
msgstr "Choisir un nom de pour le nouveau composant"
|
||
|
||
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
||
msgid "Choose an FPC message file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
||
msgid "Choose a pascal file for indentation examples"
|
||
msgstr "Choisissez un fichier Pascal pour des exemples d'indentation"
|
||
|
||
#: lazarusidestrconsts.lischoosecompilermessages
|
||
msgid "Choose compiler messages file"
|
||
msgstr "Choisir le fichier des messages de compilation"
|
||
|
||
#: lazarusidestrconsts.lischoosecompilerpath
|
||
msgid "Choose compiler filename (%s)"
|
||
msgstr "Choisissez le nom de fichier du compilateur"
|
||
|
||
#: lazarusidestrconsts.lischoosedebuggerpath
|
||
msgid "Choose debugger filename"
|
||
msgstr "Choisissez le nom de fichier du débogueur"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr "Choisissez le paquet Delphi (*.dpk)"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr "Choisissez le projet Delphi (*.dpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr "Choisissez l'unité Delphi (*.pas)"
|
||
|
||
#: lazarusidestrconsts.lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr "Choisissez le répertoire"
|
||
|
||
#: lazarusidestrconsts.lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr "Choisissez le répertoire des sources de FPC"
|
||
|
||
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr "Choisissez le répertoire de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lischoosemakepath
|
||
msgid "Choose make path"
|
||
msgstr "Choisissez le chemin \"make\""
|
||
|
||
#: lazarusidestrconsts.lischoosename
|
||
msgid "Choose name"
|
||
msgstr "Choisissez le nom"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr "Choisissez un de ces éléments pour créer un nouveau fichier"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr "Choisissez un de ces items pour créer un nouveau paquet"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr "Choisissez un de ces items pour créer un nouveau projet"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
||
msgid "Choose one of these items to inherit from an existing one"
|
||
msgstr "Choisissez un de ces éléments pour hériter d'un existant"
|
||
|
||
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr "Choisissez le source du programme (*.pp,*.pas,*.lpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr "Choisissez la structure pour entourer la sélection"
|
||
|
||
#: lazarusidestrconsts.lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr "Choisissez le répertoire de tests"
|
||
|
||
#: lazarusidestrconsts.liscirculardependencydetected
|
||
msgid "Circular dependency detected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclasscompletion
|
||
msgid "Class Completion"
|
||
msgstr "Complétion de classe"
|
||
|
||
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
|
||
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
||
msgstr "Conflits de classe avec le fichier .lfm : %s L'unité %s%s utilise l'unité %s%squi contient la classe %s,%smais le fichier .lfm contient déjà une autre classe.%s Il ne peut y avoir qu'une conception de classe par unité.%sS’il vous plaît déplacez %s dans une autre unité."
|
||
|
||
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
||
msgid "Classes and properties exist. Values were not checked."
|
||
msgstr "Les classes et les propriétés existent. Les valeurs n'ont pas été vérifiées."
|
||
|
||
#: lazarusidestrconsts.lisclassesppunotfoundcheckyourfpccfg
|
||
msgid "classes.ppu not found. Check your fpc.cfg."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
||
msgstr "La classe %s%s%s n'est pas une classe de composants référencée.%sIncapable de coller."
|
||
|
||
#: lazarusidestrconsts.lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr "Classe introuvable"
|
||
|
||
#: lazarusidestrconsts.lisclassofmethodnotfound
|
||
msgid "Class %s%s%s of method %s%s%s not found."
|
||
msgstr "Class %s%s%s de la méthode %s%s%s introuvable."
|
||
|
||
#: lazarusidestrconsts.liscldirclean
|
||
msgid "Clean"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "Nettoyage de répertoire"
|
||
|
||
#: lazarusidestrconsts.liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "Nettoyer les sous-répertoires"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr "Préserver tous les fichiers texte"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr "Préserver les fichiers correspondant au filtre"
|
||
|
||
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr "Retirer les fichiers correspondants au filtre"
|
||
|
||
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr "Syntaxe simple (i.e. * au lieu de .*)"
|
||
|
||
#: lazarusidestrconsts.liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr "Nettoyer les sources Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscleanupandbuild
|
||
msgid "Clean up and build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscleanupandbuildproject
|
||
msgid "Clean up and build project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr "nettoyer le chemin des unités"
|
||
|
||
#: lazarusidestrconsts.liscleardirectory
|
||
msgid "Clear Directory?"
|
||
msgstr "Nettoyer le répertoire ?"
|
||
|
||
#: lazarusidestrconsts.lisclearkeymapping
|
||
msgid "Clear Key Mapping"
|
||
msgstr "Effacer l' affectation des touches "
|
||
|
||
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr "Cliquez ici pour parcourir le fichier"
|
||
|
||
#: lazarusidestrconsts.lisclicktoseethepossibleuses
|
||
msgid "Click to see the possible uses"
|
||
msgstr "Cliquez pour voir les utilisations possibles"
|
||
|
||
#: lazarusidestrconsts.lisclose
|
||
msgid "&Close"
|
||
msgstr "&Fermer"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsclose
|
||
msgid "Close files"
|
||
msgstr "Fermer les fichiers"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabshide
|
||
msgid "Hide window"
|
||
msgstr "Cacher la fenêtre"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsquestion
|
||
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
||
msgstr "Fermere une fenêtre de l'éditeur de source. Voulez-vous fermer tous les fichiers ou masquer la fenêtre?"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabstitle
|
||
msgid "Close Source Editor Window"
|
||
msgstr "Fermer la fenêtre d'édition source"
|
||
|
||
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr "Options spécifiques à l'interface LCL:"
|
||
|
||
#: lazarusidestrconsts.liscmparameter
|
||
msgid "Parameter"
|
||
msgstr "Paramêtre"
|
||
|
||
#: lazarusidestrconsts.liscmplstcomponents
|
||
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
||
msgid "Components"
|
||
msgstr "Composants"
|
||
|
||
#: lazarusidestrconsts.liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr "Héritage"
|
||
|
||
#: lazarusidestrconsts.liscmplstlist
|
||
msgid "List"
|
||
msgstr "Liste"
|
||
|
||
#: lazarusidestrconsts.liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr "Palette"
|
||
|
||
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr "Fichier litigieux de configuration additionnel du compilateur"
|
||
|
||
#: lazarusidestrconsts.liscocallon
|
||
msgid "Call on:"
|
||
msgstr "Appel sur :"
|
||
|
||
#: lazarusidestrconsts.liscocallonbuild
|
||
msgctxt "lazarusidestrconsts.liscocallonbuild"
|
||
msgid "Build"
|
||
msgstr "Créer"
|
||
|
||
#: lazarusidestrconsts.liscocalloncompile
|
||
msgctxt "lazarusidestrconsts.liscocalloncompile"
|
||
msgid "Compile"
|
||
msgstr "Compiler"
|
||
|
||
#: lazarusidestrconsts.liscocallonrun
|
||
msgctxt "lazarusidestrconsts.liscocallonrun"
|
||
msgid "Run"
|
||
msgstr "Exécuter"
|
||
|
||
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
||
msgid "%s%sClick OK if you are sure to do that."
|
||
msgstr "%s%sCliquez sur OK si vous en êtes sûr"
|
||
|
||
#: lazarusidestrconsts.liscocommand
|
||
msgctxt "lazarusidestrconsts.liscocommand"
|
||
msgid "Command:"
|
||
msgstr "Commande :"
|
||
|
||
#: lazarusidestrconsts.liscode
|
||
msgid "Code"
|
||
msgstr "Code"
|
||
|
||
#: lazarusidestrconsts.liscodebrowser
|
||
#, fuzzy
|
||
#| msgid "Code browser"
|
||
msgctxt "lazarusidestrconsts.liscodebrowser"
|
||
msgid "Code Browser"
|
||
msgstr "Navigateur de code"
|
||
|
||
#: lazarusidestrconsts.liscodeexplorer
|
||
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorateur de code"
|
||
|
||
#: lazarusidestrconsts.liscodefault
|
||
msgid "default (%s)"
|
||
msgstr "défaut (%s)"
|
||
|
||
#: lazarusidestrconsts.liscodegenerationoptions
|
||
msgid "Code generation options"
|
||
msgstr "Options de génération de code"
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddlinkbutton
|
||
msgid "Add link"
|
||
msgstr "Ajouter un lien"
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "Ajouter chemin"
|
||
|
||
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
||
msgid "Browse"
|
||
msgstr "Parcourir"
|
||
|
||
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr "Confirmez remplacer"
|
||
|
||
#: lazarusidestrconsts.liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr "Créer un item d'aide"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
|
||
msgid "Delete link"
|
||
msgstr "Supprimer le lien"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "Retirer le chemin"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdescrtag
|
||
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
||
msgid "Description"
|
||
msgstr "Description"
|
||
|
||
#: lazarusidestrconsts.liscodehelperrorstag
|
||
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
||
msgid "Errors"
|
||
msgstr "Erreurs"
|
||
|
||
#: lazarusidestrconsts.liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "Exemple"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr "Insérer une balise de formatage gras"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr "Insérer une balise de formatage code"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr "Insérer une balise de formatage italique"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr "Insérer une balise de formatage remarque"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr "Insérer une balise de formatage souligner"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr "Insérer une balise de formatage variable"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinherited
|
||
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
||
msgid "Inherited"
|
||
msgstr "Hérité"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr "Insérer un lien"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr "Insérer une balise de formatage paragraphe"
|
||
|
||
#: lazarusidestrconsts.liscodehelpmainformcaption
|
||
#, fuzzy
|
||
#| msgid "FPDoc editor"
|
||
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
||
msgid "FPDoc Editor"
|
||
msgstr "Editeur FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnodocumentation
|
||
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
|
||
msgid "(none)"
|
||
msgstr "<Aucun>"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
||
msgid "(no inherited description found)"
|
||
msgstr "(pas de description héritée trouvées)"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<NONE>"
|
||
|
||
#: lazarusidestrconsts.liscodehelppathsgroupbox
|
||
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
|
||
msgid "FPDoc files path"
|
||
msgstr "Chemin des fichiers FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelpreplacebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
|
||
msgid "Replace"
|
||
msgstr "Remplacer"
|
||
|
||
#: lazarusidestrconsts.liscodehelpsavebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: lazarusidestrconsts.liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr "Voir aussi"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr "Courte description de"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr "Court"
|
||
|
||
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
||
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
||
msgid "Ignore constants in next functions"
|
||
msgstr "Ignore les constantes dans les fonctions suivantes"
|
||
|
||
#: lazarusidestrconsts.liscodeobscharconst
|
||
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
||
msgid "Search for unnamed char constants"
|
||
msgstr "Rechercher des constantes de type char sans nom "
|
||
|
||
#: lazarusidestrconsts.liscodeobserver
|
||
msgid "Code Observer"
|
||
msgstr "Observateur de code"
|
||
|
||
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
||
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
||
msgid "Ignore next unnamed constants"
|
||
msgstr "Ignorer les prochaines constantes sans nom"
|
||
|
||
#: lazarusidestrconsts.liscodetempladd
|
||
msgctxt "lazarusidestrconsts.liscodetempladd"
|
||
msgid "Add"
|
||
msgstr "Ajouter"
|
||
|
||
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "Ajouter modèle de code"
|
||
|
||
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
||
msgid " A token %s%s%s already exists! "
|
||
msgstr "Le raccourci %s%s%s existe déjà"
|
||
|
||
#: lazarusidestrconsts.liscodetemplautocompleteon
|
||
#, fuzzy
|
||
#| msgid "Auto complete on ..."
|
||
msgid "Auto complete on"
|
||
msgstr "Auto compléter sur ..."
|
||
|
||
#: lazarusidestrconsts.liscodetemplchange
|
||
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
||
msgid "Change"
|
||
msgstr "Changer"
|
||
|
||
#: lazarusidestrconsts.liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "Commentaire :"
|
||
|
||
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr "Editer les modèles de code"
|
||
|
||
#: lazarusidestrconsts.liscodetemplerror
|
||
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
||
msgid "Error"
|
||
msgstr "Erreur"
|
||
|
||
#: lazarusidestrconsts.liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr "Jeton:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "Action : %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
||
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
||
msgstr "Les noeuds créés automatiquement ne peuvent être modifiés,%set ne peuvent pas avoir de sous-noeud non automatique"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "%s, généré automatiquement"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes can not be edited."
|
||
msgstr "Les noeuds générés automatiquement ne peuvent pas être édités."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "Bloc"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr "Editeur des directives des outils de code ..."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
|
||
msgid "CodeTools Defines Preview"
|
||
msgstr "Définitions des Outils de code"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
||
#, fuzzy
|
||
#| msgid "compiler path"
|
||
msgid "Compiler path"
|
||
msgstr "Chemin du compilateur"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "Convertir un noeud"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr "Créer les définitions pour le répertoire %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr "Créer les définitions pour le compilateur Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr "Créer Définitions pour des sources Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
|
||
msgid "Create Defines for Lazarus Directory"
|
||
msgstr "Créer les définitions pour le répertoire Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr "Créer les définitions pour le projet %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr "Créer les Macros et chemins FPC pour un répertoire projet fpc"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr "Définir"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr "Définir de manière récursive"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "Supprimer le noeud"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Le réperoire principal %s %soù Borland a installé tous les sources %s.%sPar exemple: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Le répertoire principal %s où Borland a installé tous les sources %s %squi sont utilisés dans ce projet %s.%sPar exemple: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr "Description :"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "répertoire %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsedit
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
|
||
msgid "Edit"
|
||
msgstr "Editer"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr "Autrement"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr "ElseIf"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorreading
|
||
msgid "Error reading %s%s%s%s%s"
|
||
msgstr "Erreur lors de la lecture de %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
|
||
msgid "Error reading project info file %s%s%s%s%s"
|
||
msgstr "Erreur de lecture des infos de projet %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
|
||
msgid "Error while writing %s%s%s%s%s"
|
||
msgstr "Erreur lors de l'écriture %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
|
||
msgid "Error while writing project info file %s%s%s%s%s"
|
||
msgstr "Erreur lors de l'écriture du fichier infos projet %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsexit
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
|
||
msgid "Exit"
|
||
msgstr "Quitter"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr "Quitter sans enregistrer"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr "Répertoire des sources FPC SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr "Si"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr "IfNDef"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr "Répertoire"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr "Insérer un modèle répertoire Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr "Insérer un modèle projet Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr "Insérer un modèle répertoire Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Insérer un modèle projet Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr "Insérer un modèle répertoire Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr "Insérer un modèle projet Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr "Insérer un modèle projet Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr "Insérer la source d'exemple Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr "Insérer un modèle répertoire Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr "Insérer un modèle projet Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
|
||
msgid "Insert Lazarus Directory Template"
|
||
msgstr "Insérer un modèle répertoire Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr "Insérer un noeud enfant"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr "Insérer un noeud ci-dessous"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr "Insérer un modèle"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr "Parent non valide"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr "Noeud parent non valide"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr "Noeud précédent non valide"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr "Le réperoire principal %s %soù Borland a installé tous les sources %s.%sPar exemple: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr "Le répertoire principal %s, où Borland a installé tous les sources %s %squi sont utilisés dans ce projet %s.%sPar exemple: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
|
||
msgid "Lazarus Directory"
|
||
msgstr "Répertoire Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr "Déplacer le noeud vers le bas"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr "Déplacer le noeud d'un niveau vers le bas"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr "Déplacer le noeud d'un niveau vers le haut"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr "Déplacer le noeud vers le haut"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsname
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
||
msgid "Name:"
|
||
msgstr "Nom :"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr "NouveauNoeud"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
|
||
msgid "Node and its children are only valid for this project"
|
||
msgstr "Le noeud et ses enfants sont seulement valides pour ce projet"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr "Noeud en lecture seule"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "Aucun sélectionné"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node can not contain child nodes."
|
||
msgstr "Le noeud parent ne peut contenir d'enfants"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr "Le noeud précédent ne peut contenir de noeuds enfants"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Répertoire du projet"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "%s répertoire de projet"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
|
||
msgid "%s, project specific"
|
||
msgstr "%s, spécifique au projet"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr "Erreur de lecture"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr "Enregistrer et quitter"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "Noeud sélectionné:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
#, fuzzy
|
||
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
|
||
msgstr "Le répertoire source de Free Pascal SVN. Non requis. Ceci améliorera la déclaration et le déboguage."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr "Le répertoire du projet Free Pascal."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr "Le dossier source SVN Free Pascal."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
|
||
msgid "The Lazarus main directory."
|
||
msgstr "Le répertoire principal de Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
#, fuzzy
|
||
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr "Le chemin du compilateur Free Pascal.%s Par exemple %s/usr/bin/%s -n%s ou %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
#, fuzzy
|
||
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr "Le chemin du compilateur de Free Pascal pour ce projet. Seulement requis si vous placiz la source de FPC SVN ci-dessous. Utilisé pour l'auto-création de macros."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
||
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr "Le répertoire projet %s,%squi contient les fichiers .dpr, .dpk."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr "Supprimer la définition"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr "Supprimer toutes les définitions"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr "Supprimer les définitions récursivement"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr "Valeur en chemins fichier"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr "Valeur en texte"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
||
msgid "%s:%svalue \"%s\" is invalid."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr "Variable:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr "Erreur d'écriture"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "De"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
||
msgid "Bracket"
|
||
msgstr "Parenthèses"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr "Deux-points"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr "Virgule"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Identificateur"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr "Mot-clé"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr "NouvelleLigne"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnone
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
||
msgid "None"
|
||
msgstr "Aucun"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr "Nombre"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsok
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
|
||
msgid "Ok"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr "Point"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr "Point-virgule"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsspace
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
||
msgid "Space"
|
||
msgstr "Espace"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr "Constante chaîne"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr "Symbole"
|
||
|
||
#: lazarusidestrconsts.liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr "Exécuter après"
|
||
|
||
#: lazarusidestrconsts.liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr "Exécuter avant"
|
||
|
||
#: lazarusidestrconsts.liscollapseall
|
||
msgid "Collapse All (/)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr "Replier toutes les classes"
|
||
|
||
#: lazarusidestrconsts.liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr "Replier tous les paquets"
|
||
|
||
#: lazarusidestrconsts.liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr "Replier toutes les unités"
|
||
|
||
#: lazarusidestrconsts.liscommandafter
|
||
msgid "Command after"
|
||
msgstr "Commande suivante"
|
||
|
||
#: lazarusidestrconsts.liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr "Commande suivante invalide"
|
||
|
||
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr "Commande après publication du module"
|
||
|
||
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr "Paramètres d'éxécution du programme"
|
||
|
||
#: lazarusidestrconsts.liscompiler
|
||
msgid "Compiler"
|
||
msgstr "Compilateur"
|
||
|
||
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
||
msgid "Compiler \"%s\" does not support target %s-%s"
|
||
msgstr "Le compilateur \"%s\" ne supporte pas la cible %s-%s"
|
||
|
||
#: lazarusidestrconsts.liscompilererror
|
||
msgid "Compiler error"
|
||
msgstr "Erreur du compilateur"
|
||
|
||
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr "Erreur : compilateur invalide: %s"
|
||
|
||
#: lazarusidestrconsts.liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr "Nom de fichier du compilateur"
|
||
|
||
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
||
#, fuzzy
|
||
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
||
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
||
msgstr "Conseil : vous pouvez définir le chemin du compilateur dans Configuration->Options d'environnement->Fichiers->Chemin du compilateur."
|
||
|
||
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr "NOTE : fichier de configuration codetools non trouvé. Valeurs par défaut utilisées."
|
||
|
||
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr "NOTE : chargement de l'ancien fichier d'options de codetools"
|
||
|
||
#: lazarusidestrconsts.liscompileroptionsforproject
|
||
msgid "Compiler Options for Project: %s"
|
||
msgstr "Options du compilateur pour le projet %s"
|
||
|
||
#: lazarusidestrconsts.liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%s (compilation ...)"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
||
msgid "Show long line hints"
|
||
msgstr "Voir les conseils sur de longue lignes"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
||
msgid "Extend far left"
|
||
msgstr "Etendre au loin à gauche"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
||
msgid "Extend some left"
|
||
msgstr "Etendre quelque peu à gauche"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
||
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
||
msgid "Never"
|
||
msgstr "Jamais"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
||
msgid "Extend right only"
|
||
msgstr "Etendre à droite seulement"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
||
msgid "Component name \"%s\" is a pascal keyword."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomponentnameiskeyword
|
||
msgid "Component name %s%s%s is keyword"
|
||
msgstr "Le nom du composant %s%s%s est un mot réservé"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
||
msgid "Component name %s%s%s is not a valid identifier"
|
||
msgstr "Le nom du composant %s%s%s n'est pas un identificateur valide"
|
||
|
||
#: lazarusidestrconsts.liscomppalfindcomponent
|
||
msgid "Find component"
|
||
msgstr "Rechercher un Composant"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr "Ouvrir un paquet"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr "Ouvrir l'unité"
|
||
|
||
#: lazarusidestrconsts.liscomptest
|
||
#| msgid "Test"
|
||
msgctxt "lazarusidestrconsts.liscomptest"
|
||
msgid "&Test"
|
||
msgstr "&Test"
|
||
|
||
#: lazarusidestrconsts.liscondition
|
||
msgid "Condition"
|
||
msgstr "Condition"
|
||
|
||
#: lazarusidestrconsts.lisconditionals
|
||
#, fuzzy
|
||
#| msgid "Conditionals:"
|
||
msgctxt "lazarusidestrconsts.lisconditionals"
|
||
msgid "Conditionals"
|
||
msgstr "expressions conditionnelles:"
|
||
|
||
#: lazarusidestrconsts.lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr "Répertoire de configuration de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuild
|
||
msgid "Configure Build %s"
|
||
msgstr "Configurer la création %s"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
||
msgid "Configure %sBuild Lazarus%s"
|
||
msgstr "Configurer %sCréation de Lazarus%s"
|
||
|
||
#: lazarusidestrconsts.lisconfigurelazaruside
|
||
msgid "Configure Lazarus IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirm
|
||
msgid "Confirm"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
||
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
||
msgstr "Lazarus sera recréé avec les profil suivant:%sContinuer?"
|
||
|
||
#: lazarusidestrconsts.lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr "Confirmer les changements"
|
||
|
||
#: lazarusidestrconsts.lisconfirmdelete
|
||
msgid "Confirm delete"
|
||
msgstr "Confirmer l'éffacement"
|
||
|
||
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
||
#| msgid "Do you want to rebuild Lazarus?"
|
||
msgid "Do you want to rebuild Lazarus with profile: %s ?"
|
||
msgstr "Voulez-vous recréer Lazarus avec le profil: %s ?"
|
||
|
||
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr "Confirmez le nouvel ensemble de paquets pour l'EDI"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageaction
|
||
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
||
msgid "Action"
|
||
msgstr "Action"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
||
msgid "New package set"
|
||
msgstr "Nouveau jeu de paquet"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
||
msgid "Old package set"
|
||
msgstr "Vieux jeu de paquet"
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr "Application console"
|
||
|
||
#: lazarusidestrconsts.lisconstructorcode
|
||
msgid "Constructor code"
|
||
msgstr "Code Constructor"
|
||
|
||
#: lazarusidestrconsts.liscontains
|
||
msgid "contains"
|
||
msgstr "contient"
|
||
|
||
#: lazarusidestrconsts.liscontextsensitive
|
||
msgid "Context sensitive"
|
||
msgstr "Sensible au contexte"
|
||
|
||
#: lazarusidestrconsts.liscontinue
|
||
msgctxt "lazarusidestrconsts.liscontinue"
|
||
msgid "Continue"
|
||
msgstr "Continuer"
|
||
|
||
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
||
msgid "Continue and do not ask again"
|
||
msgstr "Continuer et ne pas demander à nouveau"
|
||
|
||
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr "Continuer sans charger la fiche"
|
||
|
||
#: lazarusidestrconsts.liscontributors
|
||
msgid "Contributors"
|
||
msgstr "Contributeurs"
|
||
|
||
#: lazarusidestrconsts.liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr "Le contrôle nécessite un parent"
|
||
|
||
#: lazarusidestrconsts.lisconvcoordhint
|
||
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvcoordoffs
|
||
msgid "Coordinate offsets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedpackagerequirement
|
||
msgid "Added Package %s as a requirement."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
||
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
||
msgid "All sub-directories will be scanned for unit files"
|
||
msgstr "Tous les sous-répertoires seront scannés pour les fichiers units"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
||
msgid "BeginCodeTools failed!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphicategories
|
||
msgid "Categories:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
||
msgid "Changed encoding from %s to UTF-8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
||
msgid "Conversion Aborted."
|
||
msgstr "Conversion abandonnée."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversionready
|
||
msgid "Conversion Ready."
|
||
msgstr "Conversion prête."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
||
msgid "Convert Delphi package"
|
||
msgstr "Convertir un paquet delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
||
msgid "Convert Delphi project"
|
||
msgstr "Convertir un projet Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
||
msgid "Convert Delphi unit"
|
||
msgstr "Convertir une unité Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingfile
|
||
msgid "* Converting file %s *"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
|
||
msgid "*** Converting unit files ... ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
|
||
msgid "Delphi package main source (.dpk) file not found for package%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphierror
|
||
msgid "Error=\"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
|
||
msgid "%s(%s,%s) Error: Can't find unit %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
||
msgid "Failed converting unit"
|
||
msgstr "Echec de conversion d'unité"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
||
msgid "Failed to convert unit%s%s%s"
|
||
msgstr "Echec de conversion de l'unité%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifindallunitfiles
|
||
msgid "*** Find all unit files ... ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
||
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifixingusedunits
|
||
msgid "* Fixing used units for file %s *"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifunc
|
||
msgid "Delphi Function"
|
||
msgstr "Fonction Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphikeepboth
|
||
msgid "Keep both"
|
||
msgstr "Conserver les deux"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
||
msgid "%s(%s,%s) missing include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiname
|
||
msgid "Delphi Name"
|
||
msgstr "Nom Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
||
msgid "Package name exists"
|
||
msgstr "Le nom du paquet existe"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
||
msgid "Omitted unit %s from project"
|
||
msgstr "Omission de l'unité %s du projet"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
|
||
msgid "Removed unit \"%s\" in uses section."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiremovefirst
|
||
msgid "Remove first"
|
||
msgstr "Retirer en premier"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiremovesecond
|
||
msgid "Remove second"
|
||
msgstr "Retirer en second"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphirepairingformfile
|
||
msgid "* Repairing form file %s *"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
||
msgid "*** Repairing form files ... ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
||
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
||
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
||
msgstr "Remplace l'unité \"%s\" par \"%s\" dans la section uses."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
|
||
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
|
||
msgid "There are two units with the same unitname:%s%s%s%s%s"
|
||
msgstr "Il y a deux unités avec le même nom d'unité:%s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
||
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
||
msgstr "Il y a déjà un paquet avec le nom \"%s\"%sSVP fermez ce paquet en premier."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
|
||
msgid "Unitname exists twice"
|
||
msgstr "Le nom de l'unité existe en double"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
||
msgid "Units to replace in %s"
|
||
msgstr "Unités à remplacer dans %s"
|
||
|
||
#: lazarusidestrconsts.lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr "Erreur de conversion"
|
||
|
||
#: lazarusidestrconsts.lisconvert
|
||
msgid "Convert"
|
||
msgstr "Convertir"
|
||
|
||
#: lazarusidestrconsts.lisconvertencoding
|
||
#, fuzzy
|
||
#| msgid "Convert encoding"
|
||
msgid "Convert Encoding"
|
||
msgstr "Changer l'encodage"
|
||
|
||
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
||
msgid "Convert encoding of projects/packages"
|
||
msgstr "Convertir le codage de projets/packages"
|
||
|
||
#: lazarusidestrconsts.lisconvertprojectorpackage
|
||
msgid "Convert project or package"
|
||
msgstr "Convertir le projet ou le paquet"
|
||
|
||
#: lazarusidestrconsts.lisconverttargethint
|
||
msgid "Converter adds conditional compilation to support different targets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetmultiplatform
|
||
msgid "Multi-Platform"
|
||
msgstr "Multi-plateforme"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetmultiplatformhint
|
||
msgid "Multi-Platform versus Windows-only"
|
||
msgstr "Multi-plateforme par rapport à windows-seulement"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
||
msgid "Use the same DFM form file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
||
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
||
msgid "Support Delphi"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
||
msgid "Use conditional compilation to support Delphi"
|
||
msgstr "Utiliser la compilation conditionnelle pour supporter Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvfuncreplacements
|
||
msgid "Function Replacements"
|
||
msgstr "Remplacements de fonction"
|
||
|
||
#: lazarusidestrconsts.lisconvfuncreplhint
|
||
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
||
msgid "Some Delphi functions can be replaced with LCL function"
|
||
msgstr "Quelques fonctions Delphi peuvent être remplacées par des fonctions LCL"
|
||
|
||
#: lazarusidestrconsts.lisconvfuncstoreplace
|
||
msgid "Functions / procedures to replace"
|
||
msgstr "Fonctions / procédures à remplacer"
|
||
|
||
#: lazarusidestrconsts.lisconvleftoff
|
||
msgid "Left offset"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvnewname
|
||
msgid "New Name"
|
||
msgstr "Nouveau Nom"
|
||
|
||
#: lazarusidestrconsts.lisconvparentcontainer
|
||
msgid "Parent Container"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvtopoff
|
||
msgid "Top offset"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplacements
|
||
msgid "Type Replacements"
|
||
msgstr " Replacements de Type"
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplhint
|
||
msgid "Unknown types in form file (DFM/LFM)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvtypestoreplace
|
||
msgid "Types to replace"
|
||
msgstr "Types à remplacer"
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplacements
|
||
msgid "Unit Replacements"
|
||
msgstr "Remplacements d'unité"
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplhint
|
||
msgid "Unit names in uses section of a source unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvunitstoreplace
|
||
msgid "Units to replace"
|
||
msgstr "Unités à remplacer"
|
||
|
||
#: lazarusidestrconsts.lisconvunknownprops
|
||
msgid "Unknown properties"
|
||
msgstr "Propriétées inconnues"
|
||
|
||
#: lazarusidestrconsts.liscopyall
|
||
msgid "Copy All"
|
||
msgstr "Copier tout"
|
||
|
||
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy all items to clipboard"
|
||
msgid "Copy All Items to Clipboard"
|
||
msgstr "Copier tous les éléments vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.liscopyalloutputclipboard
|
||
msgid "Copy all output to clipboard"
|
||
msgstr "Copier toutes les sorties vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy all shown and hidden messages to clipboard"
|
||
msgid "Copy All Shown and Hidden Messages to Clipboard"
|
||
msgstr "Copie tout les messages cachés et montrés vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy all shown messages to clipboard"
|
||
msgid "Copy All Shown Messages to Clipboard"
|
||
msgstr "Copie tout les messages montrés vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.liscopydescription
|
||
msgid "Copy description to clipboard"
|
||
msgstr "Copier la description dans le presse papier"
|
||
|
||
#: lazarusidestrconsts.liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr "Erreur de copie"
|
||
|
||
#: lazarusidestrconsts.liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "Copier l'erreur"
|
||
|
||
#: lazarusidestrconsts.liscopyidentifier
|
||
msgid "Copy %s%s%s to clipboard"
|
||
msgstr "Copier %s%s%s dans le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr "La copie d'une fiche complète n'est pas encore implémentée."
|
||
|
||
#: lazarusidestrconsts.liscopyitemtoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy item to clipboard"
|
||
msgid "Copy Item to Clipboard"
|
||
msgstr "Copier l'élément vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy selected items to clipboard"
|
||
msgid "Copy Selected Items to Clipboard"
|
||
msgstr "Copier les éléments sélectionnés vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy selected messages to clipboard"
|
||
msgid "Copy Selected Messages to Clipboard"
|
||
msgstr "Copier les messages sélectionnés dans le presse-papier"
|
||
|
||
#: lazarusidestrconsts.liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr "Rechercher les messages FPC"
|
||
|
||
#: lazarusidestrconsts.liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr "Rechercher les messages Make"
|
||
|
||
#: lazarusidestrconsts.liscoscanformessages
|
||
msgid "Scan for messages:"
|
||
msgstr "Scan des messages:"
|
||
|
||
#: lazarusidestrconsts.liscoshowallmessages
|
||
msgid "Show all messages"
|
||
msgstr "Afficher tous les messages"
|
||
|
||
#: lazarusidestrconsts.liscoskipcallingcompiler
|
||
#, fuzzy
|
||
#| msgid "Skip calling Compiler"
|
||
msgid "Skip calling compiler"
|
||
msgstr "Pas d'appel au compilateur"
|
||
|
||
#: lazarusidestrconsts.liscotargetosspecificoptions
|
||
msgid "Target OS specific options"
|
||
msgstr "Options spécifiques à l'OS de destination"
|
||
|
||
#: lazarusidestrconsts.liscouldnotadditomainsource
|
||
msgid "Could not add %s{$I %s%s} to main source!"
|
||
msgstr "N'a pas pu ajouter %s{$I %s%s} à la source principale!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
||
msgid "Could not add %s{$R %s%s} to main source!"
|
||
msgstr "N'a pas pu ajouter %s{$R %s%s} à la source principale!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
||
msgid "Could not add %s%s%s to main source!"
|
||
msgstr "N'a pas pu ajouter %s%s%s à la source principale!!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
||
msgid "Could not remove %s%s%s from main source!"
|
||
msgstr "Impossible de supprimer %s%s%s de la source principale !"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
||
msgid "Could not remove %s{$I %s%s} from main source!"
|
||
msgstr "N'a pas pu enlever %s{$I %s%s} de la source principale!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
||
msgid "Could not remove %s{$R %s%s} from main source!"
|
||
msgstr "N'a pas pu enlever %s{$R %s%s} de la source principale!"
|
||
|
||
#: lazarusidestrconsts.liscovarious
|
||
msgid "%s (various)"
|
||
msgstr "%s (divers)"
|
||
|
||
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
#, fuzzy
|
||
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr "Avertissement: le fichier additionnel de configuration du compilateur porte le même nom qu'un des fichiers standards utilisés par le compilateur FreePascal. La conséquence risque d'être que SEUL le fichier additionnel sera utilisé tandis que le fichier standard sera ignoré."
|
||
|
||
#: lazarusidestrconsts.liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr "Ouvrir le paquet %s"
|
||
|
||
#: lazarusidestrconsts.liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr "Ouvrir l'unité %s"
|
||
|
||
#: lazarusidestrconsts.liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr "Veuillez d'abord créer un projet !"
|
||
|
||
#: lazarusidestrconsts.liscreatedirectory
|
||
msgid "Create directory?"
|
||
msgstr "Créer le répertoire ?"
|
||
|
||
#: lazarusidestrconsts.liscreatefunction
|
||
msgid "Create function"
|
||
msgstr "Crée une fonction"
|
||
|
||
#: lazarusidestrconsts.liscreatehelpnode
|
||
msgid "Create Help node"
|
||
msgstr "Créer un item d'aide"
|
||
|
||
#: lazarusidestrconsts.liscreateit
|
||
msgid "Create it"
|
||
msgstr "Le créer"
|
||
|
||
#: lazarusidestrconsts.liscreateproject
|
||
msgid "Create project"
|
||
msgstr "Créer un projet"
|
||
|
||
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
||
msgid "Create/update .po file when saving a lfm file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
||
msgid "Creating file index of FPC sources %s ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr "Choisissez le répertoire"
|
||
|
||
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr "Outils de code Répertoire de valeurs"
|
||
|
||
#: lazarusidestrconsts.lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr "Définir les modêles"
|
||
|
||
#: lazarusidestrconsts.lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<aucune variable choisie>"
|
||
|
||
#: lazarusidestrconsts.lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr "Ouvrir l'aperçu"
|
||
|
||
#: lazarusidestrconsts.lisctdefstools
|
||
msgid "Tools"
|
||
msgstr "Outils"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr "Variable: %s"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr "Nom de variable"
|
||
|
||
#: lazarusidestrconsts.lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr "Modèles"
|
||
|
||
#: lazarusidestrconsts.lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr "veuillez choisir une macro"
|
||
|
||
#: lazarusidestrconsts.lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr "veuillez choisir une macro"
|
||
|
||
#: lazarusidestrconsts.liscurrent
|
||
msgctxt "lazarusidestrconsts.liscurrent"
|
||
msgid "Current"
|
||
msgstr "Courant"
|
||
|
||
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr "Colonne du curseur dans l'éditeur courant"
|
||
|
||
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr "Ligne du curseur dans l'éditeur courant"
|
||
|
||
#: lazarusidestrconsts.liscustomopthint
|
||
msgid "These options are passed directly to the compiler. Macros are replaced, line breaks are replaced with single spaces."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscustomoptions
|
||
msgid "custom options"
|
||
msgstr "Options personalisées"
|
||
|
||
#: lazarusidestrconsts.liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr "Options personnalisées"
|
||
|
||
#: lazarusidestrconsts.liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr "Programme personnalisé"
|
||
|
||
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
|
||
#| msgid "Custom Program%sA freepascal program."
|
||
msgid "Custom Program%sA Free Pascal program."
|
||
msgstr "Programmeen usage%sUn programme FreePascal"
|
||
|
||
#: lazarusidestrconsts.lisdatamodule
|
||
msgid "Data Module"
|
||
msgstr "Module de données"
|
||
|
||
#: lazarusidestrconsts.lisdate
|
||
msgid "Date"
|
||
msgstr "Date"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdelete
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
|
||
msgid "Delete all"
|
||
msgstr "Efface tout"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdeletehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
|
||
msgid "Delete all"
|
||
msgstr "Efface tout"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdisable
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
|
||
msgid "Disable all"
|
||
msgstr "Interdire tout"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdisablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
|
||
msgid "Disable all"
|
||
msgstr "Interdire tout"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemenable
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
|
||
msgid "Enable all"
|
||
msgstr "Autoriser tout"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemenablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
|
||
msgid "Enable all"
|
||
msgstr "Autoriser tout"
|
||
|
||
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy to clipboard"
|
||
msgid "Copy to Clipboard"
|
||
msgstr "Copie vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
|
||
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
|
||
msgid "Breakpoint Properties ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgemexpression
|
||
msgid "&Expression:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgemnewvalue
|
||
msgid "&New value:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgemresult
|
||
msgid "&Result:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
||
msgid "Breakpoint Evaluation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
||
msgid "Breakpoint Hit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
||
msgid "Breakpoint Message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
||
msgid "Breakpoint Stack Dump"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgendefaultcolor
|
||
msgid "Default Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenexceptionraised
|
||
msgid "Exception Raised"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenmoduleload
|
||
msgid "Module Load"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenmoduleunload
|
||
msgid "Module Unload"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
||
msgid "Output Debug String"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenprocessexit
|
||
msgid "Process Exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenprocessstart
|
||
msgid "Process Start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenthreadexit
|
||
msgid "Thread Exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenthreadstart
|
||
msgid "Thread Start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
||
msgid "Windows Message Posted"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
||
msgid "Windows Message Sent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdelete
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdeletehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdisable
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
|
||
msgid "Disable"
|
||
msgstr "Interdire"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdisablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
|
||
msgid "Disable"
|
||
msgstr "Interdire"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemenable
|
||
msgctxt "lazarusidestrconsts.lisdbgitemenable"
|
||
msgid "Enable"
|
||
msgstr "Autoriser"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemenablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
|
||
msgid "Enable"
|
||
msgstr "Autoriser"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "Pas de débogueuer spécifié"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr "Placer le point d'arrêt de toute façon"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
||
msgstr "Il n'y a aucun débogueur d'indiqué.%sPlaçer des points d'arrêts n'aura aucun effet jusqu'à ce qu'un débogueur soit configuré dans le dialogue des options du débogueur dans le menu."
|
||
|
||
#: lazarusidestrconsts.lisdbgwinpower
|
||
msgid "On/Off"
|
||
msgstr "On/Off"
|
||
|
||
#: lazarusidestrconsts.lisdbgwinpowerhint
|
||
msgid "Disable/Enable updates for the entire window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebuggererror
|
||
msgid "Debugger error"
|
||
msgstr "Erreur du débogueur"
|
||
|
||
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr "Erreur du débogueur%sLe débogueur est en état d'erreur%sEnregistrez votre travail maintenant!%sCliquez sur Stop et espérez; nous ne répondons plus de rien !"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackerror
|
||
msgid "Debugger Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
|
||
msgid "Debugger Information"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackless
|
||
msgid "Less"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackmore
|
||
msgctxt "lazarusidestrconsts.lisdebuggerfeedbackmore"
|
||
msgid "More"
|
||
msgstr "Plus"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackok
|
||
#, fuzzy
|
||
#| msgid "Ok"
|
||
msgctxt "lazarusidestrconsts.lisdebuggerfeedbackok"
|
||
msgid "OK"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackstop
|
||
msgctxt "lazarusidestrconsts.lisdebuggerfeedbackstop"
|
||
msgid "Stop"
|
||
msgstr "Arrêter"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
|
||
msgid "Debugger Warning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr "Débogueur non valide"
|
||
|
||
#: lazarusidestrconsts.lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%s (débogage ...)"
|
||
|
||
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
||
msgid "Automatic type-cast for objects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
||
msgid "Add Exception"
|
||
msgstr "Ajouter une exception"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr "Chemin de recherche additionnel"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr "Point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr "Effacer les logs à l'exécution"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Débogueur"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr "Options général du débogueur"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr "Options spécifiques du débogueur (dépend du type de débogueur)"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
||
msgid "Duplicate Exception name"
|
||
msgstr "Dupliquer le nom de l'exception"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
||
msgid "Enter the name of the exception"
|
||
msgstr "Entrer le nom de l'exception"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
||
msgid "Event Log"
|
||
msgstr "Journal des événements"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr "Géré par"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr "Géré par le Débogueur"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr "Géré par le Programme"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmid
|
||
msgid "ID"
|
||
msgstr "ID"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr "Ignorer ces exceptions"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr "Exceptions de langue"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
||
#, fuzzy
|
||
#| msgid "Limit linecount to"
|
||
msgid "Limit line count to"
|
||
msgstr "Limiter le comptage des lignes à "
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
||
msgid "Module"
|
||
msgstr "Module"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmname
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
||
msgid "Notify on Lazarus Exceptions"
|
||
msgstr "Avertissement sur les exceptions de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr "Exceptions du système d'exploitation"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr "Sortie"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr "Processus"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr "Résumé"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr "Résumer le Handled"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr "Resume Unhandled"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr "Afficher le message à l'arrêt"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr "Signaux"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr "Thread"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
||
msgid "Use event log colors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
||
msgid "Windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr "Impossible de charger le fichier."
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
||
msgid "Unable to load file %s%s%s."
|
||
msgstr "Impossible de charger le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisdecimal
|
||
msgctxt "lazarusidestrconsts.lisdecimal"
|
||
msgid "Decimal"
|
||
msgstr "Décimale"
|
||
|
||
#: lazarusidestrconsts.lisdefaultvalue
|
||
msgid "Default value"
|
||
msgstr "Valeur initiale"
|
||
|
||
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
||
msgid "Delay for long line hints in completion box"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
|
||
msgid "Delay for hints and completion box"
|
||
msgstr "délai pour les conseils et la boite de completion de code"
|
||
|
||
#: lazarusidestrconsts.lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr "&Supprimer tout"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
||
msgid "Delete all breakpoints?"
|
||
msgstr "Supprimer tous les points d'arrêts ?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
||
msgid "Delete all breakpoints in file %s%s%s?"
|
||
msgstr "Supprimer tous les points d'arrêts dans le fichier %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallinsamesource
|
||
msgid "Delete All in same source"
|
||
msgstr "Supprimer tous dans le même source"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
||
msgid "Delete all selected breakpoints?"
|
||
msgstr "Supprimer tous les points d'arrêts sélectionnés ?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr "Détruire ces fichiers ?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr "Supprimer les fichier ambigus ?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpoint
|
||
msgid "Delete Breakpoint"
|
||
msgstr "Supprimer un point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointatline
|
||
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
||
msgstr "Supprimer le point d'arrêt à%s\"%s\" ligne %d ?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointforaddress
|
||
msgid "Delete breakpoint for address %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointforwatch
|
||
msgid "Delete watchpoint for \"%s\"?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletebuildmode
|
||
msgid "Delete build mode"
|
||
msgstr "Arrêter le mode de création"
|
||
|
||
#: lazarusidestrconsts.lisdeletebuildmode2
|
||
msgid "Delete build mode?"
|
||
msgstr "Supprimer le mode de création?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebuildmode3
|
||
msgid "Delete build mode %s%s%s?"
|
||
msgstr "Supprimer le mode de création %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr "La suppression du fichier a échoué"
|
||
|
||
#: lazarusidestrconsts.lisdeletemacro
|
||
#, fuzzy
|
||
#| msgid "Delete macro %s"
|
||
msgid "Delete macro %s%s%s?"
|
||
msgstr "Supprime la macro %s"
|
||
|
||
#: lazarusidestrconsts.lisdeletemode
|
||
msgid "Delete mode \"%s\""
|
||
msgstr "Supprime le mode \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile
|
||
msgid "Delete old file %s%s%s?"
|
||
msgstr "Supprimer l'ancien fichier %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile2
|
||
msgid "Delete old file?"
|
||
msgstr "Supprimer l'ancien fichier ?"
|
||
|
||
#: lazarusidestrconsts.lisdeleterow
|
||
msgid "Delete row"
|
||
msgstr "Supprimer la ligne"
|
||
|
||
#: lazarusidestrconsts.lisdeleteselectedfiles
|
||
msgid "Delete selected files"
|
||
msgstr "Supprimer les fichiers sélectionnés ?"
|
||
|
||
#: lazarusidestrconsts.lisdeletesetting
|
||
msgid "Delete setting"
|
||
msgstr " Effacer les paramètres"
|
||
|
||
#: lazarusidestrconsts.lisdeletesetting2
|
||
msgid "Delete setting?"
|
||
msgstr " Effacer les paramètres ?"
|
||
|
||
#: lazarusidestrconsts.lisdeletesetting3
|
||
msgid "Delete setting %s%s%s?"
|
||
msgstr " Effacer les paramètres %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue
|
||
msgid "Delete value %s%s%s"
|
||
msgstr "Supprimer le Valeur %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue2
|
||
msgid "Delete value %s"
|
||
msgstr "Supprime la valeur %s"
|
||
|
||
#: lazarusidestrconsts.lisdeletingoffilefailed
|
||
msgid "Deleting of file %s%s%s failed."
|
||
msgstr "La suppression de l'ancien fichier %s%s%s a échoué."
|
||
|
||
#: lazarusidestrconsts.lisdelphi
|
||
msgid "Delphi"
|
||
msgstr "Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphipackage
|
||
msgid "Delphi package"
|
||
msgstr "paquet Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphiproject
|
||
msgid "Delphi project"
|
||
msgstr "Projet Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdelphiunit
|
||
msgid "Delphi unit"
|
||
msgstr "Unité Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
|
||
msgid "There is already another component with the name %s%s%s."
|
||
msgstr "Il y a déjà un autre composant avec le nom %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr "Répertoire de destination"
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
|
||
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
||
msgstr "Le répertoire de destination %s%s%s est non valide.%s Veuillez choisir un chemin complet."
|
||
|
||
#: lazarusidestrconsts.lisdestructorcode
|
||
msgid "Destructor code"
|
||
msgstr "Code Destructor"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr "Insensible à la casse"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr "Ignorer lignes vides ajoutées ou supprimées"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr "Ignorer les différences de fin de lignes (#10 = #13#10)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr "Ignorer le nombre d'espaces"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr "Ignorer les espaces (sauf caractères de saut de ligne)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr "Ignorer les espaces en fin de ligne"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr "Ignorer les espaces en début de ligne"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "Sélection seulement"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
||
msgid "Open Diff in editor"
|
||
msgstr "Ouvrir Différences dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgtext1
|
||
msgid "Text1"
|
||
msgstr "Texte1"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgtext2
|
||
msgid "Text2"
|
||
msgstr "Texte2"
|
||
|
||
#: lazarusidestrconsts.lisdigits
|
||
msgid "Digits:"
|
||
msgstr "Chiffres :"
|
||
|
||
#: lazarusidestrconsts.lisdirectives
|
||
msgid "Directives"
|
||
msgstr "Directives"
|
||
|
||
#: lazarusidestrconsts.lisdirectivesfornewunit
|
||
msgid "Directives for new unit"
|
||
msgstr "Directives pour la nouvelle unité"
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound
|
||
msgid "Directory %s%s%s not found."
|
||
msgstr "Répertoire %s%s%s non trouvé."
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound2
|
||
msgid "directory %s not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotwritable
|
||
msgid "Directory not writable"
|
||
msgstr "répertoire protégé en écriture."
|
||
|
||
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
||
msgid "Directory where the IDE puts the .po files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisableallinsamesource
|
||
msgid "Disable All in same source"
|
||
msgstr "Désactiver tous dans la même source"
|
||
|
||
#: lazarusidestrconsts.lisdisablebreakpoint
|
||
msgid "Disable Breakpoint"
|
||
msgstr "Désactiver le point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.lisdisabled
|
||
msgid "Disabled"
|
||
msgstr "Désactiver"
|
||
|
||
#: lazarusidestrconsts.lisdisablegroups
|
||
msgid "Disable Groups"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisablei18nforlfm
|
||
msgid "Disable I18N for LFM"
|
||
msgstr "Désactiver I18N pour LFM"
|
||
|
||
#: lazarusidestrconsts.lisdisassassembler
|
||
msgctxt "lazarusidestrconsts.lisdisassassembler"
|
||
msgid "Assembler"
|
||
msgstr "Assembleur"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotoaddress
|
||
#, fuzzy
|
||
#| msgid "Goto address"
|
||
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
|
||
msgid "Goto Address"
|
||
msgstr "Aller à l'adresse"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotoaddresshint
|
||
#, fuzzy
|
||
#| msgid "Goto address"
|
||
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
|
||
msgid "Goto Address"
|
||
msgstr "Aller à l'adresse"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotocurrentaddress
|
||
#, fuzzy
|
||
#| msgid "Goto current address"
|
||
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
|
||
msgid "Goto Current Address"
|
||
msgstr "Aller à l'adresse en cours"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
|
||
#, fuzzy
|
||
#| msgid "Goto current address"
|
||
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
|
||
msgid "Goto Current Address"
|
||
msgstr "Aller à l'adresse en cours"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr "Annuler les changements"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesall
|
||
msgid "Discard all changes"
|
||
msgstr "Annuler tous les changements"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
||
msgid "Discard changes and open project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesandquit
|
||
msgid "Discard changes and quit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
||
msgid "Discard changes, create new project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffchangedfiles
|
||
msgid "Changed files:"
|
||
msgstr "Fichiers modifiés:"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr "Cliquez sur un des éléments ci-dessous pour voir les différences"
|
||
|
||
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr "Erreur de lecture du fichier : %s"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
|
||
msgid "Ignore disk changes"
|
||
msgstr "Ignorer les changements sur disque"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffrevertall
|
||
msgid "Reload from disk"
|
||
msgstr "Recharger depuis le disque"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr "Certains fichiers ont changé sur le disque :"
|
||
|
||
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr "Différencier majuscules et minuscules (i.e. A et a)"
|
||
|
||
#: lazarusidestrconsts.lisdocumentationeditor
|
||
msgid "Documentation Editor"
|
||
msgstr "Editeur de documentation"
|
||
|
||
#: lazarusidestrconsts.lisdoesnotexists
|
||
msgid "%s does not exists: %s"
|
||
msgstr "%s n'existe pas: %s"
|
||
|
||
#: lazarusidestrconsts.lisdonotchange
|
||
msgid "Do not change"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheide
|
||
msgid "Do not close the IDE"
|
||
msgstr "Ne pas fermer l'EDI"
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "Ne pas fermer le projet "
|
||
|
||
#: lazarusidestrconsts.lisdonotcompiledependencies
|
||
msgid "do not compile dependencies"
|
||
msgstr "Ne pas compiler les dépendances"
|
||
|
||
#: lazarusidestrconsts.lisdonotinstall
|
||
msgid "Do not install"
|
||
msgstr "Ne pas installer"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr "Ne pas afficher le splashscreen"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
||
msgid "Do not show this dialog for this project"
|
||
msgstr "Ne pas montrer cette boîte de dialogue pour ce projet"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
||
msgid "Do not show this message again"
|
||
msgstr "Ne plus montrer ce message."
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
||
msgid "Do you still want to create the new project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
||
msgid "Do you still want to open another project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
||
msgid "Do you still want to quit?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
||
msgid "Draw grid lines"
|
||
msgstr "Dessiner les lignes de la grille"
|
||
|
||
#: lazarusidestrconsts.lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr "Copier les composants sélectionnés vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr "Couper les composants sélectionnés vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr "Déplacer le composant vers l'arrière de un niveau"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr "Déplacer le composant vers l'avant de un niveau"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr "Déplacer le composant à l'arrière"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr "Déplacer le composant à l'avant"
|
||
|
||
#: lazarusidestrconsts.lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr "Coller les composants sélectionnés depuis le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr "Sélectionner composant parent"
|
||
|
||
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
||
msgid "Duplicate found of value %s%s%s."
|
||
msgstr " Reproduction trouvée de la valeur %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
||
msgstr "Nom double : Un composant appelé %s%s%s existe déjà dans le composant hérité %s"
|
||
|
||
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
||
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatesearchpath
|
||
msgid "Duplicate search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
||
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseditcontexthelp
|
||
msgid "Edit context help"
|
||
msgstr "Editer le contexte d'aide"
|
||
|
||
#: lazarusidestrconsts.liseditorfiletypes
|
||
msgid "Editor file types"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedoptsloadascheme
|
||
msgid "Load a scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "Tous les paquets"
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr "Projet courant"
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
|
||
msgid "Current Project Directory"
|
||
msgstr "Répertoire du projet courant"
|
||
|
||
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
|
||
msgid "Global Source Path addition"
|
||
msgstr "Chemin complémentaire de sources globales"
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectincpath
|
||
msgid "Project IncPath"
|
||
msgstr "Chemin des fichier inc du projet"
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectsrcpath
|
||
msgid "Project SrcPath"
|
||
msgstr "Chemin des sources du projet"
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectunitpath
|
||
msgid "Project UnitPath"
|
||
msgstr "Chemin des unités du projet"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr "Tous les projets"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr "Mettre FPC en mode DELPHI"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
||
msgid "set FPC mode to FPC"
|
||
msgstr "Mettre FPC en mode FPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr "Mettre FPC en mode GPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
||
msgid "set FPC mode to MacPas"
|
||
msgstr "Mettre FPC en mode MacPas"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr "Mettre FPC en mode TP"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr "Activer IOCHECKS"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr "Activer OVERFLOWCHECKS"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr "Activer RANGECHECKS"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr "utiliser l'unité HeapTrc"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr "utiliser l'unité LineInfo"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolalt
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr "Un outil a besoin au minimum d'un titre et d'un nom de fichier."
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolctrl
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "Editer les outils"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolhidemainform
|
||
msgid "Hide main form"
|
||
msgstr "Masquer le formulaire principal"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolinsert
|
||
msgid "Insert"
|
||
msgstr "Insérer"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolkey
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
||
msgid "Key"
|
||
msgstr "Touche"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolmacros
|
||
msgid "Macros"
|
||
msgstr "Macros"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr "Paramètres :"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
||
msgid "Program Filename:"
|
||
msgstr "Fichier du programme"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for Free Pascal Compiler messages"
|
||
msgstr "Rechercher les messages de sortie de FPC"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for make messages"
|
||
msgstr "Rechercher les message Make de sortie"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolshift
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr "Titre et nom de fichier requis"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr "Répertoire de travail:"
|
||
|
||
#: lazarusidestrconsts.lisemdall
|
||
msgctxt "lazarusidestrconsts.lisemdall"
|
||
msgid "All"
|
||
msgstr "Tout"
|
||
|
||
#: lazarusidestrconsts.lisemdemtpymethods
|
||
msgid "Emtpy Methods"
|
||
msgstr "Méthodes vides"
|
||
|
||
#: lazarusidestrconsts.lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr "Trouvé les méthodes vide :"
|
||
|
||
#: lazarusidestrconsts.lisemdnoclass
|
||
msgid "No class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdnoclassat
|
||
msgid "No class at %s(%s,%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr "Publié seulement"
|
||
|
||
#: lazarusidestrconsts.lisemdpublic
|
||
msgid "Public"
|
||
msgstr "Publique"
|
||
|
||
#: lazarusidestrconsts.lisemdpublished
|
||
msgid "Published"
|
||
msgstr "Publiée"
|
||
|
||
#: lazarusidestrconsts.lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr "Supprimer les méthodes"
|
||
|
||
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr "Rechercher dans ces classes :"
|
||
|
||
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
||
msgid "Unable to show empty methods of the current class, because%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisempty
|
||
msgid "Empty"
|
||
msgstr "Vide"
|
||
|
||
#: lazarusidestrconsts.lisenableall
|
||
msgid "&Enable All"
|
||
msgstr "&Activer tout"
|
||
|
||
#: lazarusidestrconsts.lisenableallinsamesource
|
||
msgid "Enable All in same source"
|
||
msgstr "Activer tout dans la même source"
|
||
|
||
#: lazarusidestrconsts.lisenablebreakpoint
|
||
msgid "Enable Breakpoint"
|
||
msgstr "Activer le point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.lisenabled
|
||
msgctxt "lazarusidestrconsts.lisenabled"
|
||
msgid "Enabled"
|
||
msgstr "Permis "
|
||
|
||
#: lazarusidestrconsts.lisenablegroups
|
||
msgid "Enable Groups"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
||
msgid "Enable internationalization and translation support"
|
||
msgstr "Activer l'internationalisation et le support de la traduction"
|
||
|
||
#: lazarusidestrconsts.lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr "Permettre les macros"
|
||
|
||
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
||
msgid "Enable = replace whole identifier, Disable = replace prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenclose
|
||
msgid "Enclose"
|
||
msgstr "Entourer"
|
||
|
||
#: lazarusidestrconsts.lisencloseinifdef
|
||
msgid "Enclose in $IFDEF"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr "Encodage du fichier %s%s%s%s sur disque est %s. Le nouvel encodage est %s."
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr "Encodage du fichier %s%s%s%s sur disque est %s. Le nouvel encodage est %s."
|
||
|
||
#: lazarusidestrconsts.lisendlessloopinmacros
|
||
msgid "Endless loop in macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisentertransla
|
||
msgid "Enter translation language"
|
||
msgstr "Entrez la langue de traduction"
|
||
|
||
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
||
msgid "Environment variable, name as parameter"
|
||
msgstr "variable d'environnement, nom comme paramètre"
|
||
|
||
#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
|
||
msgid "Jump from message to source line on double click (otherwise: single click)"
|
||
msgstr "Saut de la fenêtre de message à la ligne du code source sur un double clic(autrement: un simple clic)"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr "Répertoire non trouvé"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
|
||
msgid "FPC source directory \"%s\" not found."
|
||
msgstr "Répertoire des sources de FPC \"%s\" non trouvé."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
|
||
msgid "Invalid compiler filename"
|
||
msgstr "Nom de fichier compilateur invalide"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
|
||
msgid "The compiler file \"%s\" is not an executable."
|
||
msgstr "Le compilateur \"%s\" n'est pas un exécutable."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr "Nom de débogueur invalide"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr "Le débogueur \"%s\" n'est pas un exécutable."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
|
||
#| msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
||
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
|
||
msgstr "Le répertoire source de FPC \"%s\" ne semble pas correct. Normalement il contient des répertoires comme rtl/inc, packages/fcl-base, ... ."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
|
||
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
||
msgstr "Le répertoire Lazarus '\"%s\" semble incorrect. Il contient normalement des répertoires comme lcl, debugger, designer, components, ... ."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
|
||
msgid "Invalid make filename"
|
||
msgstr "Nom de fichier 'make' non valide"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
|
||
msgid "The make file \"%s\" is not an executable."
|
||
msgstr "Le fichier 'make' '%s' n'est pas un exécutable."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
|
||
msgid "Lazarus directory \"%s\" not found."
|
||
msgstr "Répertoire de Lazarus \"%s\" non trouvé"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr "Répertoire de test \"%s\" non trouvé."
|
||
|
||
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
|
||
msgid "NOTE: only absolute paths are supported now"
|
||
msgstr "NOTE : seulement des chemins absolus sont supportés maintenant"
|
||
|
||
#: lazarusidestrconsts.liseotabwidths
|
||
msgctxt "lazarusidestrconsts.liseotabwidths"
|
||
msgid "Tab widths"
|
||
msgstr "Largeur de tabulation"
|
||
|
||
#: lazarusidestrconsts.liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr "Option non valide à la position %d : \"%s \""
|
||
|
||
#: lazarusidestrconsts.liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr "L'option à la position %d ne permet pas un argument : %s"
|
||
|
||
#: lazarusidestrconsts.liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr "L'option à la position %d a besoin d'un argument : %s"
|
||
|
||
#: lazarusidestrconsts.liserror
|
||
msgid "Error: "
|
||
msgstr "Erreur :"
|
||
|
||
#: lazarusidestrconsts.liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr "Erreur à la création du fichier"
|
||
|
||
#: lazarusidestrconsts.liserrorcreatinglrs
|
||
msgid "Error creating lrs"
|
||
msgstr "Erreur à la création du fichier lrs"
|
||
|
||
#: lazarusidestrconsts.liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr "Erreur à la suppression de fichier"
|
||
|
||
#: lazarusidestrconsts.liserrorin
|
||
msgid "Error in %s"
|
||
msgstr "Erreur dans %s"
|
||
|
||
#: lazarusidestrconsts.liserrorinitializingprogramserrors
|
||
msgid "Error initializing program%s%s%s%s%sError: %s"
|
||
msgstr "Erreur à l'initialisation du programme %s%s%s%s%sErreur : %s"
|
||
|
||
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
||
msgid "Error in the compiler file name:"
|
||
msgstr "Erreur dans le nom de fichier du compilateur:"
|
||
|
||
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
||
msgid "Error in the custom compiler options (Other):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
||
msgid "Error in the custom linker options (Linking / Pass options to linker):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
||
msgid "Error in the \"Debugger path addition\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
||
msgid "Error in the search path for \"Include files\":"
|
||
msgstr "Erreur dans le chemin de recherche der \"Include files\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
||
msgid "Error in the search path for \"Libraries\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
||
msgid "Error in the search path for \"Object files\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
||
msgid "Error in the search path for \"Other sources\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
||
msgid "Error in the search path for \"Other unit files\":"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
||
msgid "Error in the \"unit output directory\":"
|
||
msgstr "Erreur dans le \"unit output directory\":"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr "Erreur lors du chargement du fichier"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile2
|
||
msgid "Error loading file \"%s\":%s%s"
|
||
msgstr "Erreur de téléchargement du fichier \"%s\":%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfrom
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr "Erreur de chargement %s depuis %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr "Erreur en déplaçant le composant"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr "Erreur en déplaçant le composant %s:%s"
|
||
|
||
#: lazarusidestrconsts.liserrornamingcomponent
|
||
msgid "Error naming component"
|
||
msgstr "Erreur en nommant le composant"
|
||
|
||
#: lazarusidestrconsts.liserroropeningcomponent
|
||
msgid "Error opening component"
|
||
msgstr "Erreur d'ouverture du composant"
|
||
|
||
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr "Erreur d'analyse du flux de composant lfm."
|
||
|
||
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr "Erreur en lisant la liste des paquets du fichier %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxml
|
||
msgid "Error reading XML"
|
||
msgstr "Erreur de lecture XML"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxmlfile
|
||
msgid "Error reading xml file %s%s%s%s%s"
|
||
msgstr "Erreur de lecture du fichier XML %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr "Erreur en renommant le fichier"
|
||
|
||
#: lazarusidestrconsts.liserrors
|
||
msgctxt "lazarusidestrconsts.liserrors"
|
||
msgid "Errors"
|
||
msgstr "Erreurs"
|
||
|
||
#: lazarusidestrconsts.liserrorsavingto
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr "Erreur d'enregistrement %s dans%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
||
msgid "Error setting the name of a component %s to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorwritingfile
|
||
msgid "Error writing file \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr "Erreur lors de l'écriture de la liste des paquets dans le fichier%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liseteditcustomscanners
|
||
msgid "Edit custom scanners (%s)"
|
||
msgstr "Editer les analyseurs personnalisés(%s)"
|
||
|
||
#: lazarusidestrconsts.lisevalexpression
|
||
msgctxt "lazarusidestrconsts.lisevalexpression"
|
||
msgid "Eval expression"
|
||
msgstr "Evaluer l' expression"
|
||
|
||
#: lazarusidestrconsts.lisevaluate
|
||
msgid "E&valuate"
|
||
msgstr "É&valuer"
|
||
|
||
#: lazarusidestrconsts.lisevaluatemodify
|
||
msgid "&Evaluate/Modify"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseventlogclear
|
||
msgid "Clear Events"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseventlogoptions
|
||
msgid "Event Log Options ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseventlogsavetofile
|
||
msgid "Save Events to File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseventslogaddcomment
|
||
msgid "Add Comment ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseventslogaddcomment2
|
||
msgid "Add Comment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseverynthlinenumber
|
||
msgid "Every n-th line number:"
|
||
msgstr "Chaque n-ième numéro de ligne :"
|
||
|
||
#: lazarusidestrconsts.lisexamplefile
|
||
msgid "Example file:"
|
||
msgstr "fichier Exemple:"
|
||
|
||
#: lazarusidestrconsts.lisexamplesbuildallselected
|
||
msgid "Build all selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
||
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
msgstr "Exemples:%sIdentificateur%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
|
||
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
||
msgid "Open first selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexceptiondialog
|
||
msgid "Debugger Exception Notification"
|
||
msgstr "Notification d'exception du debogueur"
|
||
|
||
#: lazarusidestrconsts.lisexcludedatruntime
|
||
msgid "%s excluded at run time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexcludefilter
|
||
#, fuzzy
|
||
#| msgid "Exclude Filter"
|
||
msgid "Exclude filter"
|
||
msgstr "Filtre d'exclusion"
|
||
|
||
#: lazarusidestrconsts.lisexecutable
|
||
msgid "Executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr "Exécuter la commande suivante"
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr "Exécuter la commande précédente"
|
||
|
||
#: lazarusidestrconsts.lisexecutionpaused
|
||
msgid "Execution paused"
|
||
msgstr "Exécution suspendue"
|
||
|
||
#: lazarusidestrconsts.lisexecutionpausedadress
|
||
msgid "Execution paused%s Address: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
||
msgstr "Exécution suspendue%s Adresse : $%s%s Procédure : %s%s Fichier : %s%s(un jour une fenêtre d'assembleur pourrait apparaître ici :))%s"
|
||
|
||
#: lazarusidestrconsts.lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr "Exécution interrompue"
|
||
|
||
#: lazarusidestrconsts.lisexeprograms
|
||
msgid "Programs"
|
||
msgstr "Programmes"
|
||
|
||
#: lazarusidestrconsts.lisexpandall
|
||
msgid "Expand All (*)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr "Développer toutes les classes"
|
||
|
||
#: lazarusidestrconsts.lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr "Développer tous les paquets"
|
||
|
||
#: lazarusidestrconsts.lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr "Développer toutes les unités"
|
||
|
||
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr "Nom étendu du fichier de l'éditeur courant"
|
||
|
||
#: lazarusidestrconsts.lisexport
|
||
msgid "Export ..."
|
||
msgstr "Exporter ..."
|
||
|
||
#: lazarusidestrconsts.lisexportlist
|
||
msgid "Export list"
|
||
msgstr "Liste d'export"
|
||
|
||
#: lazarusidestrconsts.lisexpression
|
||
msgid "Expression:"
|
||
msgstr "Expression :"
|
||
|
||
#: lazarusidestrconsts.lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr "Etendre le chemin d'unité ?"
|
||
|
||
#: lazarusidestrconsts.lisextract
|
||
msgid "Extract"
|
||
msgstr "Extraire"
|
||
|
||
#: lazarusidestrconsts.lisextractprocedure
|
||
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
||
msgid "Extract Procedure"
|
||
msgstr "Extraire procédure"
|
||
|
||
#: lazarusidestrconsts.lisexttoolexternaltools
|
||
#, fuzzy
|
||
#| msgid "External tools"
|
||
msgid "External Tools"
|
||
msgstr "Outils externes"
|
||
|
||
#: lazarusidestrconsts.lisexttoolfailedtoruntool
|
||
msgid "Failed to run tool"
|
||
msgstr "L'exécution de l'outil a échoué"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr "Nombre maximum d'outils atteint"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmovedown
|
||
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
|
||
msgid "Down"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmoveup
|
||
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
|
||
msgid "Up"
|
||
msgstr "Haut"
|
||
|
||
#: lazarusidestrconsts.lisexttoolremove
|
||
msgctxt "lazarusidestrconsts.lisexttoolremove"
|
||
msgid "Remove"
|
||
msgstr "Retirer"
|
||
|
||
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr "Le nombre d'outils est limité à %s."
|
||
|
||
#: lazarusidestrconsts.lisexttooltitlecompleted
|
||
msgid "\"%s\" completed"
|
||
msgstr "\"%s\" terminé"
|
||
|
||
#: lazarusidestrconsts.lisexttoolunabletorunthetool
|
||
msgid "Unable to run the tool %s%s%s:%s%s"
|
||
msgstr "Impossible d'exécuter l'outil %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
||
msgid "Failed to create Application Bundle for \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
||
msgid "Failed to load fold state"
|
||
msgstr "Echec du téléchargement de l'état de repliement"
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr "Réduire le traçage du designer"
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr "Dessiner les éléments du designer seulement quand inactif (réduit la charge sur ordinateurs lents)"
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Le fichier %s%s%s n'a pas l'air d'un fichier texte.%sL'ouvrir quand même ?"
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Le fichier %s%s%s n'a pas l'air d'un fichier texte.%sL'ouvrir quand même ?"
|
||
|
||
#: lazarusidestrconsts.lisfileextensionofprograms
|
||
msgid "File extension of programs"
|
||
msgstr "Extension de fichier des programmes"
|
||
|
||
#: lazarusidestrconsts.lisfilefilter
|
||
msgid "File filter"
|
||
msgstr "Filtre fichier"
|
||
|
||
#: lazarusidestrconsts.lisfilefilters
|
||
msgid "File Filters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersaddrow
|
||
msgid "Add Row"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
||
msgid "Delete Row"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
||
msgid "Insert Row"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersmask
|
||
msgid "File mask"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersname
|
||
msgctxt "lazarusidestrconsts.lisfilefiltersname"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
||
msgid "Set defaults"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefilterstitle
|
||
msgid "These are file filters that will appear in all File Open dialogs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilehaschangedsave
|
||
msgid "File %s%s%s has changed. Save?"
|
||
msgstr "Le fichier %s%s%s a été modifié. L'enregistrer ?"
|
||
|
||
#: lazarusidestrconsts.lisfilehasnoproject
|
||
msgid "File has no project"
|
||
msgstr "Le fichier n'a pas de projet"
|
||
|
||
#: lazarusidestrconsts.lisfileisdirectory
|
||
msgid "File is directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileisnotanexecutable
|
||
msgid "File is not an executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr "Fichier protégé en écriture"
|
||
|
||
#: lazarusidestrconsts.lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr "Le fichier est un lien symbolique"
|
||
|
||
#: lazarusidestrconsts.lisfileisvirtual
|
||
msgid "File %s%s%s is virtual."
|
||
msgstr "Le fichier %s%s%s est virtuel."
|
||
|
||
#: lazarusidestrconsts.lisfilelinkerror
|
||
msgid "File link error"
|
||
msgstr "Erreur de fichier lien"
|
||
|
||
#: lazarusidestrconsts.lisfilenameaddress
|
||
msgid "Filename/Address"
|
||
msgstr "Nom de fichier/Adresse"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr "Fichier non trouvé"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound2
|
||
msgid "File %s%s%s not found.%s"
|
||
msgstr "Fichier %s%s%s non trouvé.%s"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound3
|
||
msgid "file %s not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound4
|
||
msgid "file not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
||
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
||
msgstr "Fichier %s%s%s non trouvé.%sSouhaitez-vous le créer ?%s"
|
||
|
||
#: lazarusidestrconsts.lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr "Fichier pas en minuscules"
|
||
|
||
#: lazarusidestrconsts.lisfilenottext
|
||
msgid "File not text"
|
||
msgstr "Pas un fichier texte"
|
||
|
||
#: lazarusidestrconsts.lisfilesettings
|
||
#, fuzzy
|
||
#| msgid "File Settings ..."
|
||
msgid "File Settings"
|
||
msgstr "paramêtres fichiers"
|
||
|
||
#: lazarusidestrconsts.lisfileshaverightencoding
|
||
msgid "*** All found files already have the right encoding ***"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
||
msgid "Files in ASCII or UTF-8 encoding"
|
||
msgstr "Fichiers encodé ASCII ou UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
||
msgid "Files not in ASCII nor UTF-8 encoding"
|
||
msgstr "Fichiers non encodé ASCII ou UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr "Où est écrit le fichier de déboguage. Si on ne l'indique pas, la sortie de déboguage est écrit sur la console. "
|
||
|
||
#: lazarusidestrconsts.lisfilter
|
||
msgid "Filter"
|
||
msgstr "Filtre"
|
||
|
||
#: lazarusidestrconsts.lisfilter2
|
||
msgid "(filter)"
|
||
msgstr "(Filtre)"
|
||
|
||
#: lazarusidestrconsts.lisfilter3
|
||
msgid "Filter: %s"
|
||
msgstr "Filtre: %s"
|
||
|
||
#: lazarusidestrconsts.lisfiltersets
|
||
msgid "Filter Sets"
|
||
msgstr "Jeu de filtres"
|
||
|
||
#: lazarusidestrconsts.lisfindfiledirectory
|
||
msgid "D&irectory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfiledirectoryoptions
|
||
msgid "Directory options"
|
||
msgstr "Options du répertoire"
|
||
|
||
#: lazarusidestrconsts.lisfindfilefilemask
|
||
msgid "Fi&le mask"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
||
#, fuzzy
|
||
#| msgid "Include sub directories"
|
||
msgid "Include &sub directories"
|
||
msgstr "Inclure les sous-répertoires"
|
||
|
||
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr "Modèle &Multi-ligne"
|
||
|
||
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr "Seulement les fichiers texte"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
||
msgid "search all files in &project"
|
||
msgstr "Rechercher dans tous les fichiers du &projet"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
||
msgid "search all &open files"
|
||
msgstr "Rechercher dans tous les fichiers &ouverts"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
||
msgid "search in &directories"
|
||
msgstr "Rechercher dans les &répertoires"
|
||
|
||
#: lazarusidestrconsts.lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr "Ou"
|
||
|
||
#: lazarusidestrconsts.lisfindkeycombination
|
||
msgid "Find key combination"
|
||
msgstr "Trouver la combinaison de touches"
|
||
|
||
#: lazarusidestrconsts.lisfindmissingunit
|
||
msgid "Find missing unit"
|
||
msgstr "Trouver l'unité manquante"
|
||
|
||
#: lazarusidestrconsts.lisfirst
|
||
msgid "First"
|
||
msgstr "Premier"
|
||
|
||
#: lazarusidestrconsts.lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr "Corriger fichier LFM"
|
||
|
||
#: lazarusidestrconsts.lisfloatingpoin
|
||
msgid "Floating Point"
|
||
msgstr "Virgule flottante"
|
||
|
||
#: lazarusidestrconsts.lisfocushint
|
||
msgid "Focus hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr "Forcer le renommage"
|
||
|
||
#: lazarusidestrconsts.lisform
|
||
msgid "Form"
|
||
msgstr "Fiche"
|
||
|
||
#: lazarusidestrconsts.lisformaterror
|
||
msgid "Format error"
|
||
msgstr "Erreur de format"
|
||
|
||
#: lazarusidestrconsts.lisformloaderror
|
||
msgid "Form load error"
|
||
msgstr "Erreur au chargement de la fiche"
|
||
|
||
#: lazarusidestrconsts.lisfoundversionexpected
|
||
msgid "Found version %s, expected %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpccfgismissing
|
||
msgid "fpc.cfg is missing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcmakefailed
|
||
msgid "fpcmake failed"
|
||
msgstr "Fpcmake échoué"
|
||
|
||
#: lazarusidestrconsts.lisfpcmessagefile
|
||
msgid "FPC message file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcomponents
|
||
msgctxt "lazarusidestrconsts.lisfpcomponents"
|
||
msgid "Components"
|
||
msgstr "Composants"
|
||
|
||
#: lazarusidestrconsts.lisfpcresources
|
||
msgid "FPC resources"
|
||
msgstr "Resources FPC :"
|
||
|
||
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
|
||
msgid "FPC Source Directory error"
|
||
msgstr "Erreur sur le répertoire des sources de FPC"
|
||
|
||
#: lazarusidestrconsts.lisfpcsources
|
||
msgid "FPC sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpctooold
|
||
msgid "FPC too old"
|
||
msgstr "FPC trop vieux"
|
||
|
||
#: lazarusidestrconsts.lisfpcversion
|
||
msgid "FPC Version: "
|
||
msgstr "Version FPC :"
|
||
|
||
#: lazarusidestrconsts.lisfpcversioneg222
|
||
msgid "FPC Version (e.g. 2.2.2)"
|
||
msgstr "Version FPC (ex. 2.2.2)"
|
||
|
||
#: lazarusidestrconsts.lisfpdoceditor
|
||
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
||
msgid "FPDoc Editor"
|
||
msgstr "Editeur FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisfpdocerrorwriting
|
||
msgid "Error writing \"%s\"%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
||
msgid "FPDoc syntax error"
|
||
msgstr "Erreur de syntaxe de FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
||
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
||
msgstr "Il y a une erreur de syntaxe dans l'élément fpdoc \"%s\":%s%s"
|
||
|
||
#: lazarusidestrconsts.lisfpfindpalettecomponent
|
||
msgid "Find palette component"
|
||
msgstr "Rechercher la palette des composants"
|
||
|
||
#: lazarusidestrconsts.lisframe
|
||
msgid "Frame"
|
||
msgstr "Cadre"
|
||
|
||
#: lazarusidestrconsts.lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr "&Recherche en arrière"
|
||
|
||
#: lazarusidestrconsts.lisfreepascal
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalcompilernotfound
|
||
msgid "Free Pascal Compiler not found"
|
||
msgstr "Compilateur Free Pascal introuvable"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
|
||
#, fuzzy
|
||
#| msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
||
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
|
||
msgstr "Programme freepascal employant TCustomApplication pour vérifier facilement les options en ligne de commande, manipulation des exceptions, etc. Le fichier de programme est automatiquement maintenu par Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
||
#, fuzzy
|
||
#| msgid "Freepascal source directory"
|
||
msgid "Free Pascal source directory"
|
||
msgstr "Répertoire des sources FreePascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcefile
|
||
#, fuzzy
|
||
#| msgid "FreePascal source file"
|
||
msgid "Free Pascal source file"
|
||
msgstr "Fichier source FreePascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
|
||
msgid "Free Pascal Sources not found"
|
||
msgstr "Sources Free Pascal introuvables"
|
||
|
||
#: lazarusidestrconsts.lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr "Recherche vers l'&avant"
|
||
|
||
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr "Fichiers additionnels à chercher (ex. /chemin/*.pas;/chemin2/*.pp)"
|
||
|
||
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr "Trouver ou renommer l'identificateur"
|
||
|
||
#: lazarusidestrconsts.lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr "Trouver les références"
|
||
|
||
#: lazarusidestrconsts.lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr "Identificateur : %s"
|
||
|
||
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr "dans tous les paquets et projets ouverts"
|
||
|
||
#: lazarusidestrconsts.lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr "dans l'unité courante"
|
||
|
||
#: lazarusidestrconsts.lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr "dans le projet principal"
|
||
|
||
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr "dans le projet/paquet possédant l'unité courante"
|
||
|
||
#: lazarusidestrconsts.lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr "Identificateur non valide"
|
||
|
||
#: lazarusidestrconsts.lisfrirename
|
||
msgctxt "lazarusidestrconsts.lisfrirename"
|
||
msgid "Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr "Renommer toutes les références"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameto
|
||
msgid "Rename to"
|
||
msgstr "Renommer en"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr "Chercher aussi dans les commentaires"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchwhere
|
||
msgid "Search where"
|
||
msgstr "Chercher où"
|
||
|
||
#: lazarusidestrconsts.lisfunction
|
||
msgctxt "lazarusidestrconsts.lisfunction"
|
||
msgid "Function"
|
||
msgstr "Fonction"
|
||
|
||
#: lazarusidestrconsts.lisgeneral
|
||
msgctxt "lazarusidestrconsts.lisgeneral"
|
||
msgid "General"
|
||
msgstr "Général"
|
||
|
||
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
||
msgid "get word at current cursor position"
|
||
msgstr "obtient le mot à la position du curseur courante"
|
||
|
||
#: lazarusidestrconsts.lisgotoline
|
||
#, fuzzy
|
||
#| msgid "Goto line"
|
||
msgid "Goto Line"
|
||
msgstr "Aller à la ligne"
|
||
|
||
#: lazarusidestrconsts.lisgotoselectedsourceline
|
||
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
|
||
msgid "Goto selected source line"
|
||
msgstr "Aller à la ligne du source sélectionnée"
|
||
|
||
#: lazarusidestrconsts.lisgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lisgroup
|
||
msgid "Group"
|
||
msgstr "Groupe"
|
||
|
||
#: lazarusidestrconsts.lisgroupassignexisting
|
||
msgid "Assign to existing \"%s\" group?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroupemptydelete
|
||
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroupemptydeletemore
|
||
msgid "%sThere are %d more empty groups, delete all?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
|
||
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroupnameinput
|
||
msgid "Group name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroupnameinvalid
|
||
msgid "BreakpointGroup name must be a valid Pascal identifier name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroupsetnew
|
||
msgid "Set new group..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroupsetnone
|
||
msgid "Clear group(s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr "Agrandir au plus grand"
|
||
|
||
#: lazarusidestrconsts.lishashelp
|
||
msgid "Has Help"
|
||
msgstr "a une aide"
|
||
|
||
#: lazarusidestrconsts.lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr "Commentaire d'en-tête pour la classe"
|
||
|
||
#: lazarusidestrconsts.lishelpentries
|
||
msgid "Help entries"
|
||
msgstr "Aide entrées"
|
||
|
||
#: lazarusidestrconsts.lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "Sélecteur d'aide"
|
||
|
||
#: lazarusidestrconsts.lishexadecimal
|
||
msgid "Hexadecimal"
|
||
msgstr "Hexadécimal"
|
||
|
||
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
||
#, fuzzy
|
||
#| msgid "Help for FreePascal Compiler message"
|
||
msgid "Help for Free Pascal Compiler message"
|
||
msgstr "Aide pour les messages du compilateur FreePascal"
|
||
|
||
#: lazarusidestrconsts.lishidemessageviadirective
|
||
msgid "Hide message via directive"
|
||
msgstr "Cache rdes messages via une directive"
|
||
|
||
#: lazarusidestrconsts.lishint
|
||
msgid "Hint"
|
||
msgstr "Conseil"
|
||
|
||
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
||
msgid "Hint: A default value can be defined in the conditionals."
|
||
msgstr "Astuce: Une valeur par défaut peut être définie dans les expressions conditionnelles."
|
||
|
||
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr "Suggestion : Vérifier si deux paquets contiennent une unité du même nom."
|
||
|
||
#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
|
||
msgid "Hint: double click on the command you want to edit"
|
||
msgstr "Astuce: double-cliquez sur la commande que vous souhaitez modifier"
|
||
|
||
#: lazarusidestrconsts.lishintopen
|
||
msgctxt "lazarusidestrconsts.lishintopen"
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: lazarusidestrconsts.lishintpause
|
||
msgctxt "lazarusidestrconsts.lishintpause"
|
||
msgid "Pause"
|
||
msgstr "Pause"
|
||
|
||
#: lazarusidestrconsts.lishintrun
|
||
msgctxt "lazarusidestrconsts.lishintrun"
|
||
msgid "Run"
|
||
msgstr "Exécuter"
|
||
|
||
#: lazarusidestrconsts.lishintsave
|
||
msgctxt "lazarusidestrconsts.lishintsave"
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: lazarusidestrconsts.lishintsaveall
|
||
msgid "Save all"
|
||
msgstr "Tout enregistrer"
|
||
|
||
#: lazarusidestrconsts.lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr "Pas à pas approfondi"
|
||
|
||
#: lazarusidestrconsts.lishintstepout
|
||
msgid "Run until function returns"
|
||
msgstr "Execute jusqu'au retour de fonction"
|
||
|
||
#: lazarusidestrconsts.lishintstepover
|
||
msgid "Step Over"
|
||
msgstr "Pas à pas"
|
||
|
||
#: lazarusidestrconsts.lishintstop
|
||
msgctxt "lazarusidestrconsts.lishintstop"
|
||
msgid "Stop"
|
||
msgstr "Arrêter"
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr "Conseil : la fonction \"Make Ressourcestring\" s'attend à une constante chaîne.%sVeuillez choisir l'expression et réessayer."
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
||
msgstr "Conseil : la fonction \"Make Ressourcestring\" attend une constante chaîne.%sVeuillez choisir seulement une expression de type chaîne et réessayer."
|
||
|
||
#: lazarusidestrconsts.lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr "Commutation Fiche/Unité"
|
||
|
||
#: lazarusidestrconsts.lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr "Afficher les Fiches"
|
||
|
||
#: lazarusidestrconsts.lishintviewunits
|
||
msgid "View Units"
|
||
msgstr "Afficher les Unités"
|
||
|
||
#: lazarusidestrconsts.lishitcount
|
||
msgid "Hitcount"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr "Bases de données"
|
||
|
||
#: lazarusidestrconsts.lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "Options de l'aide"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr "Propriétés:"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr "Visualiseurs"
|
||
|
||
#: lazarusidestrconsts.lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr "Chemin FPC Doc HTML"
|
||
|
||
#: lazarusidestrconsts.lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr "Horizontal"
|
||
|
||
#: lazarusidestrconsts.liside
|
||
msgid "IDE"
|
||
msgstr "EDI"
|
||
|
||
#: lazarusidestrconsts.lisidebuildoptions
|
||
msgid "IDE build options"
|
||
msgstr "Options de création de l'IDE"
|
||
|
||
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
||
msgid "Creating Makefile for package %s"
|
||
msgstr "Creation du Makefile pour le paquet %s"
|
||
|
||
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
|
||
msgid "Error: running 'compile after' tool failed for package %s"
|
||
msgstr "Erreur: L'execution de l'outil 'compile after' a échoué pour le paquet %s"
|
||
|
||
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
||
msgid "Information about the IDE"
|
||
msgstr "Information à propos de l'IDE"
|
||
|
||
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
|
||
msgid "WARNING: unit name invalid %s, package=%s"
|
||
msgstr "ATTENTION:nom d'unité non valide %s, paquet=%s"
|
||
|
||
#: lazarusidestrconsts.lisidemacros
|
||
msgid "IDE Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidentifier
|
||
msgid "identifier"
|
||
msgstr "Identificateur"
|
||
|
||
#: lazarusidestrconsts.lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr "L'identificateur commence par..."
|
||
|
||
#: lazarusidestrconsts.lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr "L'dentificateur contient ..."
|
||
|
||
#: lazarusidestrconsts.lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr "Options de l'EDI :"
|
||
|
||
#: lazarusidestrconsts.lisideprojectdirinidetitle
|
||
msgid "Show project directory in IDE title"
|
||
msgstr "Voir le répertoire du projet dans le titre de l'IDE"
|
||
|
||
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
||
msgid "IDE title starts with project name"
|
||
msgstr "Le titre de l'IDE débute avec le nom du projet"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroraccessingxml
|
||
msgid "Error accessing xml"
|
||
msgstr "Erreur d'accès xml"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
|
||
msgid "Error accessing xml file %s%s%s:%s%s"
|
||
msgstr "Erreur d'accès au fichier xml %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoerrorloadingxml
|
||
msgid "Error loading xml"
|
||
msgstr "Erreur de chargement xml"
|
||
|
||
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
|
||
msgid "Error loading xml file %s%s%s:%s%s"
|
||
msgstr "Erreur de chargement du fichier xml %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr "Le fichier d'export existe"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr "Le fichier d'export %s%s%s existe.%sOuvrir le fichier et remplacer seulement les options du compilateur?%s(les autres paramètres seront conservés.)"
|
||
|
||
#: lazarusidestrconsts.lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr "Charger depuis un fichier"
|
||
|
||
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
|
||
msgid "Open or Load Compiler Options"
|
||
msgstr "Ouvrir ou charger les options du compilateur"
|
||
|
||
#: lazarusidestrconsts.lisiecoopenrecent
|
||
msgid "Open recent"
|
||
msgstr "Ouverture récente"
|
||
|
||
#: lazarusidestrconsts.lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr "Fichiers récents"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "Enregistrer dans un fichier"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetorecent
|
||
msgid "Save to recent"
|
||
msgstr "Enregistrer dans un fichier récent"
|
||
|
||
#: lazarusidestrconsts.lisifdok
|
||
msgctxt "lazarusidestrconsts.lisifdok"
|
||
msgid "OK"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts.lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr "Ignorer tout"
|
||
|
||
#: lazarusidestrconsts.lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr "Ignorer et continuer"
|
||
|
||
#: lazarusidestrconsts.lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr "Ignorer les binaires"
|
||
|
||
#: lazarusidestrconsts.lisignoreexceptiontype
|
||
msgid "Ignore this exception type"
|
||
msgstr "Ignorer ce type d'exception"
|
||
|
||
#: lazarusidestrconsts.lisignoremissingfile
|
||
msgid "Ignore missing file"
|
||
msgstr "Ignorer le fichier manquant"
|
||
|
||
#: lazarusidestrconsts.lisignoreusetformasancestor
|
||
msgid "Ignore, use TForm as ancestor"
|
||
msgstr "Ignorer, employer TForm comme ancêtre "
|
||
|
||
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
||
msgid "Imitate indentation of current unit, project or package"
|
||
msgstr "Imite l'indentation de l'unité, du projet ou du paquet en cours"
|
||
|
||
#: lazarusidestrconsts.lisimplementationcommentforclass
|
||
msgid "Implementation comment for class"
|
||
msgstr "Commentaire d'implémentation pour la classe"
|
||
|
||
#: lazarusidestrconsts.lisimportlist
|
||
msgid "Import list"
|
||
msgstr "Liste d'import"
|
||
|
||
#: lazarusidestrconsts.lisimpossible
|
||
msgid "Impossible"
|
||
msgstr "Impossible"
|
||
|
||
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
||
msgid "In a source directory of the package \"%s\"."
|
||
msgstr "Dans un répertoire source du paquet \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
||
msgid "In a source directory of the project. Check for duplicates."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisincludeexamples
|
||
msgid "Include Examples"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisincludefilter
|
||
#, fuzzy
|
||
#| msgid "Include Filter"
|
||
msgid "Include filter"
|
||
msgstr "Inclure le filtre"
|
||
|
||
#: lazarusidestrconsts.lisincludepath
|
||
msgid "include path"
|
||
msgstr "chemin 'include'"
|
||
|
||
#: lazarusidestrconsts.lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr "Inclure les chemins"
|
||
|
||
#: lazarusidestrconsts.lisincludetestcases
|
||
msgid "Include Testcases"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisindentation
|
||
msgid "Indentation"
|
||
msgstr "Indentation"
|
||
|
||
#: lazarusidestrconsts.lisindentationforpascalsources
|
||
msgid "Indentation for pascal sources"
|
||
msgstr "Indentation des sources en pascal"
|
||
|
||
#: lazarusidestrconsts.lisindex
|
||
msgid "Index"
|
||
msgstr "Index"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildabort
|
||
#, fuzzy
|
||
#| msgid "Aborted..."
|
||
msgid "Aborted ..."
|
||
msgstr "Abandonner..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuildcaption
|
||
msgid "Compile Project"
|
||
msgstr "Compiler le projet"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildcomplile
|
||
#, fuzzy
|
||
#| msgid "Compiling..."
|
||
msgid "Compiling ..."
|
||
msgstr "Compilation ..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuilderror
|
||
#, fuzzy
|
||
#| msgid "Error..."
|
||
msgid "Error ..."
|
||
msgstr "Erreur..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuilderrors
|
||
msgid "Errors:"
|
||
msgstr "Erreurs :"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildhint
|
||
msgid "Hints:"
|
||
msgstr "Conseils :"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildlines
|
||
msgctxt "lazarusidestrconsts.lisinfobuildlines"
|
||
msgid "Lines:"
|
||
msgstr "Lignes :"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildmakeabort
|
||
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
|
||
msgid "Abort"
|
||
msgstr "Abandon"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildnote
|
||
msgid "Notes:"
|
||
msgstr "Notes :"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildproject
|
||
msgid "Project:"
|
||
msgstr "Projet:"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildsuccess
|
||
#, fuzzy
|
||
#| msgid "Success..."
|
||
msgid "Success ..."
|
||
msgstr "Succès..."
|
||
|
||
#: lazarusidestrconsts.lisinfobuildwarning
|
||
msgid "Warnings:"
|
||
msgstr "Avertissements"
|
||
|
||
#: lazarusidestrconsts.lisinformation
|
||
msgid "Information"
|
||
msgstr "Information"
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr "Informations sur %s"
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
||
msgid "Information about used FPC"
|
||
msgstr "Information sur FPC utilisé"
|
||
|
||
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
||
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfrontofrelated
|
||
#, fuzzy
|
||
msgid "In front of related"
|
||
msgstr "Devant les méthodes"
|
||
|
||
#: lazarusidestrconsts.lisinheriteditem
|
||
msgid "Inherited Item"
|
||
msgstr "Élément hérité"
|
||
|
||
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
||
msgid "Inherited project component"
|
||
msgstr "Composant du projet hérité"
|
||
|
||
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
||
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
||
msgstr "Afin de créer une copie prope du projet/paquet, tous les fichiers dans le répertoire suivant seront supprimés et tout son contenu sera perdu.%s%sSupprimer tous les fichiers dans %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts.lisinsertdate
|
||
msgid "insert date"
|
||
msgstr "Insérer date"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtime
|
||
msgid "insert date and time"
|
||
msgstr "Insérer date et heure"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
||
msgid "Insert date and time. Optional: format string"
|
||
msgstr "Insérer la date et l'heure. Facultatif: format chaîne de caractère"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
||
msgid "Insert date. Optional: format string"
|
||
msgstr "Insérer la date. Facultatif: format chaîne de caractère"
|
||
|
||
#: lazarusidestrconsts.lisinsertendifneeded
|
||
msgid "insert end if needed"
|
||
msgstr "Insère end si nécessaire"
|
||
|
||
#: lazarusidestrconsts.lisinsertmacro
|
||
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
||
msgid "Insert Macro"
|
||
msgstr "Insérer une macro"
|
||
|
||
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
||
msgid "Insert name of current procedure"
|
||
msgstr "Insére le nom de la procédure courante"
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag
|
||
msgid "Insert PrintShort tag"
|
||
msgstr "insère la balise PrintShort"
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag2
|
||
msgid "Insert printshort tag"
|
||
msgstr "Insère la balise printshort"
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurehead
|
||
msgid "insert procedure head"
|
||
msgstr "Insère un entête de procédure"
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurename
|
||
msgid "insert procedure name"
|
||
msgstr "Insérer un nom de procédure"
|
||
|
||
#: lazarusidestrconsts.lisinserttime
|
||
msgid "insert time"
|
||
msgstr "Insérer l'heure"
|
||
|
||
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
||
#, fuzzy
|
||
msgid "Insert time. Optional: format string"
|
||
msgstr "Insérer la date. Facultatif: format chaîne de caractère"
|
||
|
||
#: lazarusidestrconsts.lisinserturltag
|
||
msgid "Insert url tag"
|
||
msgstr "Insérer une balise url"
|
||
|
||
#: lazarusidestrconsts.lisinsession
|
||
msgid "In session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspect
|
||
msgid "&Inspect"
|
||
msgstr "&Inspecter"
|
||
|
||
#: lazarusidestrconsts.lisinspectdata
|
||
msgid "Data"
|
||
msgstr "Données"
|
||
|
||
#: lazarusidestrconsts.lisinspectdialog
|
||
msgid "Debug Inspector"
|
||
msgstr "Inspecteur de débogage"
|
||
|
||
#: lazarusidestrconsts.lisinspectmethods
|
||
msgid "Methods"
|
||
msgstr "Méthodes"
|
||
|
||
#: lazarusidestrconsts.lisinspectproperties
|
||
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
||
msgid "Properties"
|
||
msgstr "Propriétés "
|
||
|
||
#: lazarusidestrconsts.lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr "Installation ratée"
|
||
|
||
#: lazarusidestrconsts.lisinstallitilikethefat
|
||
msgid "Install it, I like the fat"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "Installer la sélection"
|
||
|
||
#: lazarusidestrconsts.lisinstalluninstallpackages
|
||
#, fuzzy
|
||
#| msgid "Install/Uninstall packages"
|
||
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
||
msgid "Install/Uninstall Packages"
|
||
msgstr "Installer/Désinstaller les paquets"
|
||
|
||
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
||
msgid "Instead of compile package create a simple Makefile."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinteractive
|
||
msgid "Interactive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr "Commande non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidcompilerfilename
|
||
msgid "Invalid Compiler Filename"
|
||
msgstr "Nom de compilateur non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr "Effacement non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvaliddestinationdirectory
|
||
msgid "Invalid destination directory"
|
||
msgstr "Répertoire de destination non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpression
|
||
msgid "Invalid expression:%s%s%s%s"
|
||
msgstr "Expression non valide :%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr "Expression non valide.%sConseil: la fonction \"Make Resourcestring\" s'attend à une constante de type chaîne dans un fichier unique. Veuillez choisir l'expression et réessayer."
|
||
|
||
#: lazarusidestrconsts.lisinvalidfilter
|
||
msgid "Invalid filter"
|
||
msgstr "Filtre non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
|
||
msgid "Invalid Free Pascal source directory"
|
||
msgstr "Répertoire source Free Pascal non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
||
msgid "Invalid line, column in message%s%s"
|
||
msgstr "Ligne non valide, colonne dans le message%s%s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
||
msgid "Invalid macro %s%s%s. The macro name must be a pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
||
msgid "Invalid macro name \"%s\". The name is a keyword."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmask
|
||
msgid "Invalid Mask"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmode
|
||
msgid "Invalid mode %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr "Sélection multiple non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidoff
|
||
msgid "Invalid (Off)"
|
||
msgstr "Invalide (Off)"
|
||
|
||
#: lazarusidestrconsts.lisinvalidon
|
||
msgid "Invalid (On)"
|
||
msgstr "Invalide (On)"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr "Identificateur Pascal invalide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
||
msgid "The name \"%s\" is not a valid pascal identifier."
|
||
msgstr "Le nom \"%s\" n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts.lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr "Nom de procédure non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr "Nom de fichier projet non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
||
msgid "Invalid publishing Directory"
|
||
msgstr "Répertoire de publication non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr "Sélection non valide"
|
||
|
||
#: lazarusidestrconsts.lisinvalidversionin
|
||
msgid "invalid version in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
|
||
msgid "%s is a group. A setting can only be added to normal build modes."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s fait déjà partie du projet"
|
||
|
||
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "%s%s%s n'est pas un nom de projet valide.%sVeuillez en choisir un autre (ex: project1.lpi)"
|
||
|
||
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
||
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisisddirectorynotfound
|
||
msgid "directory not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
||
msgid "I wonder how you did that. Error in the %s:"
|
||
msgstr "Je me demande comment vous avez fait cela. Erreur dans le %s:"
|
||
|
||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
||
msgid "I wonder how you did that: Error in the base directory:"
|
||
msgstr "Je me demande comment vous avez fait cela: Erreur dans le répertoire de base"
|
||
|
||
#: lazarusidestrconsts.lisjhjumphistory
|
||
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
||
msgid "Jump History"
|
||
msgstr "Historique des déplacements"
|
||
|
||
#: lazarusidestrconsts.liskeep
|
||
msgid "keep"
|
||
msgstr "garder"
|
||
|
||
#: lazarusidestrconsts.liskeep2
|
||
msgid "Keep"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepfileopen
|
||
msgid "Keep converted files open in editor"
|
||
msgstr "Conserver le fichiers convertis ouvert dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts.liskeepfileopenhint
|
||
msgid "All project files will be open in editor after conversion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepininstalllist
|
||
msgid "Keep in install list"
|
||
msgstr "Conserver dans la liste d'installation"
|
||
|
||
#: lazarusidestrconsts.liskeepname
|
||
msgid "Keep name"
|
||
msgstr "Préserver le nom"
|
||
|
||
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
||
msgid "Keep relative indentation of multi line template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepsubindentation
|
||
msgid "Keep indentation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr "Préserver et continuer"
|
||
|
||
#: lazarusidestrconsts.liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr "Commandes personnalisées"
|
||
|
||
#: lazarusidestrconsts.liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr "Commandes du concepteur"
|
||
|
||
#: lazarusidestrconsts.liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr "Commandes de l'inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts.liskeyor2keysequence
|
||
msgid "Key (or 2 key sequence)"
|
||
msgstr "Touche (ou séquence de 2 touches)"
|
||
|
||
#: lazarusidestrconsts.liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "Arrêter la création"
|
||
|
||
#: lazarusidestrconsts.liskmaddbpaddress
|
||
msgid "Add Address Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmaddbpsource
|
||
msgid "Add Source Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
||
msgid "Add Data/WatchPoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmaddwatch
|
||
msgid "Add watch"
|
||
msgstr "Ajouter un suivi"
|
||
|
||
#: lazarusidestrconsts.liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr "Créer le programme/projet"
|
||
|
||
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr "Choisir l'arrangement du clavier"
|
||
|
||
#: lazarusidestrconsts.liskmclassic
|
||
msgid "Classic"
|
||
msgstr "Classique"
|
||
|
||
#: lazarusidestrconsts.liskmcleanupcompiled
|
||
msgid "Clean up build files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmcloseall
|
||
msgid "Close All"
|
||
msgstr "Fermer tout"
|
||
|
||
#: lazarusidestrconsts.liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "Fermer le projet"
|
||
|
||
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr "Editeur des directives des outils de code ..."
|
||
|
||
#: lazarusidestrconsts.liskmcompileprojectprogram
|
||
msgid "Compile project/program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmcompileroptions
|
||
#, fuzzy
|
||
#| msgid "Compiler options"
|
||
msgctxt "lazarusidestrconsts.liskmcompileroptions"
|
||
msgid "Compiler Options"
|
||
msgstr "Options du compilateur"
|
||
|
||
#: lazarusidestrconsts.liskmconfigbuildfile
|
||
msgid "Config %sBuild File%s"
|
||
msgstr "Configurer %sla création de fichier%s"
|
||
|
||
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
||
#, fuzzy
|
||
#| msgid "Configure custom components"
|
||
msgid "Configure Custom Components"
|
||
msgstr "Configurer les composants personnalisés ..."
|
||
|
||
#: lazarusidestrconsts.liskmconfigurehelp
|
||
msgid "Configure Help"
|
||
msgstr "Configurer l'aide "
|
||
|
||
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr "Aide contextuelle"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr "Convertir un paquet Delphi en paquet Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi project to Lazarus project"
|
||
msgid "Convert Delphi Project to Lazarus Project"
|
||
msgstr "Convertir un projet Delphi en projet Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi unit to Lazarus unit"
|
||
msgid "Convert Delphi Unit to Lazarus Unit"
|
||
msgstr "Convertir une unité Delphi en unité Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
||
#, fuzzy
|
||
#| msgid "Convert DFM file to LFM"
|
||
msgid "Convert DFM File to LFM"
|
||
msgstr "Convertir un fichier DFM vers LFM"
|
||
|
||
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
||
msgid "Copy selected Components to clipboard"
|
||
msgstr "Copier les composants choisis vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
||
msgid "Cut selected Components to clipboard"
|
||
msgstr "Couper les composants choisis vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr "Effacer le dernier caractère"
|
||
|
||
#: lazarusidestrconsts.liskmdiffeditorfiles
|
||
#, fuzzy
|
||
#| msgid "Diff editor files"
|
||
msgid "Diff Editor Files"
|
||
msgstr "Editeur de différences "
|
||
|
||
#: lazarusidestrconsts.liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr "Editer les modèles de code"
|
||
|
||
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr "Éditer l'aide contextuelle"
|
||
|
||
#: lazarusidestrconsts.liskmencloseselection
|
||
#, fuzzy
|
||
#| msgid "Enclose selection"
|
||
msgid "Enclose Selection"
|
||
msgstr "Entourer la sélection"
|
||
|
||
#: lazarusidestrconsts.liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr "Evaluer/modifier "
|
||
|
||
#: lazarusidestrconsts.liskmexampleprojects
|
||
msgid "Example Projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr "Configuration d'outils externes "
|
||
|
||
#: lazarusidestrconsts.liskmfindincremental
|
||
#, fuzzy
|
||
#| msgid "Find incremental"
|
||
msgid "Find Incremental"
|
||
msgstr "Recherche incrémentale"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker0
|
||
msgid "Go to marker 0"
|
||
msgstr "Aller au marqueur 0"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker1
|
||
msgid "Go to marker 1"
|
||
msgstr "Aller au marqueur 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker2
|
||
msgid "Go to marker 2"
|
||
msgstr "Aller au marqueur 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker3
|
||
msgid "Go to marker 3"
|
||
msgstr "Aller au marqueur 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker4
|
||
msgid "Go to marker 4"
|
||
msgstr "Aller au marqueur 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker5
|
||
msgid "Go to marker 5"
|
||
msgstr "Aller au marqueur 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker6
|
||
msgid "Go to marker 6"
|
||
msgstr "Aller au marqueur 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker7
|
||
msgid "Go to marker 7"
|
||
msgstr "Aller au marqueur 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker8
|
||
msgid "Go to marker 8"
|
||
msgstr "Aller au marqueur 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker9
|
||
msgid "Go to marker 9"
|
||
msgstr "Aller au marqueur 9"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr "Aller à éditeur de source 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr "Aller à éditeur de source 10"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr "Aller à éditeur de source 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr "Aller à éditeur de source 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr "Aller à éditeur de source 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr "Aller à éditeur de source 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr "Aller à éditeur de source 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr "Aller à éditeur de source 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr "Aller à éditeur de source 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr "Aller à éditeur de source 9"
|
||
|
||
#: lazarusidestrconsts.liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr "Insérer la date et l'heure"
|
||
|
||
#: lazarusidestrconsts.liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr "Insérer le nom d'utilisateur"
|
||
|
||
#: lazarusidestrconsts.liskminspect
|
||
msgid "Inspect"
|
||
msgstr "Inspecter"
|
||
|
||
#: lazarusidestrconsts.liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr "Modèle de clavier"
|
||
|
||
#: lazarusidestrconsts.liskmlazarusdefault
|
||
msgid "Lazarus (default)"
|
||
msgstr "Lazarus (défaut)"
|
||
|
||
#: lazarusidestrconsts.liskmmacosxapple
|
||
msgid "Mac OS X (Apple style)"
|
||
msgstr "Mac OS X (Apple style)"
|
||
|
||
#: lazarusidestrconsts.liskmmacosxlaz
|
||
msgid "Mac OS X (Lazarus style)"
|
||
msgstr "Mac OS X (Lazarus style)"
|
||
|
||
#: lazarusidestrconsts.liskmnewpackage
|
||
msgid "New package"
|
||
msgstr "Nouveau paquet"
|
||
|
||
#: lazarusidestrconsts.liskmnewproject
|
||
msgid "New project"
|
||
msgstr "Nouveau projet"
|
||
|
||
#: lazarusidestrconsts.liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr "Nouveau projet depuis le fichier"
|
||
|
||
#: lazarusidestrconsts.liskmnewunit
|
||
msgctxt "lazarusidestrconsts.liskmnewunit"
|
||
msgid "New Unit"
|
||
msgstr "Nouvelle unité"
|
||
|
||
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
||
msgid "Note: All keys will be set to the values of the chosen scheme."
|
||
msgstr "Note: toutes les touches seront définies avec les valeurs du programme choisi"
|
||
|
||
#: lazarusidestrconsts.liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr "Ouvrir un fichier paquet"
|
||
|
||
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
||
msgid "Paste Components from clipboard"
|
||
msgstr "Coller les composants depuis le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr "suspendre le programme"
|
||
|
||
#: lazarusidestrconsts.liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr "Publier le projet ..."
|
||
|
||
#: lazarusidestrconsts.liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr "Compiler vite, aucun liens"
|
||
|
||
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
||
msgid "Remove Active File from Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr "Exécuter un programme"
|
||
|
||
#: lazarusidestrconsts.liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "Enregistrer tout"
|
||
|
||
#: lazarusidestrconsts.liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "Enregistrer sous"
|
||
|
||
#: lazarusidestrconsts.liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "Enregistrer le projet"
|
||
|
||
#: lazarusidestrconsts.liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "Enregistrer le projet sous"
|
||
|
||
#: lazarusidestrconsts.liskmselectlineend
|
||
#, fuzzy
|
||
#| msgid "Select line end"
|
||
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
||
msgid "Select Line End"
|
||
msgstr "Sélectionner fin de ligne"
|
||
|
||
#: lazarusidestrconsts.liskmselectlinestart
|
||
#, fuzzy
|
||
#| msgid "Select line start"
|
||
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
||
msgid "Select Line Start"
|
||
msgstr "Sélectionner début de ligne"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagebottom
|
||
#, fuzzy
|
||
#| msgid "Select page bottom"
|
||
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
||
msgid "Select Page Bottom"
|
||
msgstr "Sélectionner bas de page"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagetop
|
||
#, fuzzy
|
||
#| msgid "Select page top"
|
||
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
||
msgid "Select Page Top"
|
||
msgstr "Sélectionner haut de page"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordleft
|
||
#, fuzzy
|
||
#| msgid "Select word left"
|
||
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
||
msgid "Select Word Left"
|
||
msgstr "Sélectionner mot de gauche"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordright
|
||
#, fuzzy
|
||
#| msgid "Select word right"
|
||
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
||
msgid "Select Word Right"
|
||
msgstr "Sélectionner mot de droite"
|
||
|
||
#: lazarusidestrconsts.liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr "Mettre un signet libre"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker0
|
||
msgid "Set marker 0"
|
||
msgstr "Placer le marqueur 0"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker1
|
||
msgid "Set marker 1"
|
||
msgstr "Placer le marqueur 1"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker2
|
||
msgid "Set marker 2"
|
||
msgstr "Placer le marqueur 2"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker3
|
||
msgid "Set marker 3"
|
||
msgstr "Placer le marqueur 3"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker4
|
||
msgid "Set marker 4"
|
||
msgstr "Placer le marqueur 4"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker5
|
||
msgid "Set marker 5"
|
||
msgstr "Placer le marqueur 5"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker6
|
||
msgid "Set marker 6"
|
||
msgstr "Placer le marqueur 6"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker7
|
||
msgid "Set marker 7"
|
||
msgstr "Placer le marqueur 7"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker8
|
||
msgid "Set marker 8"
|
||
msgstr "Placer le marqueur 8"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker9
|
||
msgid "Set marker 9"
|
||
msgstr "Placer le marqueur 9"
|
||
|
||
#: lazarusidestrconsts.liskmstopprogram
|
||
#, fuzzy
|
||
#| msgid "Stop program"
|
||
msgid "Stop Program"
|
||
msgstr "Arrêter le programme"
|
||
|
||
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr "Commuter entre l'unité et la fiche"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker0
|
||
msgid "Toggle marker 0"
|
||
msgstr "Placer le marqueur 0"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker1
|
||
msgid "Toggle marker 1"
|
||
msgstr "Placer le marqueur 1"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker2
|
||
msgid "Toggle marker 2"
|
||
msgstr "Placer le marqueur 2"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker3
|
||
msgid "Toggle marker 3"
|
||
msgstr "Placer le marqueur 3"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker4
|
||
msgid "Toggle marker 4"
|
||
msgstr "Placer le marqueur 4"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker5
|
||
msgid "Toggle marker 5"
|
||
msgstr "Placer le marqueur 5"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker6
|
||
msgid "Toggle marker 6"
|
||
msgstr "Placer le marqueur 6"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker7
|
||
msgid "Toggle marker 7"
|
||
msgstr "Placer le marqueur 7"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker8
|
||
msgid "Toggle marker 8"
|
||
msgstr "Placer le marqueur 8"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker9
|
||
msgid "Toggle marker 9"
|
||
msgstr "Placer le marqueur 9"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewassembler
|
||
msgid "Toggle view Assembler"
|
||
msgstr "Commuter vue assembleur"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
||
msgid "Toggle view Breakpoints"
|
||
msgstr "Commuter vue Point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
||
msgid "Toggle view Call Stack"
|
||
msgstr "Commuter vue Pile d'appels"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr "Commuter vue Explorateur de code"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
||
#, fuzzy
|
||
#| msgid "Toggle view component palette"
|
||
msgid "Toggle View Component Palette"
|
||
msgstr "Commuter vue Palette de composants"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
||
msgid "Toggle view Debuger Event Log"
|
||
msgstr "Basculer la vue vers le journal d'événement du débogueur"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
||
msgid "Toggle view Debugger Output"
|
||
msgstr "Commuter vue Sortie du débogueur"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr "Commuter vue Editeur de documentation"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewhistory
|
||
msgid "Toggle view History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr "Commuter vue boutons rapides EDI"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
||
msgid "Toggle view Local Variables"
|
||
msgstr "Commuter vue Variables Locales"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr "Commuter vue Messages"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr "Commuter vue Inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
||
msgid "Toggle view Terminal Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewregisters
|
||
msgid "Toggle view Registers"
|
||
msgstr "Commuter sur la vuedes registres"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr "Commuter vue Résultats de recherche"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr "Commuter vue Editeur de source"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewthreads
|
||
msgid "Toggle view Threads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewwatches
|
||
msgid "Toggle view Watches"
|
||
msgstr "Commuter vue Suivi"
|
||
|
||
#: lazarusidestrconsts.liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr "Afficher l'historique des déplacements ..."
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr "Afficher les options du projet"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectsource
|
||
#, fuzzy
|
||
#| msgid "View project source"
|
||
msgid "View Project Source"
|
||
msgstr "Afficher les sources du projet"
|
||
|
||
#: lazarusidestrconsts.liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr "Afficher les Infos d'Unité"
|
||
|
||
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr "Lancement de l'application non valide"
|
||
|
||
#: lazarusidestrconsts.lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr "Lancement de la cible avec la ligne de commande"
|
||
|
||
#: lazarusidestrconsts.lislazarusdesktopsettings
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr "Paramêtres du bureau Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr "Répertoire de Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectorynotfound
|
||
msgid "Lazarus directory not found"
|
||
msgstr "Répertoire de Lazarus introuvable"
|
||
|
||
#: lazarusidestrconsts.lislazarusdiroverride
|
||
msgid "directory, to be used as a basedirectory"
|
||
msgstr "répertoire, à utiliser comme un répertoire de base"
|
||
|
||
#: lazarusidestrconsts.lislazaruseditorv
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr "EDI Lazarus v%s"
|
||
|
||
#: lazarusidestrconsts.lislazarusfile
|
||
#| msgid "Lazarus File"
|
||
msgid "Lazarus file"
|
||
msgstr "Fichier Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusform
|
||
msgid "Lazarus form"
|
||
msgstr "fiche Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr "EDI Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusinclude
|
||
msgid "Lazarus include file"
|
||
msgstr "Fichier d'inclusion Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr "Identificateur de langue de Lazarus (par exemple en, de, br, fi)"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr "Nom de langue de Lazarus (par exemple english, deutsch)"
|
||
|
||
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr "lazarus [options] <ficher-projet>"
|
||
|
||
#: lazarusidestrconsts.lislazarusotherfile
|
||
msgid "Lazarus other file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazaruspackage
|
||
msgid "Lazarus package"
|
||
msgstr "paquet Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusproject
|
||
msgid "Lazarus project"
|
||
msgstr "projet Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusprojectinfofile
|
||
msgid "Lazarus Project Info file"
|
||
msgstr "fichier d'information du projet Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusprojectsource
|
||
msgid "Lazarus project source"
|
||
msgstr "source du projet Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarussource
|
||
msgid "Lazarus Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazarusunit
|
||
msgid "Lazarus unit"
|
||
msgstr "unité Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazbuildaboaction
|
||
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
||
msgid "Action"
|
||
msgstr "Action"
|
||
|
||
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr "Choisissez le répertoire de sortie pour l'exécutable de l'EDI"
|
||
|
||
#: lazarusidestrconsts.lislazbuildadd
|
||
msgctxt "lazarusidestrconsts.lislazbuildadd"
|
||
msgid "Add"
|
||
msgstr "Ajouter"
|
||
|
||
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
||
msgid "Are you sure you want to delete this build profile?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuild
|
||
msgctxt "lazarusidestrconsts.lislazbuildbuild"
|
||
msgid "Build"
|
||
msgstr "Créer"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildcodetools
|
||
msgid "Build CodeTools"
|
||
msgstr "Création des outils de code"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
|
||
msgid "Build components (SynEdit, CodeTools)"
|
||
msgstr "Création des composants (SynEdit, CodeTools)"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildide
|
||
msgid "Build IDE"
|
||
msgstr "Création de l'EDI"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildingide
|
||
msgid "Building IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildjitform
|
||
msgid "Build JITForm"
|
||
msgstr "Création de JITForm"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildmany
|
||
msgid "Build Many"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildsynedit
|
||
msgid "Build SynEdit"
|
||
msgstr "Création de SynEdit"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcancel
|
||
msgctxt "lazarusidestrconsts.lislazbuildcancel"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcleanallbuild
|
||
msgid "Clean All + Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildcleanbuild
|
||
#, fuzzy
|
||
#| msgid "Clean+Build"
|
||
msgid "Clean + Build"
|
||
msgstr "Nettoyer+ Créer"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcommonsettings
|
||
msgid "Common Settings"
|
||
msgstr "Paramètres communs"
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
||
#| msgid "Confirm before rebuilding Lazarus"
|
||
msgid "Confirm before build"
|
||
msgstr "Confirmer avant la création"
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
||
msgid "Confirm deletion"
|
||
msgstr "Confirmez la suppression"
|
||
|
||
#: lazarusidestrconsts.lislazbuilddebugide
|
||
msgid "Debug IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuilddefines
|
||
msgid "Defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
||
msgid "Defines without -d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditdefines
|
||
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
||
msgid "Edit Defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
|
||
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
|
||
msgid "Edit Defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
||
msgid "Edit list of defines which can be used by any profile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Erreur d'écriture de fichier"
|
||
|
||
#: lazarusidestrconsts.lislazbuildidebuildhint
|
||
msgid "Build = \"make ide\", %sClean + Build = \"make cleanide ide\", %sClean All + Build = \"make cleanlaz ide\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildidewithoutpackages
|
||
msgid "IDE without Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
||
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
||
msgstr "%s%s%s%slazbuild n'est pas interactif, abandoner maintenant."
|
||
|
||
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
||
msgid "Manage Build Profiles"
|
||
msgstr "Gérer le profils de création"
|
||
|
||
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
||
msgid "Manage profiles"
|
||
msgstr "Gérer les profils"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
||
msgid "Name of the active profile"
|
||
msgstr "Nom du profil actif"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnewprof
|
||
msgid "Add New Profile"
|
||
msgstr "Ajouter un nouveau profil"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
||
msgid "Current build options will be associated with:"
|
||
msgstr "Les options courantes de création seront associées avec:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnormalide
|
||
msgid "Normal IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildok
|
||
#, fuzzy
|
||
#| msgid "Ok"
|
||
msgctxt "lazarusidestrconsts.lislazbuildok"
|
||
msgid "OK"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptimizedide
|
||
msgid "Optimized IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr "Options :"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
||
msgid "Options passed to compiler"
|
||
msgstr "Options passées au compilateur"
|
||
|
||
#: lazarusidestrconsts.lislazbuildprofile
|
||
#, fuzzy
|
||
#| msgid "Profile to Build"
|
||
msgid "Profile to build"
|
||
msgstr "Profil à créer"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrefresh
|
||
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
|
||
msgid "Refresh"
|
||
msgstr "Rafraîchir"
|
||
|
||
#: lazarusidestrconsts.lislazbuildremove
|
||
msgctxt "lazarusidestrconsts.lislazbuildremove"
|
||
msgid "Remove"
|
||
msgstr "Retirer"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrename
|
||
msgctxt "lazarusidestrconsts.lislazbuildrename"
|
||
msgid "Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrenameprof
|
||
msgid "Rename Profile"
|
||
msgstr "Renommer le profil"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
||
msgid "New name for profile:"
|
||
msgstr "Nouveau nom pour le profil:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
||
#| msgid "Restart after building the IDE"
|
||
msgid "Restart after building IDE"
|
||
msgstr "Redémarrer après la création de l'IDE"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
||
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
||
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
||
msgstr "Redemarrer Lazarus automatiquement après la création de L'IDE(n'a aucun effet quand on crée d'autres parties)"
|
||
|
||
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
||
msgid "Select profiles to build"
|
||
msgstr "Selectionner le profils à créer"
|
||
|
||
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
||
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
||
msgid "Show confirmation dialog when building directly from Tools menu"
|
||
msgstr "Voir une boite de dialogue de confirmation quand on lance la création directement du menu Outils"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr "CPU de destination"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr "Répertoire cible :"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr "OS de destination :"
|
||
|
||
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr "Impossible d'écrire le fichier \"%s\":%s"
|
||
|
||
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
||
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
||
msgid "Update revision.inc"
|
||
msgstr "Mise à jour de revision.inc"
|
||
|
||
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
||
msgid "Update revision info in \"About Lazarus\" dialog"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazcleanupbuildall
|
||
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
||
msgid "Clean Up + Build all"
|
||
msgstr "Nettoyer + créer tout"
|
||
|
||
#: lazarusidestrconsts.lislclwidgettype
|
||
#, fuzzy
|
||
#| msgid "LCL Widget Type"
|
||
msgid "LCL widget type"
|
||
msgstr "Type composant graphique LCL"
|
||
|
||
#: lazarusidestrconsts.lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr "Ajouter un lien à hérité"
|
||
|
||
#: lazarusidestrconsts.lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr "Copie depuis hérité "
|
||
|
||
#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
||
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr "%s ne dispose d'aucun chemin d'accès LazDoc valide.%sImpossible de créer le fichier pour %s"
|
||
|
||
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr "Déplacer les entrées vers hérité"
|
||
|
||
#: lazarusidestrconsts.lisldnovalidlazdocpath
|
||
msgid "No valid LazDoc path"
|
||
msgstr "Chemin LazDoc non valide"
|
||
|
||
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr "L'unité %s n'appartient à aucun paquet ou projet. %sVeuillez ajouter l'unité à un paquet ou à un projet. %s Impossible de créer le fichier fpdoc."
|
||
|
||
#: lazarusidestrconsts.lisleaveemptyfo
|
||
msgid "Leave empty for default .po file"
|
||
msgstr "Laissez vide pour le fichier .po par défaut"
|
||
|
||
#: lazarusidestrconsts.lisleft
|
||
msgctxt "lazarusidestrconsts.lisleft"
|
||
msgid "Left"
|
||
msgstr "Gauche"
|
||
|
||
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr "L'espace de bordure gauche. Cette valeur est ajoutée à la base de l'espace de bordure et employée pour l'espace à gauche du contrôle."
|
||
|
||
#: lazarusidestrconsts.lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr "Ancrage à gauche"
|
||
|
||
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
||
msgstr "C'est le contrôle à laquelle le côté gauche est ancré. Laisser vide pour le parent."
|
||
|
||
#: lazarusidestrconsts.lisleftsides
|
||
msgid "Left sides"
|
||
msgstr "Côtés gauches"
|
||
|
||
#: lazarusidestrconsts.lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr "Espacement gauche égal"
|
||
|
||
#: lazarusidestrconsts.lislevels
|
||
msgid "Levels"
|
||
msgstr "Niveaux"
|
||
|
||
#: lazarusidestrconsts.lislfmfile
|
||
msgid "LFM file"
|
||
msgstr "Fichier LFM"
|
||
|
||
#: lazarusidestrconsts.lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr "Fichier LFM corrompu"
|
||
|
||
#: lazarusidestrconsts.lislfmisok
|
||
msgid "LFM is ok"
|
||
msgstr "LFM est ok"
|
||
|
||
#: lazarusidestrconsts.lislgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
|
||
#| msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
||
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
|
||
msgstr "Bibliothèque%sune bibliothèque freepascal (.dll sous windows, .so sous linux, .dylib sous macosx). Le fichier source de la bibliothèque est automatiquement maintenu par Lazarus."
|
||
|
||
#: lazarusidestrconsts.lislibrarypath
|
||
msgid "library path"
|
||
msgstr "Chemin des librairies"
|
||
|
||
#: lazarusidestrconsts.lisline
|
||
msgid "Line:"
|
||
msgstr "Ligne :"
|
||
|
||
#: lazarusidestrconsts.lislinelength
|
||
msgid "Line/Length"
|
||
msgstr "Ligne/longueur"
|
||
|
||
#: lazarusidestrconsts.lislink
|
||
msgid "Link:"
|
||
msgstr "Lien :"
|
||
|
||
#: lazarusidestrconsts.lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr "options de l'éditeur de liens"
|
||
|
||
#: lazarusidestrconsts.lislinktarget
|
||
msgid "Link target"
|
||
msgstr "Lier la cible"
|
||
|
||
#: lazarusidestrconsts.lislistofallcasevalues
|
||
msgid "list of all case values"
|
||
msgstr " liste de toutes les valeurs de cas"
|
||
|
||
#: lazarusidestrconsts.lisloadedsuccessfully
|
||
msgid "Loaded successfully"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisloadingfailed
|
||
msgid "Loading %s failed."
|
||
msgstr "Le chargement de%s a échoué."
|
||
|
||
#: lazarusidestrconsts.lislocals
|
||
msgid "Locals"
|
||
msgstr "Locales"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgcopyname
|
||
msgid "&Copy Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgcopyvalue
|
||
msgid "C&opy Value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgname
|
||
msgctxt "lazarusidestrconsts.lislocalsdlgname"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgvalue
|
||
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: lazarusidestrconsts.lislocalsnotevaluated
|
||
msgid "Locals not evaluated"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislogcallstack
|
||
msgid "Log Call Stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislogcallstacklimit
|
||
msgid "(frames limit. 0 - no limits)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislogevalexpression
|
||
msgctxt "lazarusidestrconsts.lislogevalexpression"
|
||
msgid "Eval expression"
|
||
msgstr "Evaluer l' expression"
|
||
|
||
#: lazarusidestrconsts.lislogmessage
|
||
#, fuzzy
|
||
#| msgid "Log message"
|
||
msgid "Log Message"
|
||
msgstr "Journal des messages"
|
||
|
||
#: lazarusidestrconsts.lislogo
|
||
msgid "Logo"
|
||
msgstr "Logo"
|
||
|
||
#: lazarusidestrconsts.lislowercasestring
|
||
msgid "lowercase string"
|
||
msgstr "chaîne en minuscules"
|
||
|
||
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
||
msgid "Lowercase string given as parameter"
|
||
msgstr "chaîne de caractère en minuscules donnée en paramètre"
|
||
|
||
#: lazarusidestrconsts.lislrsincludefiles
|
||
msgid "lrs include files"
|
||
msgstr "montre le point d'exécution"
|
||
|
||
#: lazarusidestrconsts.lismacpascal
|
||
msgid "Mac Pascal"
|
||
msgstr "Mac Pascal"
|
||
|
||
#: lazarusidestrconsts.lismacro
|
||
msgid "Macro %s"
|
||
msgstr "Macro %s"
|
||
|
||
#: lazarusidestrconsts.lismacroname
|
||
msgid "Macro name"
|
||
msgstr "Nom de macro"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr "Entrez les données"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr "Entrez les paramètres d'exécution"
|
||
|
||
#: lazarusidestrconsts.lismacrovalue
|
||
msgid "Macro value"
|
||
msgstr "Valeur de macro"
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
||
#, fuzzy
|
||
#| msgid "Main Unit has Application.CreateForm statements"
|
||
msgid "Main unit has Application.CreateForm statements"
|
||
msgstr "L'unité principale a des instructions Application.CreateForm"
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
|
||
#, fuzzy
|
||
#| msgid "Main Unit has Application.Title statements"
|
||
msgid "Main unit has Application.Title statements"
|
||
msgstr "L'unité principale a des instructions Application.Title"
|
||
|
||
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
||
#, fuzzy
|
||
#| msgid "Main Unit has Uses Section containing all Units of project"
|
||
msgid "Main unit has Uses section containing all units of project"
|
||
msgstr "L'unité principale a une section Uses contenant toutes les unités du projet"
|
||
|
||
#: lazarusidestrconsts.lismainunitispascalsource
|
||
#, fuzzy
|
||
#| msgid "Main Unit is Pascal Source"
|
||
msgid "Main unit is Pascal source"
|
||
msgstr "L'unité principale est un source Pascal"
|
||
|
||
#: lazarusidestrconsts.lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr "Créer un exécutable"
|
||
|
||
#: lazarusidestrconsts.lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr "'Make' introuvable"
|
||
|
||
#: lazarusidestrconsts.lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr "Construire une chaîne ressource"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "Ajouter à la section"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
||
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr "La chaîne ressource %s%s%s existe déjà %sVeuillez choisir un autre nom.%sUtilisez Ignorer pour l'ajouter quand même."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr "Options de conversion"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr "Identificateur personnalisé"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
||
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Identificateur"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr "Longueur d'identificateur :"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr "Préfixe de l'identificateur :"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr "Insérer par ordre alphabétique"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr "Insérer en tenant compte du contexte"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr "Section ResourceString non valide"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr "S’il vous plaît choisisser une section Resourcestring de la liste."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr "Resourcestring existe déjà"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr "Section Resourcestring :"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr "Prévisualisation du code source"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr "Constante chaîne dans le source"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr "Chaînes avec la même valeur:"
|
||
|
||
#: lazarusidestrconsts.lismaxs
|
||
msgid "Max %d"
|
||
msgstr "Max %d"
|
||
|
||
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
||
msgid "%s Maybe you have to recompile the package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismeaction
|
||
msgctxt "lazarusidestrconsts.lismeaction"
|
||
msgid "Action"
|
||
msgstr "Action"
|
||
|
||
#: lazarusidestrconsts.lismemorydump
|
||
msgid "Memory Dump"
|
||
msgstr "Vidage Mémoire"
|
||
|
||
#: lazarusidestrconsts.lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "Arrêter la création"
|
||
|
||
#: lazarusidestrconsts.lismenuaboutfpc
|
||
msgid "About FPC"
|
||
msgstr "A propos de FPC"
|
||
|
||
#: lazarusidestrconsts.lismenuaddbreakpoint
|
||
#, fuzzy
|
||
#| msgid "Add breakpoint"
|
||
msgid "Add &Breakpoint"
|
||
msgstr "Ajouter un point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
||
msgid "Add Active File to Package ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
||
#, fuzzy
|
||
#| msgid "Add jump point to history"
|
||
msgid "Add Jump Point to History"
|
||
msgstr "Ajouter un point de saut à l'historique"
|
||
|
||
#: lazarusidestrconsts.lismenuaddtoproject
|
||
#, fuzzy
|
||
#| msgid "Add editor file to Project"
|
||
msgid "Add Editor File to Project"
|
||
msgstr "Ajouter le fichier de l'éditeur au projet"
|
||
|
||
#: lazarusidestrconsts.lismenuaddwatch
|
||
#, fuzzy
|
||
#| msgid "Add watch ..."
|
||
msgid "Add &Watch ..."
|
||
msgstr "Ajouter un suivi ..."
|
||
|
||
#: lazarusidestrconsts.lismenubeaklinesinselection
|
||
#, fuzzy
|
||
#| msgid "Break Lines in selection"
|
||
msgid "Break Lines in Selection"
|
||
msgstr "Couper les lignes dans la sélection"
|
||
|
||
#: lazarusidestrconsts.lismenubuild
|
||
msgctxt "lazarusidestrconsts.lismenubuild"
|
||
msgid "Build"
|
||
msgstr "Créer"
|
||
|
||
#: lazarusidestrconsts.lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "Créer le fichier"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarus
|
||
#, fuzzy
|
||
#| msgid "Build Lazarus with current profile"
|
||
msgid "Build Lazarus with Current Profile"
|
||
msgstr "Créer Lazarus avec le profil en cours"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarusprof
|
||
#, fuzzy
|
||
#| msgid "Build Lazarus with profile: %s"
|
||
msgid "Build Lazarus with Profile: %s"
|
||
msgstr "Créer Lazarus avec le profil: %s"
|
||
|
||
#: lazarusidestrconsts.lismenuchecklfm
|
||
#, fuzzy
|
||
#| msgid "Check LFM file in editor"
|
||
msgid "Check LFM File in Editor"
|
||
msgstr "Vérifier le fichier LFM dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts.lismenucleandirectory
|
||
#, fuzzy
|
||
#| msgid "Clean directory ..."
|
||
msgid "Clean Directory ..."
|
||
msgstr "Nettoyer un répertoire ..."
|
||
|
||
#: lazarusidestrconsts.lismenucleanupcompiled
|
||
msgid "Clean up Build Files ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuclose
|
||
msgctxt "lazarusidestrconsts.lismenuclose"
|
||
msgid "Close"
|
||
msgstr "Fermer"
|
||
|
||
#: lazarusidestrconsts.lismenucloseall
|
||
msgid "Close A&ll Editor Files"
|
||
msgstr "Fermer tous les fichiers de l'éditeur"
|
||
|
||
#: lazarusidestrconsts.lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "Fermer le projet"
|
||
|
||
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
||
#, fuzzy
|
||
#| msgid "CodeTools defines editor ..."
|
||
msgid "CodeTools Defines Editor ..."
|
||
msgstr "Editeur des directives des outils de code ..."
|
||
|
||
#: lazarusidestrconsts.lismenucollectpofil
|
||
msgid "Collect .po files"
|
||
msgstr "Collecter les fichiers .po"
|
||
|
||
#: lazarusidestrconsts.lismenucommentselection
|
||
#, fuzzy
|
||
#| msgid "Comment selection"
|
||
msgid "Comment Selection"
|
||
msgstr "Commenter la sélection"
|
||
|
||
#: lazarusidestrconsts.lismenucompile
|
||
msgctxt "lazarusidestrconsts.lismenucompile"
|
||
msgid "Compile"
|
||
msgstr "Compiler"
|
||
|
||
#: lazarusidestrconsts.lismenucompileroptions
|
||
msgid "Compiler Options ..."
|
||
msgstr "Options du compilateur ..."
|
||
|
||
#: lazarusidestrconsts.lismenucompletecode
|
||
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Compléter le code"
|
||
|
||
#: lazarusidestrconsts.lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr "Configurer Créer+Exécuter le fichier ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
||
#, fuzzy
|
||
#| msgid "Configure custom components ..."
|
||
msgid "Configure Custom Components ..."
|
||
msgstr "Configurer les composants personnalisés ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigexternaltools
|
||
#, fuzzy
|
||
#| msgid "Configure external tools ..."
|
||
msgid "Configure External Tools ..."
|
||
msgstr "Configurer des outils externes..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr "Configurer \"Création de Lazarus\" ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurehelp
|
||
msgid "Configure Help ..."
|
||
msgstr "Configurer l'aide ..."
|
||
|
||
#: lazarusidestrconsts.lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr "Aide contextuelle"
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi package to Lazarus package ..."
|
||
msgid "Convert Delphi Package to Lazarus Package ..."
|
||
msgstr "Convertir un paquet Delphi en paquet Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi project to Lazarus project ..."
|
||
msgid "Convert Delphi Project to Lazarus Project ..."
|
||
msgstr "Convertir un projet Delphi en projet Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
||
#, fuzzy
|
||
#| msgid "Convert Delphi unit to Lazarus unit ..."
|
||
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
||
msgstr "Convertir une unité Delphi en unité Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
||
#, fuzzy
|
||
#| msgid "Convert binary DFM to text LFM + check syntax ..."
|
||
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
||
msgstr "Convertir un fichier binaire DFM en un fichier texte LFM et vérification de syntaxe ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertencoding
|
||
#, fuzzy
|
||
#| msgid "Convert encoding of projects/packages ..."
|
||
msgid "Convert Encoding of Projects/Packages ..."
|
||
msgstr "Convertir le codage de projets/paquets..."
|
||
|
||
#: lazarusidestrconsts.lismenucopy
|
||
msgctxt "lazarusidestrconsts.lismenucopy"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: lazarusidestrconsts.lismenucreatefpdocfiles
|
||
msgid "Create FPDoc files"
|
||
msgstr "Créer un fichier FPDoc"
|
||
|
||
#: lazarusidestrconsts.lismenucreatepofile
|
||
msgid "Create .po files"
|
||
msgstr "Créer les fichiers .po"
|
||
|
||
#: lazarusidestrconsts.lismenucut
|
||
msgctxt "lazarusidestrconsts.lismenucut"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: lazarusidestrconsts.lismenudebugwindows
|
||
#, fuzzy
|
||
#| msgid "Debug windows"
|
||
msgid "Debug Windows"
|
||
msgstr "Fenêtres de débogage"
|
||
|
||
#: lazarusidestrconsts.lismenudiff
|
||
#| msgid "Diff"
|
||
msgctxt "lazarusidestrconsts.lismenudiff"
|
||
msgid "Diff ..."
|
||
msgstr "Diff ..."
|
||
|
||
#: lazarusidestrconsts.lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "&Editer"
|
||
|
||
#: lazarusidestrconsts.lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr "Modèles de code ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr "Éditer l'aide contextuelle"
|
||
|
||
#: lazarusidestrconsts.lismenueditinstallpkgs
|
||
#, fuzzy
|
||
#| msgid "Install/Uninstall packages ..."
|
||
msgid "Install/Uninstall Packages ..."
|
||
msgstr "Installer/Désinstaller des paquets ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditor
|
||
#, fuzzy
|
||
#| msgid "Menu Editor..."
|
||
msgid "Menu Editor ..."
|
||
msgstr "Editeur de menu..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorcancel
|
||
msgctxt "lazarusidestrconsts.lismenueditorcancel"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: lazarusidestrconsts.lismenueditorcreatesubmenu
|
||
msgid "Create Submenu"
|
||
msgstr "Créer un sous-menu"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletefromtemplate
|
||
#, fuzzy
|
||
#| msgid "Delete From Template..."
|
||
msgid "Delete From Template ..."
|
||
msgstr "Supprimer du modèle ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditordeleteitem
|
||
msgid "Delete Item"
|
||
msgstr "Supprimer l'élément"
|
||
|
||
#: lazarusidestrconsts.lismenueditorhandleonclickevent
|
||
msgid "Handle OnClick Event"
|
||
msgstr "Gérer l'événement OnClick"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
|
||
#, fuzzy
|
||
#| msgid "Insert From Template..."
|
||
msgid "Insert From Template ..."
|
||
msgstr "Insérer depuis le modèle ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
|
||
msgid "Insert New Item (after)"
|
||
msgstr "Insérer un nouvel élément (après)"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
|
||
msgid "Insert New Item (before)"
|
||
msgstr "Insérer un nouvel élément (avant)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr "Editeur de menu"
|
||
|
||
#: lazarusidestrconsts.lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr "Déplacer vers le bas (ou à droite)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr "Déplacer vers le haut (ou gauche)"
|
||
|
||
#: lazarusidestrconsts.lismenueditornewtemplatedescription
|
||
#, fuzzy
|
||
#| msgid "New Template Description..."
|
||
msgid "New Template Description ..."
|
||
msgstr "Nouvelle description de modèle..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorsaveastemplate
|
||
#, fuzzy
|
||
#| msgid "Save As Template..."
|
||
msgid "Save As Template ..."
|
||
msgstr "Enregister comme modèle..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorselectmenu
|
||
msgid "Select Menu:"
|
||
msgstr "Menu sélectionner:"
|
||
|
||
#: lazarusidestrconsts.lismenueditorselecttemplate
|
||
msgid "Select Template:"
|
||
msgstr "Choisir le modèle:"
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplatepreview
|
||
msgid "Template Preview"
|
||
msgstr "Prévisualisation d'un modèle"
|
||
|
||
#: lazarusidestrconsts.lismenuencloseinifdef
|
||
msgid "Enclose in $IFDEF ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuencloseselection
|
||
#, fuzzy
|
||
#| msgid "Enclose selection ..."
|
||
msgid "Enclose Selection ..."
|
||
msgstr "Entourer la sélection ..."
|
||
|
||
#: lazarusidestrconsts.lismenuevaluate
|
||
#, fuzzy
|
||
#| msgid "Evaluate/Modify ..."
|
||
msgid "E&valuate/Modify ..."
|
||
msgstr "Evaluer/Modifier ..."
|
||
|
||
#: lazarusidestrconsts.lismenuexampleprojects
|
||
msgid "Example Projects ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuextractproc
|
||
#, fuzzy
|
||
#| msgid "Extract procedure ..."
|
||
msgid "Extract Procedure ..."
|
||
msgstr "Extraire procédure ..."
|
||
|
||
#: lazarusidestrconsts.lismenufile
|
||
msgid "&File"
|
||
msgstr "&Fichier"
|
||
|
||
#: lazarusidestrconsts.lismenufind
|
||
msgctxt "lazarusidestrconsts.lismenufind"
|
||
msgid "Find"
|
||
msgstr "Chercher"
|
||
|
||
#: lazarusidestrconsts.lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr "&Chercher"
|
||
|
||
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
||
#, fuzzy
|
||
#| msgid "Find other end of code block"
|
||
msgid "Find Other End of Code Block"
|
||
msgstr "Chercher l'autre extrémité du bloc de code"
|
||
|
||
#: lazarusidestrconsts.lismenufindcodeblockstart
|
||
#, fuzzy
|
||
#| msgid "Find code block start"
|
||
msgid "Find Start of Code Block"
|
||
msgstr "Chercher le début du bloc de code"
|
||
|
||
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
||
#, fuzzy
|
||
#| msgid "Find Declaration at cursor"
|
||
msgid "Find Declaration at Cursor"
|
||
msgstr "Rechercher la déclaration sous le curseur"
|
||
|
||
#: lazarusidestrconsts.lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr "Trouver les références de l'identificateur ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindinfiles
|
||
#, fuzzy
|
||
#| msgid "Find &in files ..."
|
||
msgid "Find &in Files ..."
|
||
msgstr "Chercher dans les &fichiers ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "Chercher l'occurrence &suivante"
|
||
|
||
#: lazarusidestrconsts.lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "Chercher l'occurrence &précédente"
|
||
|
||
#: lazarusidestrconsts.lismenugeneraloptions
|
||
msgid "Options ..."
|
||
msgstr "Options..."
|
||
|
||
#: lazarusidestrconsts.lismenugotoincludedirective
|
||
#, fuzzy
|
||
#| msgid "Goto include directive"
|
||
msgid "Goto Include Directive"
|
||
msgstr "Aller à la directive \"Include\""
|
||
|
||
#: lazarusidestrconsts.lismenugotoline
|
||
#, fuzzy
|
||
#| msgid "Goto line ..."
|
||
msgid "Goto Line ..."
|
||
msgstr "Aller à la ligne ..."
|
||
|
||
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
||
#, fuzzy
|
||
#| msgid "Guess misplaced IFDEF/ENDIF"
|
||
msgid "Guess Misplaced IFDEF/ENDIF"
|
||
msgstr "Deviner les IFDEF/ENDIF mal placés"
|
||
|
||
#: lazarusidestrconsts.lismenuguessunclosedblock
|
||
#, fuzzy
|
||
#| msgid "Guess unclosed block"
|
||
msgid "Guess Unclosed Block"
|
||
msgstr "Deviner les blocs non terminés"
|
||
|
||
#: lazarusidestrconsts.lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "&Aide"
|
||
|
||
#: lazarusidestrconsts.lismenuideinternals
|
||
#, fuzzy
|
||
#| msgid "IDE internals"
|
||
msgid "IDE Internals"
|
||
msgstr "dessous de l'EDI"
|
||
|
||
#: lazarusidestrconsts.lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr "Recherche incrémentale"
|
||
|
||
#: lazarusidestrconsts.lismenuindentselection
|
||
#, fuzzy
|
||
#| msgid "Indent selection"
|
||
msgid "Indent Selection"
|
||
msgstr "Indenter la sélection"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
||
#, fuzzy
|
||
#| msgid "ChangeLog entry"
|
||
msgid "ChangeLog Entry"
|
||
msgstr "Entrée ChangeLog"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcharacter
|
||
#, fuzzy
|
||
#| msgid "Insert from Character Map"
|
||
msgid "Insert from Character Map ..."
|
||
msgstr "Insérer depuis la table des caractères"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
||
#, fuzzy
|
||
#| msgid "Insert CVS keyword"
|
||
msgid "Insert CVS Keyword"
|
||
msgstr "Mot-clé CVS"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertdatetime
|
||
#, fuzzy
|
||
#| msgid "Current date and time"
|
||
msgid "Current Date and Time"
|
||
msgstr "Date et heure courantes"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertfilename
|
||
msgid "Insert full Filename ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgeneral
|
||
#, fuzzy
|
||
#| msgid "General"
|
||
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
||
msgid "Insert General"
|
||
msgstr "Général"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgplnotice
|
||
#, fuzzy
|
||
#| msgid "GPL notice"
|
||
msgid "GPL Notice"
|
||
msgstr "Notice GPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
||
#, fuzzy
|
||
#| msgid "LGPL notice"
|
||
msgid "LGPL Notice"
|
||
msgstr "Notice LGPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
||
#, fuzzy
|
||
#| msgid "Modified LGPL notice"
|
||
msgid "Modified LGPL Notice"
|
||
msgstr "Notice modifié LGPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertusername
|
||
#, fuzzy
|
||
#| msgid "Current username"
|
||
msgid "Current Username"
|
||
msgstr "Utilisateur courant"
|
||
|
||
#: lazarusidestrconsts.lismenuinspect
|
||
#, fuzzy
|
||
#| msgid "Inspect ..."
|
||
msgctxt "lazarusidestrconsts.lismenuinspect"
|
||
msgid "&Inspect ..."
|
||
msgstr "Inspecter..."
|
||
|
||
#: lazarusidestrconsts.lismenujumpback
|
||
#, fuzzy
|
||
#| msgid "Jump back"
|
||
msgid "Jump Back"
|
||
msgstr "En arrière"
|
||
|
||
#: lazarusidestrconsts.lismenujumpforward
|
||
#, fuzzy
|
||
#| msgid "Jump forward"
|
||
msgid "Jump Forward"
|
||
msgstr "En avant"
|
||
|
||
#: lazarusidestrconsts.lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr "Aller à"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoimplementation
|
||
msgid "Jump to Implementation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenujumptonextbookmark
|
||
#, fuzzy
|
||
#| msgid "Jump to next bookmark"
|
||
msgid "Jump to Next Bookmark"
|
||
msgstr "Aller au signet suivant"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonexterror
|
||
#, fuzzy
|
||
#| msgid "Jump to next error"
|
||
msgid "Jump to Next Error"
|
||
msgstr "Erreur suivante"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
||
#, fuzzy
|
||
#| msgid "Jump to previous bookmark"
|
||
msgid "Jump to Previous Bookmark"
|
||
msgstr "Aller au signet précédent"
|
||
|
||
#: lazarusidestrconsts.lismenujumptopreverror
|
||
#, fuzzy
|
||
#| msgid "Jump to previous error"
|
||
msgid "Jump to Previous Error"
|
||
msgstr "Erreur précédente"
|
||
|
||
#: lazarusidestrconsts.lismenulowercaseselection
|
||
#, fuzzy
|
||
#| msgid "Lowercase selection"
|
||
msgid "Lowercase Selection"
|
||
msgstr "Mettre la sélection en minuscules"
|
||
|
||
#: lazarusidestrconsts.lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr "Construire une chaîne ressource ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewform
|
||
msgid "New Form"
|
||
msgstr "Nouvelle fiche"
|
||
|
||
#: lazarusidestrconsts.lismenunewother
|
||
msgid "New ..."
|
||
msgstr "Nouveau..."
|
||
|
||
#: lazarusidestrconsts.lismenunewpackage
|
||
#, fuzzy
|
||
#| msgid "New package ..."
|
||
msgid "New Package ..."
|
||
msgstr "Nouveau paquet ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "Nouveau projet ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewprojectfromfile
|
||
#, fuzzy
|
||
#| msgid "New Project from file ..."
|
||
msgid "New Project from File ..."
|
||
msgstr "Nouveau projet depuis le fichier ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewunit
|
||
msgctxt "lazarusidestrconsts.lismenunewunit"
|
||
msgid "New Unit"
|
||
msgstr "Nouvelle unité"
|
||
|
||
#: lazarusidestrconsts.lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "Aide en ligne"
|
||
|
||
#: lazarusidestrconsts.lismenuopen
|
||
#| msgid "Open ..."
|
||
msgid "&Open ..."
|
||
msgstr "&Ouvrir"
|
||
|
||
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
||
#, fuzzy
|
||
#| msgid "Open filename at cursor"
|
||
msgid "Open Filename at Cursor"
|
||
msgstr "Ouvrir le fichier sous le curseur"
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackage
|
||
#, fuzzy
|
||
#| msgid "Open loaded package ..."
|
||
msgid "Open Loaded Package ..."
|
||
msgstr "Ouvrir le paquet chargé ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackagefile
|
||
#, fuzzy
|
||
#| msgid "Open package file (.lpk) ..."
|
||
msgid "Open Package File (.lpk) ..."
|
||
msgstr "Ouvrir un fichier paquet (.lpk) ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
||
#, fuzzy
|
||
#| msgid "Open package of current unit"
|
||
msgid "Open Package of Current Unit"
|
||
msgstr "Ouvrir le paquet de l'unité courante"
|
||
|
||
#: lazarusidestrconsts.lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "Ouvrir un projet ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecent
|
||
#, fuzzy
|
||
#| msgid "Open &Recent ..."
|
||
msgid "Open &Recent"
|
||
msgstr "&Récemment ouverts"
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentpkg
|
||
#, fuzzy
|
||
#| msgid "Open recent package"
|
||
msgid "Open Recent Package"
|
||
msgstr "Ouvrir un paquet récent"
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentproject
|
||
#| msgid "Open Recent Project ..."
|
||
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
||
msgid "Open Recent Project"
|
||
msgstr "Ouvrir un projet récent"
|
||
|
||
#: lazarusidestrconsts.lismenupackage
|
||
#, fuzzy
|
||
#| msgid "&Package"
|
||
msgid "Pa&ckage"
|
||
msgstr "Pa&quet"
|
||
|
||
#: lazarusidestrconsts.lismenupackagegraph
|
||
#, fuzzy
|
||
#| msgid "Package Graph ..."
|
||
msgid "Package Graph"
|
||
msgstr "Graphe des paquets ..."
|
||
|
||
#: lazarusidestrconsts.lismenupackagelinks
|
||
#, fuzzy
|
||
#| msgid "Package links ..."
|
||
msgid "Package Links ..."
|
||
msgstr "Liens Paquet ..."
|
||
|
||
#: lazarusidestrconsts.lismenupaste
|
||
msgctxt "lazarusidestrconsts.lismenupaste"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: lazarusidestrconsts.lismenupause
|
||
msgctxt "lazarusidestrconsts.lismenupause"
|
||
msgid "Pause"
|
||
msgstr "Pause"
|
||
|
||
#: lazarusidestrconsts.lismenuprocedurelist
|
||
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
||
msgid "Procedure List ..."
|
||
msgstr "Liste de procédure ..."
|
||
|
||
#: lazarusidestrconsts.lismenuproject
|
||
msgid "&Project"
|
||
msgstr "&Projet"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr "Inspecteur de projet"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr "Options du projet ..."
|
||
|
||
#: lazarusidestrconsts.lismenuprojectrun
|
||
#, fuzzy
|
||
#| msgid "Run"
|
||
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
||
msgid "&Run"
|
||
msgstr "Exécuter"
|
||
|
||
#: lazarusidestrconsts.lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr "Publier le projet ..."
|
||
|
||
#: lazarusidestrconsts.lismenuquickcompile
|
||
#, fuzzy
|
||
#| msgid "Quick compile"
|
||
msgid "Quick Compile"
|
||
msgstr "compilation rapide "
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
||
#, fuzzy
|
||
#| msgid "Quick syntax check"
|
||
msgid "Quick Syntax Check"
|
||
msgstr "Vérification rapide de la syntaxe"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
||
msgid "Quick syntax check OK"
|
||
msgstr "vérification rapide de la syntaxe"
|
||
|
||
#: lazarusidestrconsts.lismenuquit
|
||
#| msgid "Quit"
|
||
msgid "&Quit"
|
||
msgstr "&Quitter"
|
||
|
||
#: lazarusidestrconsts.lismenuredo
|
||
msgctxt "lazarusidestrconsts.lismenuredo"
|
||
msgid "Redo"
|
||
msgstr "Refaire"
|
||
|
||
#: lazarusidestrconsts.lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr "Retirer du projet ..."
|
||
|
||
#: lazarusidestrconsts.lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr "Renommer l'identificateur ..."
|
||
|
||
#: lazarusidestrconsts.lismenureplace
|
||
msgctxt "lazarusidestrconsts.lismenureplace"
|
||
msgid "Replace"
|
||
msgstr "Remplacer"
|
||
|
||
#: lazarusidestrconsts.lismenureplace2
|
||
msgid "&Replace ..."
|
||
msgstr "&Remplacer"
|
||
|
||
#: lazarusidestrconsts.lismenureportingbug
|
||
#, fuzzy
|
||
#| msgid "Reporting a bug"
|
||
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
||
msgid "Reporting a Bug"
|
||
msgstr "Signaler un bogue ..."
|
||
|
||
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
||
#, fuzzy
|
||
#| msgid "Rescan FPC source directory"
|
||
msgid "Rescan FPC Source Directory"
|
||
msgstr "Reparcourir le répertoire des sources FPC"
|
||
|
||
#: lazarusidestrconsts.lismenuresetdebugger
|
||
#, fuzzy
|
||
#| msgid "Reset debugger"
|
||
msgid "Reset Debugger"
|
||
msgstr "Réinitialiser le débogueur"
|
||
|
||
#: lazarusidestrconsts.lismenurestart
|
||
msgid "Restart"
|
||
msgstr "Redémarrer"
|
||
|
||
#: lazarusidestrconsts.lismenurevert
|
||
msgid "Revert"
|
||
msgstr "Restaurer"
|
||
|
||
#: lazarusidestrconsts.lismenurun
|
||
msgctxt "lazarusidestrconsts.lismenurun"
|
||
msgid "&Run"
|
||
msgstr "E&xécuter"
|
||
|
||
#: lazarusidestrconsts.lismenurunfile
|
||
msgid "Run File"
|
||
msgstr "Exécuter le fichier"
|
||
|
||
#: lazarusidestrconsts.lismenurunparameters
|
||
#, fuzzy
|
||
#| msgid "Run Parameters ..."
|
||
msgid "Run &Parameters ..."
|
||
msgstr "Paramètres d'exécution..."
|
||
|
||
#: lazarusidestrconsts.lismenuruntocursor
|
||
#, fuzzy
|
||
#| msgid "Run to &cursor"
|
||
msgid "Run to &Cursor"
|
||
msgstr "Exécuter jusqu'au curseur"
|
||
|
||
#: lazarusidestrconsts.lismenusave
|
||
#| msgid "Save"
|
||
msgctxt "lazarusidestrconsts.lismenusave"
|
||
msgid "&Save"
|
||
msgstr "&Enregistrer"
|
||
|
||
#: lazarusidestrconsts.lismenusaveall
|
||
msgid "Save All"
|
||
msgstr "Tout enregistrer"
|
||
|
||
#: lazarusidestrconsts.lismenusaveas
|
||
#| msgid "Save As ..."
|
||
msgid "Save &As ..."
|
||
msgstr "Enregistrer &sous..."
|
||
|
||
#: lazarusidestrconsts.lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "Enregistrer le projet"
|
||
|
||
#: lazarusidestrconsts.lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "Enregistrer le projet sous ..."
|
||
|
||
#: lazarusidestrconsts.lismenusearch
|
||
msgid "&Search"
|
||
msgstr "&Chercher"
|
||
|
||
#: lazarusidestrconsts.lismenuselect
|
||
msgid "Select"
|
||
msgstr "Sélectionner"
|
||
|
||
#: lazarusidestrconsts.lismenuselectall
|
||
#, fuzzy
|
||
#| msgid "Select all"
|
||
msgctxt "lazarusidestrconsts.lismenuselectall"
|
||
msgid "Select All"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: lazarusidestrconsts.lismenuselectcodeblock
|
||
#, fuzzy
|
||
#| msgid "Select code block"
|
||
msgid "Select Code Block"
|
||
msgstr "Sélectionner le bloc de code"
|
||
|
||
#: lazarusidestrconsts.lismenuselectline
|
||
#, fuzzy
|
||
#| msgid "Select line"
|
||
msgid "Select Line"
|
||
msgstr "Sélectionner la ligne"
|
||
|
||
#: lazarusidestrconsts.lismenuselectparagraph
|
||
#, fuzzy
|
||
#| msgid "Select paragraph"
|
||
msgid "Select Paragraph"
|
||
msgstr "Sélectionner paragraphe"
|
||
|
||
#: lazarusidestrconsts.lismenuselecttobrace
|
||
#, fuzzy
|
||
#| msgid "Select to brace"
|
||
msgid "Select to Brace"
|
||
msgstr "Ancrer la sélection"
|
||
|
||
#: lazarusidestrconsts.lismenuselectword
|
||
#, fuzzy
|
||
#| msgid "Select word"
|
||
msgid "Select Word"
|
||
msgstr "Sélectionner un mot"
|
||
|
||
#: lazarusidestrconsts.lismenusetfreebookmark
|
||
#, fuzzy
|
||
#| msgid "Set a free bookmark"
|
||
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
||
msgid "Set a Free Bookmark"
|
||
msgstr "Mettre un signet libre"
|
||
|
||
#: lazarusidestrconsts.lismenushowexecutionpoint
|
||
#, fuzzy
|
||
#| msgid "S&how execution point"
|
||
msgid "S&how Execution Point"
|
||
msgstr "montre le point d'exécution"
|
||
|
||
#: lazarusidestrconsts.lismenusortselection
|
||
#, fuzzy
|
||
#| msgid "Sort selection ..."
|
||
msgid "Sort Selection ..."
|
||
msgstr "Trier la sélection ..."
|
||
|
||
#: lazarusidestrconsts.lismenusource
|
||
msgid "S&ource"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenustepinto
|
||
#, fuzzy
|
||
#| msgid "Step in&to"
|
||
msgid "Step In&to"
|
||
msgstr "Pas à pas approfondi"
|
||
|
||
#: lazarusidestrconsts.lismenustepintocontext
|
||
msgid "Step Into (Context)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenustepintoinstr
|
||
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
|
||
msgid "Step Into Instruction"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenustepintoinstrhint
|
||
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
|
||
msgid "Step Into Instruction"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenustepout
|
||
#, fuzzy
|
||
#| msgid "Step o&ut"
|
||
msgid "Step O&ut"
|
||
msgstr "Pas à pas approfondi"
|
||
|
||
#: lazarusidestrconsts.lismenustepover
|
||
#, fuzzy
|
||
#| msgid "&Step over"
|
||
msgid "&Step Over"
|
||
msgstr "Pas à pas"
|
||
|
||
#: lazarusidestrconsts.lismenustepovercontext
|
||
msgid "Step Over (Context)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenustepoverinstr
|
||
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
|
||
msgid "Step Over Instruction"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenustepoverinstrhint
|
||
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
|
||
msgid "Step Over Instruction"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenustop
|
||
msgctxt "lazarusidestrconsts.lismenustop"
|
||
msgid "Stop"
|
||
msgstr "Arrêter"
|
||
|
||
#: lazarusidestrconsts.lismenuswapcaseselection
|
||
msgid "Swap Case in Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenutabstospacesselection
|
||
#, fuzzy
|
||
#| msgid "Tabs to spaces in selection"
|
||
msgid "Tabs to Spaces in Selection"
|
||
msgstr "Remplacer les tabulations par des espaces dans la sélection"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateabout
|
||
msgid "About"
|
||
msgstr "A propos"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateclose
|
||
msgctxt "lazarusidestrconsts.lismenutemplateclose"
|
||
msgid "Close"
|
||
msgstr "Fermer"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr "Contenu"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecopy
|
||
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecut
|
||
msgctxt "lazarusidestrconsts.lismenutemplatecut"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr "Menu Edition standard"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr "Menu Fichier standard"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr "Menu Aide standard"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateedit
|
||
msgctxt "lazarusidestrconsts.lismenutemplateedit"
|
||
msgid "Edit"
|
||
msgstr "Editer"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateexit
|
||
msgctxt "lazarusidestrconsts.lismenutemplateexit"
|
||
msgid "Exit"
|
||
msgstr "Quitter"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefile
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefile"
|
||
msgid "File"
|
||
msgstr "Fichier"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefind
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
||
msgid "Find"
|
||
msgstr "Chercher"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefindnext
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
|
||
msgid "Find Next"
|
||
msgstr "Trouver l'occurence suivante"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatehelp
|
||
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
|
||
msgid "Help"
|
||
msgstr "Aide"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatenew
|
||
msgid "New"
|
||
msgstr "Nouveau"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateopen
|
||
msgctxt "lazarusidestrconsts.lismenutemplateopen"
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateopenrecent
|
||
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
||
msgid "Open Recent"
|
||
msgstr "Réouvrir"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatepaste
|
||
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateredo
|
||
msgctxt "lazarusidestrconsts.lismenutemplateredo"
|
||
msgid "Redo"
|
||
msgstr "Refaire"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatesave
|
||
msgctxt "lazarusidestrconsts.lismenutemplatesave"
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatesaveas
|
||
msgid "Save As"
|
||
msgstr "Enregistrer sous"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr "Tutorial"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateundo
|
||
msgctxt "lazarusidestrconsts.lismenutemplateundo"
|
||
msgid "Undo"
|
||
msgstr "Défaire"
|
||
|
||
#: lazarusidestrconsts.lismenutogglecomment
|
||
#, fuzzy
|
||
#| msgid "Toggle comment"
|
||
msgid "Toggle Comment in Selection"
|
||
msgstr "Commuter vers les commentaires"
|
||
|
||
#: lazarusidestrconsts.lismenutools
|
||
msgid "&Tools"
|
||
msgstr "&Outils"
|
||
|
||
#: lazarusidestrconsts.lismenuuncommentselection
|
||
#, fuzzy
|
||
#| msgid "Uncomment selection"
|
||
msgid "Uncomment Selection"
|
||
msgstr "Décommenter la sélection"
|
||
|
||
#: lazarusidestrconsts.lismenuundo
|
||
msgctxt "lazarusidestrconsts.lismenuundo"
|
||
msgid "Undo"
|
||
msgstr "Défaire"
|
||
|
||
#: lazarusidestrconsts.lismenuunindentselection
|
||
#, fuzzy
|
||
#| msgid "Unindent selection"
|
||
msgid "Unindent Selection"
|
||
msgstr "Désindenter la sélection"
|
||
|
||
#: lazarusidestrconsts.lismenuuppercaseselection
|
||
#, fuzzy
|
||
#| msgid "Uppercase selection"
|
||
msgid "Uppercase Selection"
|
||
msgstr "Mettre la sélection en majuscules"
|
||
|
||
#: lazarusidestrconsts.lismenuuseunit
|
||
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
||
msgid "Add Unit to Uses Section ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuview
|
||
msgid "&View"
|
||
msgstr "&Voir"
|
||
|
||
#: lazarusidestrconsts.lismenuviewanchoreditor
|
||
#| msgid "View Anchor Editor"
|
||
msgid "Anchor Editor"
|
||
msgstr "Editeur d'ancres"
|
||
|
||
#: lazarusidestrconsts.lismenuviewassembler
|
||
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
||
msgid "Assembler"
|
||
msgstr "Assembleur"
|
||
|
||
#: lazarusidestrconsts.lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "Points d'arrêts"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr "Pile d'appels"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodebrowser
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
||
msgid "Code Browser"
|
||
msgstr "Navigateur de code"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Explorateur de code"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
||
#| msgid "View Component Palette"
|
||
msgid "Component Palette"
|
||
msgstr "Palette de composants"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "&Composants"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugevents
|
||
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
||
msgid "Event Log"
|
||
msgstr "Journal des événements"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugoutput
|
||
#, fuzzy
|
||
#| msgid "Debug output"
|
||
msgid "Debug Output"
|
||
msgstr "Sortie de débogueur"
|
||
|
||
#: lazarusidestrconsts.lismenuviewforms
|
||
#, fuzzy
|
||
#| msgid "Forms..."
|
||
msgid "Forms ..."
|
||
msgstr "Fiches ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewhistory
|
||
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
||
msgid "History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewidespeedbuttons
|
||
#, fuzzy
|
||
#| msgid "IDE speed buttons"
|
||
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
|
||
msgid "IDE Speed Buttons"
|
||
msgstr "Afficher les boutons rapides de l'EDI"
|
||
|
||
#: lazarusidestrconsts.lismenuviewjumphistory
|
||
#, fuzzy
|
||
#| msgid "Jump History ..."
|
||
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
||
msgid "Jump History"
|
||
msgstr "Historique des déplacements ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr "Variables locales"
|
||
|
||
#: lazarusidestrconsts.lismenuviewmessages
|
||
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
||
msgid "Messages"
|
||
msgstr "Messages"
|
||
|
||
#: lazarusidestrconsts.lismenuviewobjectinspector
|
||
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
||
msgid "Object Inspector"
|
||
msgstr "Inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts.lismenuviewprojectsource
|
||
msgid "&View Project Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
||
msgid "Terminal Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewregisters
|
||
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
||
msgid "Registers"
|
||
msgstr "Registres"
|
||
|
||
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr "Explorateur de restrictions"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr "Résultats de la recherche"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsourceeditor
|
||
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
||
msgid "Source Editor"
|
||
msgstr "Editeur de source"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtaborder
|
||
msgid "Tab Order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewthreads
|
||
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
||
msgid "Threads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewtodolist
|
||
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
|
||
msgid "ToDo List"
|
||
msgstr "Liste ToDo"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
||
#, fuzzy
|
||
#| msgid "Toggle form/unit view"
|
||
msgid "Toggle Form/Unit View"
|
||
msgstr "Commutation Fiche/Unité"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitdependencies
|
||
#| msgid "View Unit Dependencies"
|
||
msgid "Unit Dependencies"
|
||
msgstr "Dépendances de l'unité"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitinfo
|
||
#, fuzzy
|
||
#| msgid "Unit Information"
|
||
msgid "Unit Information ..."
|
||
msgstr "Informations sur l'unité"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunits
|
||
#, fuzzy
|
||
#| msgid "Units..."
|
||
msgid "Units ..."
|
||
msgstr "Unités ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr "Points de suivi"
|
||
|
||
#: lazarusidestrconsts.lismenuwindow
|
||
msgid "&Window"
|
||
msgstr "Fe&nêtre "
|
||
|
||
#: lazarusidestrconsts.lismeother
|
||
msgctxt "lazarusidestrconsts.lismeother"
|
||
msgid "Other"
|
||
msgstr "Autre"
|
||
|
||
#: lazarusidestrconsts.lismeprojects
|
||
msgid "Projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
|
||
msgid "Message contains no file position information:%s%s"
|
||
msgstr "Le message ne contient pas d'information sur la position du fichier:%s%s"
|
||
|
||
#: lazarusidestrconsts.lismessageseditor
|
||
msgid "Messages Editor"
|
||
msgstr "Editeur de Messages"
|
||
|
||
#: lazarusidestrconsts.lismethodclassnotfound
|
||
msgid "Method class not found"
|
||
msgstr "Classe de la méthode introuvable"
|
||
|
||
#: lazarusidestrconsts.lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr "Evènement manquants"
|
||
|
||
#: lazarusidestrconsts.lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr "Identificateurs manquant"
|
||
|
||
#: lazarusidestrconsts.lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr "Paquets manquants"
|
||
|
||
#: lazarusidestrconsts.lismissingunitschoices
|
||
msgid "Your choices are:"
|
||
msgstr "Vos choix sont:"
|
||
|
||
#: lazarusidestrconsts.lismissingunitscomment
|
||
#, fuzzy
|
||
msgid "Comment Out"
|
||
msgstr "1) Commentaire sur les unités sélectionnées."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsfordelphi
|
||
msgid "For Delphi only"
|
||
msgstr "Pour Delphi seulement"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1
|
||
msgid "1) Comment out the selected units."
|
||
msgstr "1) Commentaire sur les unités sélectionnées."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1b
|
||
msgid "1) Use the units only for Delphi."
|
||
msgstr "1) Utiliser les unités uniquement pour Delphi."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo2
|
||
msgid "2) Search for units. Found paths are added to project settings."
|
||
msgstr "2) Recherche des unités. Les chemins trouvés sont ajoutés aux paramètres du projet."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo3
|
||
msgid "3) Abort now, install packages or fix paths and try again."
|
||
msgstr "3) Abandonnez maintenant, installez les paquets ou de fixez les chemins et essayez à nouveau."
|
||
|
||
#: lazarusidestrconsts.lismissingunitssearch
|
||
msgid "Search Unit Path"
|
||
msgstr "Recherche de chemin de l'unité"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsskip
|
||
msgid "Skip this Unit"
|
||
msgstr "Ignorer cette unité"
|
||
|
||
#: lazarusidestrconsts.lismodifiedlgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts.lismodify
|
||
msgid "&Modify"
|
||
msgstr "&Modifier"
|
||
|
||
#: lazarusidestrconsts.lismore
|
||
msgctxt "lazarusidestrconsts.lismore"
|
||
msgid "More"
|
||
msgstr "Plus"
|
||
|
||
#: lazarusidestrconsts.lismoveonepositiondown
|
||
msgid "Move \"%s\" one position down"
|
||
msgstr "Déplacer \"%s\" une position plus bas"
|
||
|
||
#: lazarusidestrconsts.lismoveonepositionup
|
||
msgid "Move \"%s\" one position up"
|
||
msgstr "Déplacer \"%s\" une position plus haut"
|
||
|
||
#: lazarusidestrconsts.lismovepage
|
||
#, fuzzy
|
||
#| msgid "Move Page ..."
|
||
msgid "Move Page"
|
||
msgstr "Déplacer la page..."
|
||
|
||
#: lazarusidestrconsts.lisms
|
||
msgid "(ms)"
|
||
msgstr "(ms)"
|
||
|
||
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr "Sauver les messages dans un fichier (*.txt)"
|
||
|
||
#: lazarusidestrconsts.lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr "Conflit de nom"
|
||
|
||
#: lazarusidestrconsts.lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr "Nom de la nouvelle procédure"
|
||
|
||
#: lazarusidestrconsts.lisnever
|
||
msgctxt "lazarusidestrconsts.lisnever"
|
||
msgid "Never"
|
||
msgstr "Jamais"
|
||
|
||
#: lazarusidestrconsts.lisnew
|
||
msgid "new"
|
||
msgstr "Nouveau"
|
||
|
||
#: lazarusidestrconsts.lisnewancestors
|
||
msgid "New Ancestors"
|
||
msgstr "Nouveaux ancêtres"
|
||
|
||
#: lazarusidestrconsts.lisnewbuildmode
|
||
msgid "New build mode"
|
||
msgstr "Nouveau mode de création"
|
||
|
||
#: lazarusidestrconsts.lisnewclass
|
||
msgid "New Class"
|
||
msgstr "Nouvelle classe"
|
||
|
||
#: lazarusidestrconsts.lisnewconsoleapplication
|
||
msgid "New console application"
|
||
msgstr "Nouvelle application console"
|
||
|
||
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
||
#| msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
||
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
|
||
msgstr "Créer une nouvelle application CGI.%sLa source de l'application est gérée par Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
|
||
msgid "Create a new program."
|
||
msgstr "Créer un nouveau programme."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr "Créer un nouveau fichier dans l'éditeur.%sChoisir un type."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr "Créer un nouveau fichier texte vide"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
|
||
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
||
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
|
||
msgstr "Créer une nouvelle application graphique.%sLa source de l'application est gérée par Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
|
||
msgid "Create a new pascal unit."
|
||
msgstr "Créer une nouvelle unité Pascal."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
|
||
#| msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
||
msgid "Create a new program.%sThe program source is maintained by Lazarus."
|
||
msgstr "Créer un nouveau programme.%sLa source de l'application est gérée par Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr "Créer un nouveau projet.%Choisir un type."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr "Créer un nouveau paquet standard.%sUn paquet est une collection d'unités et de composants."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr "Créer une nouvelle unité avec un module de données."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
||
#| msgid "Create a new unit with a frame"
|
||
msgid "Create a new unit with a frame."
|
||
msgstr "Créer une nouvelle unité avec un cadre."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr "Créer une nouvelle unité avec une fiche LCL."
|
||
|
||
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
||
msgid "Inherit from a project form or component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "Pas d'élément sélectionné"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "Veuillez d'abord sélectionner un élément"
|
||
|
||
#: lazarusidestrconsts.lisnewencoding
|
||
msgid "New encoding:"
|
||
msgstr "Nouveau codage :"
|
||
|
||
#: lazarusidestrconsts.lisnewgroupasetofmodes
|
||
#, fuzzy
|
||
msgid "New group - a set of modes"
|
||
msgstr "Confirmez le nouvel ensemble de paquets pour l'EDI"
|
||
|
||
#: lazarusidestrconsts.lisnewproject
|
||
#| msgid "%s - (new project)"
|
||
msgid "(new project)"
|
||
msgstr "(nouveau projet)"
|
||
|
||
#: lazarusidestrconsts.lisnewsetting
|
||
msgid "New setting"
|
||
msgstr "Nouveau paramètre"
|
||
|
||
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
||
#, fuzzy
|
||
#| msgid "New units are added to uses sections:"
|
||
msgid "New units are added to uses sections"
|
||
msgstr "De nouvelles unités sont ajoutées aux sections uses:"
|
||
|
||
#: lazarusidestrconsts.lisno
|
||
msgid "No"
|
||
msgstr "Non"
|
||
|
||
#: lazarusidestrconsts.lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr "Pas de fichiers de sauvegarde"
|
||
|
||
#: lazarusidestrconsts.lisnobuildprofilesselected
|
||
msgid "No profiles are selected to be built."
|
||
msgstr "Pas de profil sélectionné pour la création."
|
||
|
||
#: lazarusidestrconsts.lisnochange
|
||
msgid "No change"
|
||
msgstr "Pas de changements"
|
||
|
||
#: lazarusidestrconsts.lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "Aucun code sélectionné"
|
||
|
||
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr "Aucune option de compilateur héritée"
|
||
|
||
#: lazarusidestrconsts.lisnoerrors
|
||
msgid "No errors"
|
||
msgstr "Pas d'erreurs"
|
||
|
||
#: lazarusidestrconsts.lisnohints
|
||
msgid "no hints"
|
||
msgstr "pas de conseil"
|
||
|
||
#: lazarusidestrconsts.lisnoidewindowselected
|
||
msgid "No IDE window selected"
|
||
msgstr "Pas de fenêtre iDE sélectionné"
|
||
|
||
#: lazarusidestrconsts.lisnolfmfile
|
||
msgid "No LFM file"
|
||
msgstr "pas de fichier LFM"
|
||
|
||
#: lazarusidestrconsts.lisnomacroselected
|
||
msgid "No macro selected"
|
||
msgstr "Aucune macro sélectionnée"
|
||
|
||
#: lazarusidestrconsts.lisnoname
|
||
msgid "noname"
|
||
msgstr "sans_nom"
|
||
|
||
#: lazarusidestrconsts.lisnone
|
||
msgid "%snone"
|
||
msgstr "%s aucun "
|
||
|
||
#: lazarusidestrconsts.lisnone2
|
||
msgid "none"
|
||
msgstr "Aucun"
|
||
|
||
#: lazarusidestrconsts.lisnoneclicktochooseone
|
||
msgid "none, click to choose one"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnonodeselected
|
||
msgid "no node selected"
|
||
msgstr "Aucun nœud sélectionné"
|
||
|
||
#: lazarusidestrconsts.lisnopascalfile
|
||
msgid "No pascal file"
|
||
msgstr "pas de fichier pascal"
|
||
|
||
#: lazarusidestrconsts.lisnoprogramfilesfound
|
||
msgid "No program file %s%s%s found."
|
||
msgstr "Fichier programme %s%s%s non trouvé."
|
||
|
||
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr "Section ResourceString non trouvée"
|
||
|
||
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
||
#, fuzzy
|
||
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr "Normalement le filtre est une expression régulière. En syntaxe simple un . est un caractère normal, une * vaut pour toute suite de caractères , un ? vaut pour tout caractère, et la virgule et le point-virgule sépare les solutions de rechange . Par exemple : Syntaxe simple *.pas;*.pp correspond à ^(.*\\.pas|.*\\.pp)$"
|
||
|
||
#: lazarusidestrconsts.lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr "Constante chaîne non trouvée"
|
||
|
||
#: lazarusidestrconsts.lisnotaninstallpackage
|
||
msgid "Not an install package"
|
||
msgstr "N'est pas un paquet d'installation"
|
||
|
||
#: lazarusidestrconsts.lisnotavalidpascalidentifier
|
||
msgid "Not a valid pascal identifier"
|
||
msgstr "N'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr "NOTE : Incapable de créer le modèle 'Define' pour sources Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr "NOTE : Incapable de créer le modèle 'Define' pour sources Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr "Non implémenté"
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr "Non implémenté à ce jour :%s%s"
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet2
|
||
msgid "Not implemented yet."
|
||
msgstr "Non implémenté à ce jour."
|
||
|
||
#: lazarusidestrconsts.lisnotnow
|
||
msgid "Not now"
|
||
msgstr "Pas maintenant"
|
||
|
||
#: lazarusidestrconsts.lisnpcreate
|
||
msgid "Create"
|
||
msgstr "Créer"
|
||
|
||
#: lazarusidestrconsts.lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr "Créer un nouveau projet"
|
||
|
||
#: lazarusidestrconsts.lisnpselectaprojecttype
|
||
msgid "Select a project type"
|
||
msgstr "Choisir un type de projet"
|
||
|
||
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
||
msgid "Number of files to convert: %s"
|
||
msgstr "Nombre de fichiers à convertir:%s"
|
||
|
||
#: lazarusidestrconsts.lisobjectpascaldefault
|
||
msgid "Object Pascal - default"
|
||
msgstr "Pascal Objet - default"
|
||
|
||
#: lazarusidestrconsts.lisobjectpath
|
||
msgid "object path"
|
||
msgstr "Chemin du code objet"
|
||
|
||
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
||
msgid "Switch to Object Inspector Favorites tab"
|
||
msgstr "Basculer vers l'onglet des favoris de l'inspecteur d'objet"
|
||
|
||
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
|
||
msgid "Switch to Object Inspector Favorites tab after asking for component name"
|
||
msgstr "Bascule vers l'onglet des favoris de l'inspecteur d'objet après avoir demandé le nom du composant"
|
||
|
||
#: lazarusidestrconsts.lisoff
|
||
msgid "? (Off)"
|
||
msgstr "? (Off)"
|
||
|
||
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
|
||
msgid "Add to favourite properties"
|
||
msgstr "Ajouter aux propriétés favorites"
|
||
|
||
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
|
||
msgid "Choose a base class for the favourite property %s%s%s."
|
||
msgstr "Choisir une classe de base pour la propriété favorite %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisoifclassnotfound
|
||
msgid "Class %s%s%s not found."
|
||
msgstr "Classe %s%s%s non trouvée."
|
||
|
||
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
|
||
msgid "Remove from favourite properties"
|
||
msgstr "Retirer des propriétés favorites"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr "Installation auto dynamique"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr "Installation auto statique"
|
||
|
||
#: lazarusidestrconsts.lisoipdescription
|
||
msgid "Description: "
|
||
msgstr "Description : "
|
||
|
||
#: lazarusidestrconsts.lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%sDescription : %s"
|
||
|
||
#: lazarusidestrconsts.lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr "Nom de fichier : %s"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr "installé dynamiquement"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr "installé statiquement"
|
||
|
||
#: lazarusidestrconsts.lisoipmissing
|
||
msgid "missing"
|
||
msgstr "manquant"
|
||
|
||
#: lazarusidestrconsts.lisoipmodified
|
||
msgid "modified"
|
||
msgstr "modifié"
|
||
|
||
#: lazarusidestrconsts.lisoipnopackageselected
|
||
msgid "No package selected"
|
||
msgstr "Pas de paquet sélectionné"
|
||
|
||
#: lazarusidestrconsts.lisoipopenloadedpackage
|
||
#, fuzzy
|
||
#| msgid "Open loaded package"
|
||
msgid "Open Loaded Package"
|
||
msgstr "Ouvrir le paquet chargé"
|
||
|
||
#: lazarusidestrconsts.lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr "Nom du paquet"
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr "Veuillez sélectionner un paquet"
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
|
||
msgid "Please select a package to open"
|
||
msgstr "Veuillez sélectionner un paquet à ouvrir"
|
||
|
||
#: lazarusidestrconsts.lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr "Lecture seule"
|
||
|
||
#: lazarusidestrconsts.lisoipstate
|
||
msgctxt "lazarusidestrconsts.lisoipstate"
|
||
msgid "State"
|
||
msgstr "Etat"
|
||
|
||
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "%s Ce paquet est installé, mais le fichier lpk est introuvable"
|
||
|
||
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
|
||
msgid "%sThis package was automatically created"
|
||
msgstr "%sCe paquet a été créé automatiquement"
|
||
|
||
#: lazarusidestrconsts.lisok
|
||
#| msgid "&Ok"
|
||
msgid "&OK"
|
||
msgstr "&OK"
|
||
|
||
#: lazarusidestrconsts.lisold
|
||
msgid "old"
|
||
msgstr "Ancien"
|
||
|
||
#: lazarusidestrconsts.lisoldancestors
|
||
msgid "Old Ancestors"
|
||
msgstr "Anciens ancêtres"
|
||
|
||
#: lazarusidestrconsts.lisoldclass
|
||
msgid "Old Class"
|
||
msgstr "Ancienne classe"
|
||
|
||
#: lazarusidestrconsts.lison
|
||
msgid "? (On)"
|
||
msgstr "? (On)"
|
||
|
||
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
||
msgid "On break line (i.e. return or enter key)"
|
||
msgstr "Sur le saut de ligne (à savoir tourche RETURN ou ENTER)"
|
||
|
||
#: lazarusidestrconsts.lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr "Chercher les mots entiers seulement"
|
||
|
||
#: lazarusidestrconsts.lisonpastefromclipboard
|
||
#, fuzzy
|
||
msgid "On paste from clipboard"
|
||
msgstr "Coller les composants depuis le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.lisopen
|
||
msgid "Open ..."
|
||
msgstr "Ouvrir..."
|
||
|
||
#: lazarusidestrconsts.lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr "Ouvrir un fichier XML"
|
||
|
||
#: lazarusidestrconsts.lisopendesigneronopenunit
|
||
msgid "Open designer on open unit"
|
||
msgstr "Ouvrir le concepteur de fiche avec l'unité ouverte"
|
||
|
||
#: lazarusidestrconsts.lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr "Ouvrir le fichier existant"
|
||
|
||
#: lazarusidestrconsts.lisopenfile
|
||
#, fuzzy
|
||
#| msgid "Open file"
|
||
msgctxt "lazarusidestrconsts.lisopenfile"
|
||
msgid "Open File"
|
||
msgstr "Ouvrir un fichier"
|
||
|
||
#: lazarusidestrconsts.lisopenfile2
|
||
#, fuzzy
|
||
#| msgid "Open file"
|
||
msgctxt "lazarusidestrconsts.lisopenfile2"
|
||
msgid "Open file"
|
||
msgstr "Ouvrir un fichier"
|
||
|
||
#: lazarusidestrconsts.lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr "Ouvrir %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr "Ouvrir le paquet ?"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage2
|
||
msgid "Open package %s"
|
||
msgstr "Ouvrir le paquet %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr "Ouvrir un fichier paquet"
|
||
|
||
#: lazarusidestrconsts.lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "Ouvrir le projet ?"
|
||
|
||
#: lazarusidestrconsts.lisopenproject2
|
||
msgid "Open project"
|
||
msgstr "Ouvrir projet"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr "Réouvrir projet"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "Ouvrir un fichier projet"
|
||
|
||
#: lazarusidestrconsts.lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr "Ouvrir le lien symbolique"
|
||
|
||
#: lazarusidestrconsts.lisopentarget
|
||
msgid "Open target"
|
||
msgstr "Ouvrir la cible"
|
||
|
||
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr "Ouvrir le fichier en tant que source normale"
|
||
|
||
#: lazarusidestrconsts.lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr "Ouvrir le paquet %s?"
|
||
|
||
#: lazarusidestrconsts.lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr "Ouvrir le projet %s?"
|
||
|
||
#: lazarusidestrconsts.lisopenxml
|
||
msgid "Open XML"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
|
||
msgid "Options changed, recompiling clean with -B"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisor
|
||
msgid "or"
|
||
msgstr "ou"
|
||
|
||
#: lazarusidestrconsts.lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr "Outrepasser le langage. Par exemple --language=de. Pour les valeurs possibles voir dans le dossier languages."
|
||
|
||
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
||
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
||
msgstr "%sredefinie le compilateur par défaut. par exemple, ppc386 ppcx64 ppcppc etc par défaut est stocké dans environmentoptions.xml"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
||
msgid "%soverride the project build mode."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
||
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
||
msgstr "%sredefinie la CPU du projet. Par exemple, i386 x86_64 powerpc powerpc_64 etc. défaut: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
||
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
||
msgstr "%sredefinie l'OS du projet. Par exemple, win32 linux. défaut: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
||
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
||
msgstr "%sredefinie le widgetset du projet. Par exemple, gtk gtk2 qt win32 carbon. défaut: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr "Ecraser le fichier ?"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr "Ecraser les fichiers sur le disque"
|
||
|
||
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
||
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackage
|
||
msgid "Package"
|
||
msgstr "Paquet"
|
||
|
||
#: lazarusidestrconsts.lispackage2
|
||
msgid "package %s"
|
||
msgstr " paquet %s"
|
||
|
||
#: lazarusidestrconsts.lispackageinfo
|
||
#, fuzzy
|
||
#| msgid "Package Info"
|
||
msgid "Package info"
|
||
msgstr "Information paquet"
|
||
|
||
#: lazarusidestrconsts.lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr "Le nom de paquet commence par ..."
|
||
|
||
#: lazarusidestrconsts.lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr "Nom de paquet contient ..."
|
||
|
||
#: lazarusidestrconsts.lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr "Le paquet doit être installé"
|
||
|
||
#: lazarusidestrconsts.lispackageoutputdirectories
|
||
msgid "Package output directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackagesourcedirectories
|
||
msgid "Package source directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackagestoinstallintheide
|
||
msgid "Packages to install in the IDE"
|
||
msgstr "Paquets à installer dans l'EDI"
|
||
|
||
#: lazarusidestrconsts.lispackageunit
|
||
msgid "package unit"
|
||
msgstr "Unité du paquet"
|
||
|
||
#: lazarusidestrconsts.lisparsed
|
||
msgid ", parsed "
|
||
msgstr ", analysé "
|
||
|
||
#: lazarusidestrconsts.lispascalsourcefile
|
||
msgid "Pascal source file"
|
||
msgstr "Fichier source pascal"
|
||
|
||
#: lazarusidestrconsts.lispascalunit
|
||
msgid "Pascal unit"
|
||
msgstr "Unité pascal"
|
||
|
||
#: lazarusidestrconsts.lispasscount
|
||
msgid "Pass Count"
|
||
msgstr "Nombre de passes"
|
||
|
||
#: lazarusidestrconsts.lispasteclipboard
|
||
msgid "paste clipboard"
|
||
msgstr "Coller le contenu du presse-papiers"
|
||
|
||
#: lazarusidestrconsts.lispastetextfromclipboard
|
||
msgid "Paste text from clipboard"
|
||
msgstr "Coller le texte depuis le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.lispath
|
||
msgid "Path"
|
||
msgstr "Chemin"
|
||
|
||
#: lazarusidestrconsts.lispatheditbrowse
|
||
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
||
msgid "Browse"
|
||
msgstr "Parcourir"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathdown
|
||
msgid "Move path down"
|
||
msgstr "Descendre le chemin"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathup
|
||
msgid "Move path up"
|
||
msgstr "Monter le Chemin"
|
||
|
||
#: lazarusidestrconsts.lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr "Chemin des modèles"
|
||
|
||
#: lazarusidestrconsts.lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr "Chemins de recherche:"
|
||
|
||
#: lazarusidestrconsts.lispatheditselectdirectory
|
||
msgid "Select directory"
|
||
msgstr "Sélectionner un répertoire"
|
||
|
||
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
||
msgid "path of the instantfpc cache"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispathofthemakeutility
|
||
msgid "Path of the make utility"
|
||
msgstr "Chemin de l'utilitaire make"
|
||
|
||
#: lazarusidestrconsts.lispathtoinstance
|
||
#, fuzzy
|
||
msgid "Path to failed Instance:"
|
||
msgstr "L'exécution de l'outil a échoué"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddanitem
|
||
msgid "Add an item"
|
||
msgstr "Ajouter un élément"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddtoproject
|
||
#, fuzzy
|
||
#| msgid "Add to project"
|
||
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
||
msgid "Add to Project"
|
||
msgstr "Ajouter au projet"
|
||
|
||
#: lazarusidestrconsts.lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "Appliquer les changements"
|
||
|
||
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr "Appel de la procédure %sRegister%s de l'unité sélectionnée"
|
||
|
||
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
||
msgid "Clear default/preferred filename of dependency"
|
||
msgstr "Effacer le nom de fichier de dépendance par défaut/préféré"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompile
|
||
msgctxt "lazarusidestrconsts.lispckeditcompile"
|
||
msgid "Compile"
|
||
msgstr "Compiler"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr "Compiler tout?"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr "Compiler le paquet"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr "Options du compilateur pour le paquet %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompopts
|
||
msgctxt "lazarusidestrconsts.lispckeditcompopts"
|
||
msgid "Compiler Options"
|
||
msgstr "Options du compilateur"
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatemakefile
|
||
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Créer le Makefile"
|
||
|
||
#: lazarusidestrconsts.lispckeditdefault
|
||
msgid "%s, default: %s"
|
||
msgstr "%s, defaut: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr "Propriétés de dépendance"
|
||
|
||
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
||
msgid "Edit General Options"
|
||
msgstr "Editer les options générales"
|
||
|
||
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
|
||
msgid "Edit Options to compile package"
|
||
msgstr "Editer les options de compilation de paquet"
|
||
|
||
#: lazarusidestrconsts.lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr "Propriétés du fichier"
|
||
|
||
#: lazarusidestrconsts.lispckeditgeneraloptions
|
||
msgid "General Options"
|
||
msgstr "Options générales"
|
||
|
||
#: lazarusidestrconsts.lispckedithelp
|
||
msgctxt "lazarusidestrconsts.lispckedithelp"
|
||
msgid "Help"
|
||
msgstr "Aide"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstall
|
||
msgid "Install"
|
||
msgstr "Installer"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstallpackageintheide
|
||
msgid "Install package in the IDE"
|
||
msgstr "Installer le paquet dans l'EDI"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr "Version maximum non valide"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr "Version minimum non valide"
|
||
|
||
#: lazarusidestrconsts.lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr "Version maximum :"
|
||
|
||
#: lazarusidestrconsts.lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr "Version minimum :"
|
||
|
||
#: lazarusidestrconsts.lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr "Modifié : %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditmore
|
||
#| msgid "More ..."
|
||
msgid "More >>"
|
||
msgstr "Plus >>"
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr "Déplacer la dépendance vers le bas"
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr "Déplacer la dépendance vers le haut"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr "Paquet %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
||
msgid "Package %s%s%s has changed.%sSave package?"
|
||
msgstr "Le paquet %s%s%s a changé.%sL'enregistrer ?"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr "paquet %s non enregistré"
|
||
|
||
#: lazarusidestrconsts.lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s, Page : %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr "Ré-ajouter la dépendance"
|
||
|
||
#: lazarusidestrconsts.lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr "Ré-ajouter le fichier"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr "Lecture seule: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
||
#, fuzzy
|
||
#| msgid "Recompile all required"
|
||
msgid "Recompile All Required"
|
||
msgstr "Recompiler tout ce qui est requis"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileclean
|
||
#, fuzzy
|
||
#| msgid "Recompile clean"
|
||
msgid "Recompile Clean"
|
||
msgstr "Nettoyer et recompiler"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr "Re-compiler ceci et tous les paquets requis ?"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr "Référencer les plugins"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr "Référencer l'unité"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr "Retirer la dépendance"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr "Retirer la dépendance ?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Retirer la dépendance %s%s%s%sdu paquet %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedfiles
|
||
msgid "Removed Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
||
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
||
msgid "Removed required packages"
|
||
msgstr "Paquets requis retirés"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr "Retirer le fichier"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr "Retirer le fichier ?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
||
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Retirer le fichier %s%s%s%sdu paquet %s%s% ?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "Retirer l'élément sélectionné"
|
||
|
||
#: lazarusidestrconsts.lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr "Paquets requis"
|
||
|
||
#: lazarusidestrconsts.lispckeditsavepackage
|
||
#, fuzzy
|
||
#| msgid "Save package"
|
||
msgid "Save Package"
|
||
msgstr "Enregistrer le paquet"
|
||
|
||
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
||
msgid "Store file name as default for this dependency"
|
||
msgstr "Enregistre le nom de fichier par défaut pour cette dépendance"
|
||
|
||
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
||
msgid "Store file name as preferred for this dependency"
|
||
msgstr "Enregistre le nom de fichier en favoris pour cette dépendance"
|
||
|
||
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "La version maximale %s%s%s n'est pas une version de paquet valide.%s(exemple correct: 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "La version minimale %s%s%s n'est pas une version de paquet valide.%s(exemple correct: 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr "Désinstaller"
|
||
|
||
#: lazarusidestrconsts.lispckeditviewpackagesource
|
||
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
||
msgid "View Package Source"
|
||
msgstr "Afficher le Source du Paquet"
|
||
|
||
#: lazarusidestrconsts.lispckexplautocreated
|
||
msgid "AutoCreated"
|
||
msgstr "généré automatiquement"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstalled
|
||
msgid "Installed"
|
||
msgstr "Installé"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr "Installer au prochain démarrage"
|
||
|
||
#: lazarusidestrconsts.lispckexplisrequiredby
|
||
msgid "Selected package is required by:"
|
||
msgstr "Le paquet sélectionné est requis par:"
|
||
|
||
#: lazarusidestrconsts.lispckexplloadedpackages
|
||
msgid "Loaded Packages:"
|
||
msgstr "Paquets chargés :"
|
||
|
||
#: lazarusidestrconsts.lispckexplpackagenotfound
|
||
msgid "Package %s not found"
|
||
msgstr "Paquet %s non trouvé"
|
||
|
||
#: lazarusidestrconsts.lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr "%sEtat : "
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start"
|
||
msgstr "Désinstaller au prochain démarrage"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "Ajouter les options aux paquets et projets dépendants"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "Ajouter les chemins aux paquets/projets dépendants"
|
||
|
||
#: lazarusidestrconsts.lispckoptsauthor
|
||
#, fuzzy
|
||
#| msgid "Author:"
|
||
msgid "Author"
|
||
msgstr "Auteur:"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
|
||
msgid "Automatically increment version on build"
|
||
msgstr "Incrémenter automatiquement la version durant la création"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "Recréer automatiquement au besoin"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "Recréation automatique quand on recrée tout"
|
||
|
||
#: lazarusidestrconsts.lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr "Personnalisé"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
||
#, fuzzy
|
||
#| msgid "Description/Abstract"
|
||
msgid "Description / Abstract"
|
||
msgstr "Description/Résumé"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
||
#, fuzzy
|
||
#| msgid "Designtime and Runtime"
|
||
msgid "Designtime and runtime"
|
||
msgstr "Conception et exécution"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeonly
|
||
msgid "Designtime only"
|
||
msgstr "Conception seulement"
|
||
|
||
#: lazarusidestrconsts.lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr "Intégration de l'EDI"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr "Inclure"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr "Type de paquet non valide"
|
||
|
||
#: lazarusidestrconsts.lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr "Librairie"
|
||
|
||
#: lazarusidestrconsts.lispckoptslicense
|
||
#, fuzzy
|
||
#| msgid "License:"
|
||
msgid "License"
|
||
msgstr "Licence :"
|
||
|
||
#: lazarusidestrconsts.lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr "Editeur de liens"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr "Principal"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr "Compilation manuelle (jamais automatiquement)"
|
||
|
||
#: lazarusidestrconsts.lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr "Mineur"
|
||
|
||
#: lazarusidestrconsts.lispckoptsobject
|
||
msgid "Object"
|
||
msgstr "Objet"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr "Options du paquet"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackagetype
|
||
#, fuzzy
|
||
#| msgid "PackageType"
|
||
msgid "Package type"
|
||
msgstr "Type de paquet"
|
||
|
||
#: lazarusidestrconsts.lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr "Fournit"
|
||
|
||
#: lazarusidestrconsts.lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr "Libérer"
|
||
|
||
#: lazarusidestrconsts.lispckoptsruntimeonly
|
||
msgid "Runtime only"
|
||
msgstr "A l'éxécution seulement"
|
||
|
||
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
||
msgstr "Le paquet %s%s%s est marqué pour installation automatique.%sCeci implique qu'il sera installé dans l'EDI. Les paquets d'installation%sdoivent être des paquets de conception."
|
||
|
||
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr "Ce paquet fournit les mêmes que les paquets suivants :"
|
||
|
||
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
||
#, fuzzy
|
||
#| msgid "Update/Rebuild"
|
||
msgid "Update / Rebuild"
|
||
msgstr "Mettre à jour/Recréation"
|
||
|
||
#: lazarusidestrconsts.lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr "Utilisation"
|
||
|
||
#: lazarusidestrconsts.lispdabort
|
||
msgctxt "lazarusidestrconsts.lispdabort"
|
||
msgid "Abort"
|
||
msgstr "Abandon"
|
||
|
||
#: lazarusidestrconsts.lispdprogress
|
||
msgid "Progress"
|
||
msgstr "Progrès"
|
||
|
||
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Une unité Pascal doit avoir l'extension .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts.lispecollapsedirectory
|
||
msgid "Collapse directory"
|
||
msgstr "Réduire le répertoire"
|
||
|
||
#: lazarusidestrconsts.lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr "Conflit trouvé "
|
||
|
||
#: lazarusidestrconsts.lispedirectories
|
||
msgid "Directories"
|
||
msgstr "Répertoires"
|
||
|
||
#: lazarusidestrconsts.lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr "Editer l'unité virtuelle"
|
||
|
||
#: lazarusidestrconsts.lispeexpanddirectory
|
||
msgid "Expand directory"
|
||
msgstr "Développez le répertoire"
|
||
|
||
#: lazarusidestrconsts.lispefilename
|
||
msgid "Filename:"
|
||
msgstr "Nom de fichier :"
|
||
|
||
#: lazarusidestrconsts.lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr "Corriger la casse des fichiers"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr "Nom de fichier d'unité non valide"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr "Nom d'unité non valide"
|
||
|
||
#: lazarusidestrconsts.lispemissingfilesofpackage
|
||
msgid "Missing files of package %s"
|
||
msgstr "Fichiers manquant du paquet %s"
|
||
|
||
#: lazarusidestrconsts.lispemovefiledown
|
||
msgid "Move file down"
|
||
msgstr "Déplacez le fichier vers le bas"
|
||
|
||
#: lazarusidestrconsts.lispemovefileup
|
||
msgid "Move file up"
|
||
msgstr "Déplacez le fichier vers le haut"
|
||
|
||
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
||
msgid "New file not in include path"
|
||
msgstr "Nouveau fichier qui n'est pas dans le chemin include "
|
||
|
||
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
||
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
||
msgid "No files missing. All files exist."
|
||
msgstr "Aucun fichier manquant. Tous les fichiers existent."
|
||
|
||
#: lazarusidestrconsts.lisperemovefiles
|
||
msgid "Remove files"
|
||
msgstr "Supprime les fichiers"
|
||
|
||
#: lazarusidestrconsts.lisperemoveselectedfiles
|
||
msgid "Remove selected files"
|
||
msgstr "Supprime les fichiers sélectionnés"
|
||
|
||
#: lazarusidestrconsts.lisperevertpackage
|
||
msgid "Revert Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispesavepackageas
|
||
#, fuzzy
|
||
#| msgid "Save package as"
|
||
msgid "Save Package As ..."
|
||
msgstr "Enregistre le paquet sous"
|
||
|
||
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
||
msgid "Show directory hierarchy"
|
||
msgstr "Voir la hiérarchie des répertoires"
|
||
|
||
#: lazarusidestrconsts.lispeshowmissingfiles
|
||
#, fuzzy
|
||
#| msgid "Show missing files"
|
||
msgid "Show Missing Files"
|
||
msgstr "Voir les fichiers manquant"
|
||
|
||
#: lazarusidestrconsts.lispesortfiles
|
||
#, fuzzy
|
||
#| msgid "Sort files"
|
||
msgid "Sort Files"
|
||
msgstr "Trier les fichiers"
|
||
|
||
#: lazarusidestrconsts.lispesortfilesalphabetically
|
||
msgid "Sort files alphabetically"
|
||
msgstr "Trier les fichier alphabétiquement"
|
||
|
||
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
||
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
|
||
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Il y a déjà une unité avec ce nom.%sFichier: %s"
|
||
|
||
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
|
||
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr "Le nom d'unité n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts.lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr "Nom d'unité:"
|
||
|
||
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Le nom d'unité et de fichier ne doivent pas être identique. %s Example: unit1.pas and Unit1"
|
||
|
||
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
||
msgid "Use all units in directory"
|
||
msgstr "Utilise toutes les unités dans le répertoire"
|
||
|
||
#: lazarusidestrconsts.lispeusenounitsindirectory
|
||
msgid "Use no units in directory"
|
||
msgstr "Utilise aucune unité dans le répertoire"
|
||
|
||
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr "Chemin de source compilé additionnel"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr "Répertoire de destination"
|
||
|
||
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr "Marque de répertoire source des paquets"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr "Chemin de l'unité"
|
||
|
||
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr "Voulez-vous réellement abandonner les changements sur le paquet %s et le recharger à partir du fichier ?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr "Nouvelle unité pas dans le chemin de l'unité"
|
||
|
||
#: lazarusidestrconsts.lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr "Publier le paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr "Restaurer le paquet?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
#, fuzzy
|
||
#| msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
||
msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
|
||
msgstr "Le fichier %s%s%s%s n'est pas actuellement dans le chemin des unités du paquet.%s%sAjouter %s%s%s au chemin ?"
|
||
|
||
#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
|
||
msgid "Online Help not yet implemented"
|
||
msgstr "Aide en ligne pas encore implémentée"
|
||
|
||
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
||
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
||
msgstr "Cliquez-droit sur l'arbre des éléments pour ouvrir le menu contextuel avec toutes les fonctions de paquet."
|
||
|
||
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
|
||
msgid "There are more functions in the popupmenu"
|
||
msgstr "Il y a plus de fonctions dans le menu contextuel."
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypebinary
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
||
msgid "Binary"
|
||
msgstr "Binaire"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr "Fichier inclus"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr "Fichier xml des problèmes"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr "Fiche Lazarus texte - LFM"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr "Fichier ressource Lazarus - LRS"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypemainunit
|
||
msgid "Main Unit"
|
||
msgstr "Unité principale"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypetext
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
||
msgid "Text"
|
||
msgstr "Texte"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeunit
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
|
||
msgid "Unit"
|
||
msgstr "Unité"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr "Unité virtuelle"
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
||
msgid "Package directory. Parameter is package ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
||
msgid "Package include files search path. Parameter is package ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
||
msgid "Package source search path. Parameter is package ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
||
msgid "Package unit search path. Parameter is package ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s%s"
|
||
msgstr "%sAjout d'une nouvelle dépendance pour le paquet %s: paquet %s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s%s"
|
||
msgstr "%sAjout d'une nouvelle dépendance pour le projet %s: paquet %s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr "Ajouter une unité à la clause uses du paquet. Désactivez ceci seulement pour les unités qui ne devraient pas être compilées dans tous les cas."
|
||
|
||
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr "Unités ambigües trouvées"
|
||
|
||
#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
|
||
msgid "A required packages was not found. See package graph."
|
||
msgstr "Un paquet requis n'a pas été trouvé. Voir le graphique des paquets."
|
||
|
||
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr "Paquets installés automatiquement"
|
||
|
||
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr "%sLes deux paquets sont connectés. Soit l'un des paquets utilise l'autre, ou les deux sont utilisés par un troisième."
|
||
|
||
#: lazarusidestrconsts.lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr "Dépendance brisée"
|
||
|
||
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
||
msgid "Circular dependencies found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangcompilingpackage
|
||
msgid "Compiling package %s"
|
||
msgstr "compilation du paquet %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr "La suppression a échoué"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr "Supprimer l'ancien fichier paquet ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file %s%s%s?"
|
||
msgstr "Supprimer l'ancien fichier paquet %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr "Dépendance sans Propriétaire : %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr "Erreur de lecture de fichier"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr "Erreur de lecture du paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
|
||
msgid "Error: updating po files failed for package %s"
|
||
msgstr "Erreur: La mise à jour des fichiers .po a échouée pour le paquet %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Erreur d'écriture de fichier"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr "Erreur d'écriture du paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr "Le fichier est déjà dans le paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr "Le fichier est dans le projet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr "Nom de fichier différent du nom de paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr "Nom de fichier utilisé par un autre paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr "Nom de fichier utilisé par un projet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotfound
|
||
msgid "File %s%s%s not found."
|
||
msgstr "Fichier %s%s% non trouvé."
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr "Fichier non enregistré"
|
||
|
||
#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
|
||
msgid "Ignore and save package now"
|
||
msgstr "Ignorer et sauver le paquet maintenant "
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr "Intaller le paquet %s installera automatiquement le paquet :"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr "Installer le paquet %s installera automatiquement les paquets :"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr "Nom de fichier de compilateur non valide"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr "Extension de fichier non valide"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr "Extension de fichier paquet non valide"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr "Nom de fichier paquet non valide"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr "Nom de paquet non valide"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr "Nom de paquet non valide"
|
||
|
||
#: lazarusidestrconsts.lispkgmanglazarus
|
||
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
||
msgstr "Le chargement du paquet %s remplacera le paquet %s%sdu fichier %s.%sL'ancien paquet est modifié.%s%s Enregister l'ancien paquet %s ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr "NouveauPaquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr "Paquet : %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr "Paquet en conflit"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagefilemissing
|
||
msgid "Package file missing"
|
||
msgstr "Fichier paquet manquant"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
|
||
msgid "Package file not saved"
|
||
msgstr "Fichier paquet non enregistrer"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
|
||
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
||
msgstr "Le paquet %s%s%s n'a pas de répertoire de destination valide : %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is no designtime package"
|
||
msgstr "Le paquet n'est pas un paquet de conception"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr "Le paquet est requis"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr "fichier source principal du paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr "Nom de paquet déjà existant"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr "Les paquets doivent avoir l'extension .lpk"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
||
msgid "Please compile the package first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr "Veuillez enregistrer le fichier avant de l'ajouter à un paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr "Projet: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr "Recréer Lazarus ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr "Renommer le fichier en minuscules ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file %s%s%s?"
|
||
msgstr "Remplacer le fichier existant %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr "Remplacer le fichier"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackage
|
||
#, fuzzy
|
||
#| msgid "Save Package?"
|
||
msgid "Save package?"
|
||
msgstr "Enregistrer le paquet ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr "Enregistrer le paquet %s (*.lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
||
msgstr "Souhaitez-vous renommer en minuscules comme %s%s%s%s ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr "Sauter ce paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr "Fichier de configuration des paquets statiques"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr "Le fichier compilateur pour le paquet %s n'est pas un exécutable valide:%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "Le fichier %s%s%s%s est déjà dans le paquet %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
||
msgid "The file %s%s%s is not a lazarus package."
|
||
msgstr "Le fichier %s%s%s n'est pas un paquet Lazarus."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
||
msgstr "Le nom de fichier %s%s%s ne correspond pas au paquet nommé %s%s%s dans le fichier.%sChanger le nom du paquet par %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr "Le fichier nommé %s%s%s fait partie du projet en cours.%sLes projets et paquets ne devraient pas partager de fichiers."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
||
msgstr "Le nom de fichier %s%s%s est utilisé par%sle paquet %s%s%s%sdans le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
|
||
msgid "The file %s%s%s%sof package %s is missing."
|
||
msgstr "Le fichier %s%s%s%s du paquet %s est manquant"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
|
||
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
||
msgstr "Le fichier %s%s%s%sdu paquet %s a besoin d'être sauvé d'abord."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr "Le paquet suivant n'a pu être chargé :"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr "Les paquets suivants n'ont pu être chargés :"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
||
msgstr "%sL'unité suivante sera ajoutée à la liste USES de%s%s:%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
||
msgstr "Le paquet %s%s%s n'a pas été compilé.%sL'enlever de la liste d'installation ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
||
msgstr "Le nom de paquet %s%s%s dans%s%s%s%s n'est pas un nom de paquet Lazarus valide."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
||
msgstr "Le paquet %s n'est qu'un paquet d'éxécution.%sLes paquets d'éxécution ne peuvent pas être installés dans l'EDI."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
||
msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also uses the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr "Le paquet %s%s%s est marqué pour l'installation mais est introuvable.%sRetirer la dépendance de la liste d'installation des paquets?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr "Le paquet %s est requis par %s, qui est marqué pour l'installation.%sVoir le graphe des paquets."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr "Le nom de paquet %s%s%s n'est pas un nom de paquet invalide.%sVeuillez choisir un autre nom (comme package1.lpk)."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
||
msgstr "Le nom de paquet %s%s%s du%sfichier %s%s%s est invalide"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Le paquet %s%s%s a été marqué. %sActuellement Lazarus ne supporte que les paquets liés statiquement. La désinstallation nécessite de reconstruire et de redémarrer Lazarus.%s%sVoulez-vous recréer Lazarus maintenant ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Le paquet %s%s%s a été marqué pour l'installation.%sActuellement Lazarus ne supporte que les paquets liés statiquement. L'installation nécessite de reconstruire et de redémarrer Lazarus.%s%sVoulez-vous recréer Lazarus maintenant ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr "Le projet nécessite le paquet %s%s%s.%sMais il est introuvable. Voir Projet->Inspecteur de projet."
|
||
|
||
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
||
msgstr "Deux unités portent le même nom: %s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
||
msgid "There is a circular dependency in the packages. See package graph."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
||
msgstr "Une unité de FPC porte le même nom que le paquet:%s%s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
||
msgstr "Une unité de FPC porte le même nom que:%s%s%s%s%s de %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
||
msgstr "Un autre paquet porte déjà le nom %s%s%s.%sPaquet en conflit: %s%s%s%sFichier: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
||
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
||
msgstr "Il y a déjà un paquet %s%s%s chargé%sdepuis le fichier %s%s%s.%sVoir Composants -> Graphe des paquets%sRemplacer est impossible"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr "Il y a un paquet non enregistré dans les paquets requis. Voir le graphe des paquets."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
||
msgstr "Une unité porte le même nom qu'un paquet:%s%s1. %s%s%s de %s%s2. %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr "C'est un paquet virtuel. Il n'a pas encore de source. Veuillez sauvegarder le paquet d'abord."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr "Impossible de créer le répertoire"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
||
msgstr "Impossible de créer le répertoire de destination %s%s%s%s pour le paquet %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
||
msgstr "Impossible de créer le répertoire %s%s%s%spour les sources du paquet %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
||
msgstr "Impossible de créer le répertoire cible pour Lazarus:%s%s%s%s.%sCe répertoire est nécessaire pour le nouvel EDI modifié avec vos paquets personnalisés."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file %s%s%s."
|
||
msgstr "Impossible de supprimer le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr "Impossible de supprimer le fichier"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
||
msgstr "Impossible de supprimer l'ancien fichier d'état %s%s%s%spour le paquet %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr "Impossible de charger le paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
||
msgstr "Impossible d'ouvrir le paquet %s%s%s.%sCe paquet a été marqué pour l'installation."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Impossible de lire l'état du fichier %s%s%s%sdu paquet %s.%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
||
msgstr "Impossible d'écrire le paquet %s%s%s%sdans le fichier %s%s%s.%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Impossible d'écrire le fichier d'état %s%s%s%sdu paquet %s.%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr "Désinstaller le paquet ?"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr "Désinstaller le paquet %s? "
|
||
|
||
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr "Paquet non enregistré"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr "Utiliser l'unité"
|
||
|
||
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
||
msgstr "Avertissement: le fichier %s%s%s%sappartient au présent projet."
|
||
|
||
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Can not register components without unit"
|
||
msgstr "Ne peut enregistrer des composants sans unité"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
||
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
||
msgstr "Outils de code - des outils et des fonctions pour analyser, passer en revue et éditer des sources Pascal"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class %s%s%s already defined"
|
||
msgstr "Classe de composant %s%s%s déjà définie"
|
||
|
||
#: lazarusidestrconsts.lispkgsysfilename
|
||
msgid "%s%sFile Name: %s%s%s"
|
||
msgstr "%s%sNom de fichier : %s%s%"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr "Classe de composant non valide"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr "Nom d'unité non valide : %s"
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr "Fichier paquet non trouvé"
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
||
msgid "Package registration error"
|
||
msgstr "Erreur d'enregistrement du paquet"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr "La procédure Register est à nil"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr "RegisterUnit a été appellé, mais aucun paquet n'est référencé."
|
||
|
||
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
|
||
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
||
msgstr "SynEdit - l'éditeur de composants utilisé par Lazarus. http://sourceforge.net/projects/synedit/"
|
||
|
||
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
||
#, fuzzy
|
||
#| msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
||
msgid "The FCL - Free Pascal Component Library provides the base classes for Object Pascal."
|
||
msgstr "la FCL (FreePascal Component Library) fournit les classes de base pour le Pascal objet."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
||
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
||
msgstr "la LCL (Lazarus Component Library) contient tous les composants de base des fiches."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr "Le paquet %s%s%s est installé, mais aucun fichier de paquet valide(.lpk) n'a été trouvé.%s Un paquet factice a été créé."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
||
msgstr "Le RTL - La Run Time Library est la base de tous les programmes Free Pascal. "
|
||
|
||
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr "C'est le paquet par défaut. Utilisez-le seulement pour les composants sans paquet. Ces composants sont obsolètes."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr "Ce paquet est installé, mais le fichier lpk n'a pas été trouvé. Tous ses composants sont désactivés. Veuillez rectifier ceci."
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitname
|
||
msgid "%s%sUnit Name: %s%s%s"
|
||
msgstr "%s%sNom d'unité : %s%s%"
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
||
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
||
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
|
||
msgid "Unit \"%s\" was removed from package (lpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr "Ce fichier n'est dans aucun des paquets chargés."
|
||
|
||
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file %s%s%s.%sError: %s"
|
||
msgstr "Impossible de lire le fichier du paquet %s%s%s.%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts.lispldexists
|
||
msgid "Exists"
|
||
msgstr "Existe"
|
||
|
||
#: lazarusidestrconsts.lispldglobal
|
||
msgctxt "lazarusidestrconsts.lispldglobal"
|
||
msgid "Global"
|
||
msgstr "Global"
|
||
|
||
#: lazarusidestrconsts.lispldonlyexistingfiles
|
||
msgid "Only existing files"
|
||
msgstr "Seulement les fichiers existants"
|
||
|
||
#: lazarusidestrconsts.lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr "Liens du Paquet"
|
||
|
||
#: lazarusidestrconsts.lispldshowgloballinks
|
||
msgid "Show global links"
|
||
msgstr "Afficher les liens globaux"
|
||
|
||
#: lazarusidestrconsts.lispldshowuserlinks
|
||
msgid "Show user links"
|
||
msgstr "Afficher les liens utilisateur"
|
||
|
||
#: lazarusidestrconsts.lisplduser
|
||
msgid "User"
|
||
msgstr "Utilisateur"
|
||
|
||
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
||
msgid "Please fix the error shown in the message window, which is normally below the source editor."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr "Veuillez ouvrir une unité avant l'exécution"
|
||
|
||
#: lazarusidestrconsts.lispleaseselectabuildmodefirst
|
||
msgid "Please select a build mode first."
|
||
msgstr "S'il vous plaît sélectionnez un mode build en premier"
|
||
|
||
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr "Veuillez sélectionner du code pour extraire une nouvelle procédure/méthode."
|
||
|
||
#: lazarusidestrconsts.lisplistall
|
||
msgid "<All>"
|
||
msgstr "<Tout>"
|
||
|
||
#: lazarusidestrconsts.lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr "Changer la police"
|
||
|
||
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr "Copier le nom de méthode dans le presse-papier"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr "Filtrer en associant n'importe quelle partie de la méthode"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr "Filtrer en associant avec le début de la méthode"
|
||
|
||
#: lazarusidestrconsts.lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr "Aller à la sélection"
|
||
|
||
#: lazarusidestrconsts.lisplistnone
|
||
msgid "<None>"
|
||
msgstr "<Aucun>"
|
||
|
||
#: lazarusidestrconsts.lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr "&Objets"
|
||
|
||
#: lazarusidestrconsts.lisplistprocedurelist
|
||
msgid "Procedure List"
|
||
msgstr "Liste de procédure"
|
||
|
||
#: lazarusidestrconsts.lisplisttype
|
||
msgctxt "lazarusidestrconsts.lisplisttype"
|
||
msgid "Type"
|
||
msgstr "Type"
|
||
|
||
#: lazarusidestrconsts.lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr "Choisissez le répertoire des fichiers .po"
|
||
|
||
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr "Ne pas conserver les informations de session"
|
||
|
||
#: lazarusidestrconsts.lispointer
|
||
msgid "Pointer"
|
||
msgstr "Pointeur"
|
||
|
||
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
||
msgid "Save in IDE config directory"
|
||
msgstr "Sauver dans le dossier de configuration de l'EDI"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr "Sauver dans un fichier .lpi"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr "Sauver dans un fichier .lps du dossier projet"
|
||
|
||
#: lazarusidestrconsts.lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr "Sauver les informations de session dans"
|
||
|
||
#: lazarusidestrconsts.lisprecedingword
|
||
msgid "Preceding word"
|
||
msgstr "Mot précédent"
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr "Premier répertoire de configuration, là où Lazarrus stocke ses dossiers de configuration. Par défaut c'est"
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigpath
|
||
msgid "Primary config path"
|
||
msgstr "chemin de configuration principal"
|
||
|
||
#: lazarusidestrconsts.lisprint
|
||
msgid "Print"
|
||
msgstr "Imprimer"
|
||
|
||
#: lazarusidestrconsts.lisprivate
|
||
msgid "Private"
|
||
msgstr "Méthode privée"
|
||
|
||
#: lazarusidestrconsts.lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr "Méthode privée"
|
||
|
||
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
#, fuzzy
|
||
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
||
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
|
||
msgstr "Vous devez probablement installer certains paquets avant de pouvoir continuer.%s%sAttention:%sLe projet dépend de certains paquets, qui contiennent des unités avec la procédure Register. La procédure Register est normalement employée pour installer des composants dans l'EDI. Mais les unités suivantes appartiennent aux paquets qui ne sont pas encore installés dans l'EDI. Si vous essayez d'ouvrir une fiche dans l'EDI qui emploie de tels composants, vous obtiendrez des erreurs relatives aux composants absents et le chargement de la fiche créera probablement des résultats très désagréables.%s%sceci n'a aucun impact pour ouvrir le projet ou n'importe lequel de ses sources.%s%sça signifie seulement que : C'est une mauvaise idée d'ouvrir les fiches pour concevoir, avant d'installer les paquets manquants.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprocedure
|
||
msgctxt "lazarusidestrconsts.lisprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Procédure"
|
||
|
||
#: lazarusidestrconsts.lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr "Procédure avec interface"
|
||
|
||
#: lazarusidestrconsts.lisprogram
|
||
msgctxt "lazarusidestrconsts.lisprogram"
|
||
msgid "Program"
|
||
msgstr "Programme"
|
||
|
||
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
|
||
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
||
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
|
||
msgstr "Programme%sUn programme FreePascal. Le fichier source du programme est automatiquement géré par Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr "Programme détecté"
|
||
|
||
#: lazarusidestrconsts.lisprogramnotfound
|
||
msgid "Program %s not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
||
msgstr "Le fichier source du programme doit avoir une extension Pascal comme .pas, .pp ou .lpr"
|
||
|
||
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
||
msgid "Add files to project"
|
||
msgstr "Ajoute des fichiers au projet"
|
||
|
||
#: lazarusidestrconsts.lisprojaddaddfiletoproject
|
||
msgid "Add file to project:"
|
||
msgstr "Ajouter un fichier au projet:"
|
||
|
||
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr "Dépendance déjà existante"
|
||
|
||
#: lazarusidestrconsts.lisprojaddeditorfile
|
||
msgid "Add editor files"
|
||
msgstr "Ajouter les fichiers de l'éditeur"
|
||
|
||
#: lazarusidestrconsts.lisprojaddfiles
|
||
msgid "Add files"
|
||
msgstr "Ajouter fichiers"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr "Version Min-Max non valide"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpackagename
|
||
msgid "Invalid packagename"
|
||
msgstr "Nom de paquet non valide"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
||
msgid "Invalid pascal unit name"
|
||
msgstr "Nom d'unité Pascal invalide"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr "Version non valide"
|
||
|
||
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr "Version max. (optionnel)"
|
||
|
||
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr "Version min. (optionnel) :"
|
||
|
||
#: lazarusidestrconsts.lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr "Nouvelle condition"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr "Nom du paquet :"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr "Paquet non trouvé"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
||
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
||
msgstr "La dépendance %s%s%s est introuvable.%sVeuillez choisir un paquet existant."
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La version maximale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "La version maximale est inférieure à la version minimale."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La version minimale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
||
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
||
msgstr "Le nom de paquet %s%s%s est invalide.%sVeuillez choisir un paquet existant."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package %s%s%s."
|
||
msgstr "Le projet a déjà une dépendance avec le paquet %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
||
msgstr "Le nom d'unité %s%s%s existe déjà dans le projet%savec le fichier: %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
||
msgstr "Le nom d'unité %s%s%s existe déjà dans la sélection%savec le fichier: %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Le nom de l'unité %s%s%s n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtoproject
|
||
#, fuzzy
|
||
#| msgid "Add to project"
|
||
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
||
msgid "Add to Project"
|
||
msgstr "Ajouter au projet"
|
||
|
||
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr "Nom d'unité déjà existant"
|
||
|
||
#: lazarusidestrconsts.lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr "Projet modifié"
|
||
|
||
#: lazarusidestrconsts.lisprojectchangedondisk
|
||
msgid "Project changed on disk"
|
||
msgstr "Le projet a changé sur le disque :"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectory
|
||
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Répertoire du projet"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
||
msgid "Title in taskbar shows also directory path of the project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr "Nom de fichier du projet"
|
||
|
||
#: lazarusidestrconsts.lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr "Chemin des 'Include' du projet"
|
||
|
||
#: lazarusidestrconsts.lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr "Fichier info du projet détecté"
|
||
|
||
#: lazarusidestrconsts.lisprojectinformation
|
||
#, fuzzy
|
||
#| msgid "Project Information"
|
||
msgid "Project information"
|
||
msgstr "Informations sur le projet"
|
||
|
||
#: lazarusidestrconsts.lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr "Le projet est exécutable"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr "Propriétés du projet macro"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacrounitpath
|
||
msgid "macro ProjectUnitPath"
|
||
msgstr "macro ProjectUnitPath"
|
||
|
||
#: lazarusidestrconsts.lisprojectoutdir
|
||
msgid "Project Output directory (e.g. the ppu directory)"
|
||
msgstr "Répertoire de sortie du projet(c'est à dire le répertoire des ppu)"
|
||
|
||
#: lazarusidestrconsts.lisprojectoutputdirectory
|
||
msgid "Project output directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectpath
|
||
msgid "Project Path:"
|
||
msgstr "Chemin du projet:"
|
||
|
||
#: lazarusidestrconsts.lisprojectpathhint
|
||
msgid "Directory where project's main file must be"
|
||
msgstr "Répertoire où le fichier principal du projet doit être"
|
||
|
||
#: lazarusidestrconsts.lisprojectsourcedirectories
|
||
msgid "Project source directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
||
msgid "%0:s%0:s At address %1:x"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
||
msgid "Project %s raised exception class '%s'."
|
||
msgstr "Le projet %s à levé une exception de class '%s'."
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
||
msgid "Project %s raised exception class '%s' with message:%s%s"
|
||
msgstr "Le projet %s à levé une classe d'exception '%s' avec le message:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
||
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
||
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
||
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr "Chemin des sources du projet"
|
||
|
||
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
|
||
#| msgid "Project %s%s%s successfully built. :)"
|
||
msgid "Project %s%s%s successfully built"
|
||
msgstr "Project %s%s%s créer avec succès"
|
||
|
||
#: lazarusidestrconsts.lisprojectunit
|
||
msgid "project unit"
|
||
msgstr "Unité du projet"
|
||
|
||
#: lazarusidestrconsts.lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr "Chemin des unités du projet"
|
||
|
||
#: lazarusidestrconsts.lisprojectwizard
|
||
msgid "Project Wizard"
|
||
msgstr "Assistant de projet"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr "Confirmer la suppression de la dépendance"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr "Confirmer le retrait du fichier"
|
||
|
||
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr "Supprimer la dépendance pour %s ?"
|
||
|
||
#: lazarusidestrconsts.lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr "Inspecteur de projet - %s"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
||
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
||
msgid "Removed required packages"
|
||
msgstr "Paquets requis retirés"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr "Retirer le fichier %s du projet ?"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr "Impossible de lire l'état du fichier %s du projet %s%sError : %s"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr "Impossible d'écrire l'état du fichier pour le projet %s%sError : %s"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr "Toujours créer(même si rien n'a changé)"
|
||
|
||
#: lazarusidestrconsts.lisprojoptserror
|
||
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
||
msgid "Error"
|
||
msgstr "Erreur"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr "Impossible de modifier la liste de création automatique des fiches dans le source du programme.%sVeuillez d'abord corriger les erreurs."
|
||
|
||
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr "Marque de répertoire source du projet"
|
||
|
||
#: lazarusidestrconsts.lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr "Demander la valeur"
|
||
|
||
#: lazarusidestrconsts.lisproperties
|
||
msgid "Properties (replace or remove)"
|
||
msgstr "Propriétés (remplacer ou supprimer)"
|
||
|
||
#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
|
||
msgid "Properties of conditional compiler option"
|
||
msgstr "Propriétés de l'option de compilation conditionnelle"
|
||
|
||
#: lazarusidestrconsts.lisprotected
|
||
msgid "Protected"
|
||
msgstr "Méthode protégée"
|
||
|
||
#: lazarusidestrconsts.lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr "Méthode protégée"
|
||
|
||
#: lazarusidestrconsts.lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr "Méthode publique"
|
||
|
||
#: lazarusidestrconsts.lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr "Méthode publiée"
|
||
|
||
#: lazarusidestrconsts.lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr "Répertoire de publication du projet"
|
||
|
||
#: lazarusidestrconsts.lispublishproject
|
||
msgid "Publish Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
||
#, fuzzy
|
||
#| msgid "Invalid Exclude filter"
|
||
msgid "Invalid exclude filter"
|
||
msgstr "Filtre d'exclusion non valide"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
||
#, fuzzy
|
||
#| msgid "Invalid Include filter"
|
||
msgid "Invalid include filter"
|
||
msgstr "Filtre d'inclusion non valide"
|
||
|
||
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
||
msgid "Save .lrs files in the output directory"
|
||
msgstr "Sauvegarder les fichiers. LRS dans le répertoire de sortie"
|
||
|
||
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Une unité Pascal doit avoir l'extension .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts.lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr "Éditer l'unité virtuelle"
|
||
|
||
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
||
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Il y a déjà une unité avec ce nom.%sFichier: %s"
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr "Le nom d'unité n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
#, fuzzy
|
||
#| msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
||
msgid "The unitname is used when the IDE extends uses clauses"
|
||
msgstr "Le nom d'unité est employé quand l'EDI prolonge les clauses uses."
|
||
|
||
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Le nom d'unité et de fichier ne doivent pas être identiques. %s Exemple: unit1.pas and Unit1"
|
||
|
||
#: lazarusidestrconsts.lispwconvertproject
|
||
msgid "Convert Delphi Project"
|
||
msgstr "Convertir un projet Delphi"
|
||
|
||
#: lazarusidestrconsts.lispwnewproject
|
||
msgid "New Project"
|
||
msgstr "Nouveau projet"
|
||
|
||
#: lazarusidestrconsts.lispwopenproject
|
||
msgid "Open Project"
|
||
msgstr "Ouvrir un projet"
|
||
|
||
#: lazarusidestrconsts.lispwopenrecentproject
|
||
#| msgid "Open Recent"
|
||
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
||
msgid "Open Recent Project"
|
||
msgstr "Ouvrir un projet récent"
|
||
|
||
#: lazarusidestrconsts.lispwviewexampleprojects
|
||
msgid "View Example Projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquickfixcreatelocalvariable
|
||
msgid "Create local variable"
|
||
msgstr "Créer une variable locale"
|
||
|
||
#: lazarusidestrconsts.lisquickfixes
|
||
msgid "Quick fixes"
|
||
msgstr " Solutions rapides"
|
||
|
||
#: lazarusidestrconsts.lisquickfixremoveunit
|
||
msgid "Quick fix: Remove unit"
|
||
msgstr "Solution rapide: Retirer l'unité"
|
||
|
||
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
||
msgid "Search identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquitlazarus
|
||
msgid "Quit Lazarus"
|
||
msgstr "Quitter Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisreaderror
|
||
msgid "Read Error"
|
||
msgstr "Erreur de lecture"
|
||
|
||
#: lazarusidestrconsts.lisrecordstruct
|
||
msgid "Record/Structure"
|
||
msgstr "Enregistrement/Structure"
|
||
|
||
#: lazarusidestrconsts.lisregisters
|
||
msgctxt "lazarusidestrconsts.lisregisters"
|
||
msgid "Registers"
|
||
msgstr "Registres"
|
||
|
||
#: lazarusidestrconsts.lisregistersdlgname
|
||
msgctxt "lazarusidestrconsts.lisregistersdlgname"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: lazarusidestrconsts.lisregistersdlgvalue
|
||
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: lazarusidestrconsts.lisregularexpression
|
||
msgid "Regular expression"
|
||
msgstr "Expression régulière"
|
||
|
||
#: lazarusidestrconsts.lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr "Chemins relatifs "
|
||
|
||
#: lazarusidestrconsts.lisremove
|
||
msgid "remove"
|
||
msgstr "Supprimer"
|
||
|
||
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr "Retirer toutes les propriétés non valides"
|
||
|
||
#: lazarusidestrconsts.lisremoveallunits
|
||
msgid "Remove all units"
|
||
msgstr "Retirer tous les unités"
|
||
|
||
#: lazarusidestrconsts.lisremovefrominstalllist
|
||
msgid "Remove from install list"
|
||
msgstr "Retirer de la liste d'installation"
|
||
|
||
#: lazarusidestrconsts.lisremovefromproject
|
||
#, fuzzy
|
||
#| msgid "Remove from project"
|
||
msgid "Remove from Project"
|
||
msgstr "Retirer du projet"
|
||
|
||
#: lazarusidestrconsts.lisremovefromsearchpath
|
||
msgid "Remove from search path"
|
||
msgstr "Supprimer du chemin de recherche"
|
||
|
||
#: lazarusidestrconsts.lisremoveincludepath
|
||
msgid "Remove include path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovelocalvariable
|
||
msgid "Remove local variable %s"
|
||
msgstr "Supprimer la variable locale %s"
|
||
|
||
#: lazarusidestrconsts.lisremovelocalvariable2
|
||
msgid "Remove local variable"
|
||
msgstr "Supprimer une variable locale"
|
||
|
||
#: lazarusidestrconsts.lisremovenonexistingfiles
|
||
msgid "Remove non existing files"
|
||
msgstr "Supprimer les fichiers qui n'existent pas"
|
||
|
||
#: lazarusidestrconsts.lisremoveselectedunits
|
||
msgid "Remove selected units"
|
||
msgstr "Retirer les unités sélectionnés"
|
||
|
||
#: lazarusidestrconsts.lisremovethem
|
||
msgid "Remove them"
|
||
msgstr "Les retirer"
|
||
|
||
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
||
msgid "Remove the paths from \"Other sources\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveunitfromusessection
|
||
msgid "Remove unit from uses section"
|
||
msgstr "Retirer l'unité de la section uses"
|
||
|
||
#: lazarusidestrconsts.lisremoveunitpath
|
||
msgid "Remove unit path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr "Renommer le fichier ?"
|
||
|
||
#: lazarusidestrconsts.lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr "Le changement du nom du fichier a échoué"
|
||
|
||
#: lazarusidestrconsts.lisrenameto
|
||
msgid "Rename to %s"
|
||
msgstr "Renommer en %s"
|
||
|
||
#: lazarusidestrconsts.lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr "Renommer en minuscules"
|
||
|
||
#: lazarusidestrconsts.lisreopenproject
|
||
msgid "Reopen project"
|
||
msgstr "Réouvrir le projet"
|
||
|
||
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
||
msgid "Reopen with another encoding"
|
||
msgstr "Rouvrir avec un autre encodage"
|
||
|
||
#: lazarusidestrconsts.lisrepeatcount
|
||
msgid "Repeat Count:"
|
||
msgstr "Nombre de répétitions :"
|
||
|
||
#: lazarusidestrconsts.lisreplacement
|
||
msgid "Replacement"
|
||
msgstr "Remplacement"
|
||
|
||
#: lazarusidestrconsts.lisreplacementfuncs
|
||
msgid "Replacement functions"
|
||
msgstr "Remplacement de fonctions"
|
||
|
||
#: lazarusidestrconsts.lisreplacements
|
||
msgid "Replacements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplaceremoveunknown
|
||
#, fuzzy
|
||
#| msgid "Replace unknown types and properties"
|
||
msgid "Fix unknown properties and types"
|
||
msgstr "Remplacer les types et les propriétées inconnus"
|
||
|
||
#: lazarusidestrconsts.lisreplacewholeidentifier
|
||
msgid "Replace whole identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr "Echec du remplacement de la sélection"
|
||
|
||
#: lazarusidestrconsts.lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/fr"
|
||
|
||
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
|
||
msgid "Requires FPC 2.4 or above. Like Delphi resources"
|
||
msgstr "Nécessite FPC 2.4 ou supérieur. Comme les ressources Delphi"
|
||
|
||
#: lazarusidestrconsts.lisrescan
|
||
msgid "Rescan"
|
||
msgstr "Nouveau balayage"
|
||
|
||
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
||
msgid "Reset all file filters to defaults?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresourceloaderror
|
||
msgid "Resource load error"
|
||
msgstr "Erreur de lecture de ressource"
|
||
|
||
#: lazarusidestrconsts.lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr "Erreur d'enregistrement de ressource"
|
||
|
||
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
||
#, fuzzy
|
||
#| msgid "Resource type of project:"
|
||
msgid "Resource type of project"
|
||
msgstr "Type de ressource du projet:"
|
||
|
||
#: lazarusidestrconsts.lisresponsecontinue
|
||
msgid "Response: %sContinue ?"
|
||
msgstr "Réponse:%sContinuer ?"
|
||
|
||
#: lazarusidestrconsts.lisresult
|
||
msgid "Result :="
|
||
msgstr "Résultat :="
|
||
|
||
#: lazarusidestrconsts.lisresult2
|
||
msgid "Result:"
|
||
msgstr "Résultat :"
|
||
|
||
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
||
msgid "returns list of all values of case variable in front of variable"
|
||
msgstr "Retourne la liste de toutes les valeurs de la variable case en face de la variable"
|
||
|
||
#: lazarusidestrconsts.lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr "Echec de la restauration"
|
||
|
||
#: lazarusidestrconsts.lisright
|
||
msgctxt "lazarusidestrconsts.lisright"
|
||
msgid "Right"
|
||
msgstr "Droite"
|
||
|
||
#: lazarusidestrconsts.lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr "Ancrage à droite"
|
||
|
||
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr "L'espace de bordure droit. Cette valeur est ajoutée à la base de l'espace de bordure et employée pour l'espace à droite du contrôle."
|
||
|
||
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
||
msgstr "C'est le contrôle à laquelle le côté droit est ancré. Laisser vide pour le parent."
|
||
|
||
#: lazarusidestrconsts.lisrightsides
|
||
msgid "Right sides"
|
||
msgstr "Côtés droits"
|
||
|
||
#: lazarusidestrconsts.lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr "Espacement droit égal"
|
||
|
||
#: lazarusidestrconsts.lisroot
|
||
msgid "Root"
|
||
msgstr "Racine"
|
||
|
||
#: lazarusidestrconsts.lisrunning
|
||
msgid "%s (running ...)"
|
||
msgstr "%s (running en cours d'exécution...)"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr "Fichier non exécutable"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application %s%s%s is not executable."
|
||
msgstr "L'application hôte %s%s%s n'est pas exécutable."
|
||
|
||
#: lazarusidestrconsts.lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr "Exécuter jusqu'à l'échec"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
||
#, fuzzy
|
||
#| msgid "Abstract methods - not yet overridden"
|
||
msgid "Abstract Methods - not yet overridden"
|
||
msgstr "Méthodes abstraites - pas encore surchargées"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsof
|
||
msgid "Abstract methods of %s"
|
||
msgstr "Méthodes abstraites de %s"
|
||
|
||
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr "Curseur n'est pas dans une déclaration de classe"
|
||
|
||
#: lazarusidestrconsts.lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr "L'EDI est occupé"
|
||
|
||
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr "%s est une classe abstraite, elle a %s méthodes abstraites."
|
||
|
||
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr "Aucune méthode abstraite trouvée"
|
||
|
||
#: lazarusidestrconsts.lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr "Écraser la selection"
|
||
|
||
#: lazarusidestrconsts.lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr "Écraser la première selection"
|
||
|
||
#: lazarusidestrconsts.lissamselectnone
|
||
msgid "Select none"
|
||
msgstr "Aucune sélection"
|
||
|
||
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr "Il y a %s méthodes abstraites à redéfinir. %sSélectionnez les méthodes pour lesquelles des souches doivent être créés :"
|
||
|
||
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr "Il n'existe pas de méthodes abstraites restantes à redéfinir."
|
||
|
||
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr "Cette méthode ne peut pas être surchargée car elle est définie dans la classe courante"
|
||
|
||
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr "Impossible de montrer les méthodes abstraites de la classe courante, parce que"
|
||
|
||
#: lazarusidestrconsts.lissave
|
||
msgid "Save ..."
|
||
msgstr "Enregistrer ..."
|
||
|
||
#: lazarusidestrconsts.lissaveallmessagestofile
|
||
#, fuzzy
|
||
#| msgid "Save all messages to file"
|
||
msgid "Save All Messages to File"
|
||
msgstr "Enregistrer tous les messages dans un fichier"
|
||
|
||
#: lazarusidestrconsts.lissaveallmodified
|
||
#, fuzzy
|
||
#| msgid "save all modified files"
|
||
msgid "Save all modified files"
|
||
msgstr "Enregistrer tous les fichiers modifiés"
|
||
|
||
#: lazarusidestrconsts.lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr "Enregistrer et quitter le dialogue"
|
||
|
||
#: lazarusidestrconsts.lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr "Enregistrer et recréer l'EDI"
|
||
|
||
#: lazarusidestrconsts.lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "Enregistrer les modifications ?"
|
||
|
||
#: lazarusidestrconsts.lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr "Enregistrer les modifications du projet %s ?"
|
||
|
||
#: lazarusidestrconsts.lissavecurrenteditorfile
|
||
#, fuzzy
|
||
#| msgid "save current editor file"
|
||
msgid "Save current editor file"
|
||
msgstr "Enregistrer le fichier courant"
|
||
|
||
#: lazarusidestrconsts.lissavedsuccessfully
|
||
msgid "Saved successfully"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr "Enregistrer les infos de l'éditeur sauf pour les fichiers projet"
|
||
|
||
#: lazarusidestrconsts.lissavefileas
|
||
msgid "Save file as"
|
||
msgstr "Enregistrer le fichier sous"
|
||
|
||
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
||
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
||
msgstr "Enregistrer le fichier %s%s%s%savant de fermer la fiche %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr "Enregistrer les infos de l'éditeur pour les fichiers fermés"
|
||
|
||
#: lazarusidestrconsts.lissaveproject
|
||
msgid "Save project %s (*%s)"
|
||
msgstr "Enregistrer le projet %s (*%s)"
|
||
|
||
#: lazarusidestrconsts.lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "Enregistrer les paramêtres"
|
||
|
||
#: lazarusidestrconsts.lissavespace
|
||
msgid "Save "
|
||
msgstr "Enregistrer "
|
||
|
||
#: lazarusidestrconsts.lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr "Facteur d'ajustement:"
|
||
|
||
#: lazarusidestrconsts.lissearchfor
|
||
msgid "Search For "
|
||
msgstr "Rechercher "
|
||
|
||
#: lazarusidestrconsts.lissearchprojectsfrom
|
||
msgid "Search projects from"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissearchunit
|
||
msgid "Search unit"
|
||
msgstr " Recherche d'unité"
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr "Deuxième répertoire de configuration, là où Lazarus recherche ses fichiers modèles de configuration. Par défaut c'est"
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigpath
|
||
msgid "Secondary config path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisseemessages
|
||
msgid "See messages."
|
||
msgstr "Voir les messages."
|
||
|
||
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr "%sVoir Projet -> Inspecteur de Projet"
|
||
|
||
#: lazarusidestrconsts.lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr "Choisir un élément d'aide:"
|
||
|
||
#: lazarusidestrconsts.lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "Choisir un noeud"
|
||
|
||
#: lazarusidestrconsts.lisselectanotherlclwidgetsetmacrolclwidgettype
|
||
msgid "Select another LCL widget set (macro LCLWidgetType)"
|
||
msgstr "Sélectionne un autre jeux de gadget LCL (macro LCLWidgetType)"
|
||
|
||
#: lazarusidestrconsts.lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr "Sélectionner les fiches Delphi (*.dfm)"
|
||
|
||
#: lazarusidestrconsts.lisselected
|
||
msgctxt "lazarusidestrconsts.lisselected"
|
||
msgid "Selected"
|
||
msgstr "sélectionné"
|
||
|
||
#: lazarusidestrconsts.lisselectedbottomneighbour
|
||
msgid "(selected bottom neighbour)"
|
||
msgstr "(Voisin du bas sélectionnée)"
|
||
|
||
#: lazarusidestrconsts.lisselectedleftneighbour
|
||
msgid "(selected left neighbour)"
|
||
msgstr "(Voisin de gauche sélectionné)"
|
||
|
||
#: lazarusidestrconsts.lisselectedrightneighbour
|
||
msgid "(selected right neighbour)"
|
||
msgstr "(Voisin de droite sélectionné)"
|
||
|
||
#: lazarusidestrconsts.lisselectedtopneighbour
|
||
msgid "(selected top neighbour)"
|
||
msgstr "(Voisin du haut sélectionné )"
|
||
|
||
#: lazarusidestrconsts.lisselectfile
|
||
msgid "Select the file"
|
||
msgstr "Sélectionner le fichier"
|
||
|
||
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
||
msgid "Select FPC source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr "La sélection dépasse la taille de constante chaîne"
|
||
|
||
#: lazarusidestrconsts.lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr "Sélection d'outils"
|
||
|
||
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
||
msgid "Select Lazarus source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectpathof
|
||
msgid "Select path of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectpathto
|
||
msgid "Select path to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselecttheactivebuildmode
|
||
msgid "Select the active build mode"
|
||
msgstr "sélectionne le mode contruire actif"
|
||
|
||
#: lazarusidestrconsts.lissetdefault
|
||
msgid "Set default"
|
||
msgstr "Valeur par défaut"
|
||
|
||
#: lazarusidestrconsts.lissetmacrovalues
|
||
msgid "Set macro values"
|
||
msgstr "Fixer les valeurs de macro"
|
||
|
||
#: lazarusidestrconsts.lissetupdefaultindentation
|
||
msgid "(Setup default indentation)"
|
||
msgstr "(paramètre l'indentation par défaut)"
|
||
|
||
#: lazarusidestrconsts.lissetvalue
|
||
msgid "Set value"
|
||
msgstr "Fixer la valeur"
|
||
|
||
#: lazarusidestrconsts.lisshort
|
||
msgid "Short:"
|
||
msgstr "Court :"
|
||
|
||
#: lazarusidestrconsts.lisshow
|
||
msgid "Show"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowdeclarationhints
|
||
msgid "Show declaration hints"
|
||
msgstr " Montre les conseils de déclaration"
|
||
|
||
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
||
msgid "Show differences between modes ..."
|
||
msgstr "Voir les différences entre les modes ..."
|
||
|
||
#: lazarusidestrconsts.lisshowemptyunitspackages
|
||
msgid "Show empty units/packages"
|
||
msgstr "Montre les unités/paquets vides"
|
||
|
||
#: lazarusidestrconsts.lisshowglyphsfor
|
||
msgid "Show Glyphs for:"
|
||
msgstr "Montre les glyphes pour:"
|
||
|
||
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
||
msgid "Show gutter"
|
||
msgstr "Afficher la gouttière"
|
||
|
||
#: lazarusidestrconsts.lisshowhelp
|
||
msgid "Show help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
||
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
||
msgid "Show hints"
|
||
msgstr "Afficher les conseils dans l'inspecteur d'objet"
|
||
|
||
#: lazarusidestrconsts.lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr "Afficher les marques"
|
||
|
||
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
||
msgid "Show information box"
|
||
msgstr "Afficher la boîte d'information"
|
||
|
||
#: lazarusidestrconsts.lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr "Afficher les paquets"
|
||
|
||
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
||
msgid "Show position of source editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
||
msgid "Show setup dialog for most important settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowspecialcharacters
|
||
msgid "Show special characters"
|
||
msgstr "Afficher les caractères spéciaux"
|
||
|
||
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
||
msgid "Show status bar"
|
||
msgstr "Afficher la barre d'état"
|
||
|
||
#: lazarusidestrconsts.lisshowunits
|
||
msgid "Show units"
|
||
msgstr "Afficher les unités"
|
||
|
||
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
||
msgid "Show value hints while debugging"
|
||
msgstr "Montrez les conseils de valeur pendant de debogage"
|
||
|
||
#: lazarusidestrconsts.lisshowversionandexit
|
||
msgid "show version and exit"
|
||
msgstr "Afficher la version et sortir"
|
||
|
||
#: lazarusidestrconsts.lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr "Réduction au plus petit"
|
||
|
||
#: lazarusidestrconsts.lissibling
|
||
msgid "Sibling"
|
||
msgstr "Contrôle"
|
||
|
||
#: lazarusidestrconsts.lissimplesyntax
|
||
#, fuzzy
|
||
#| msgid "Simple Syntax"
|
||
msgid "Simple syntax"
|
||
msgstr "Syntaxe simple"
|
||
|
||
#: lazarusidestrconsts.lisskiperrors
|
||
msgid "Skip errors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisskipfile
|
||
msgid "Skip file"
|
||
msgstr "Ignorer le fichier"
|
||
|
||
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr "Passer le fichier et continuer le chargement"
|
||
|
||
#: lazarusidestrconsts.lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr "Passer le chargement du dernier projet"
|
||
|
||
#: lazarusidestrconsts.lissmallerratherthanfaster
|
||
msgid "smaller rather than faster"
|
||
msgstr "Petit plutôt que rapide"
|
||
|
||
#: lazarusidestrconsts.lissmatches
|
||
msgid "Matches"
|
||
msgstr "Correspondances"
|
||
|
||
#: lazarusidestrconsts.lissorrynotimplementedyet
|
||
msgid "Sorry, not implemented yet"
|
||
msgstr "Désolé, non implémenté à ce jour"
|
||
|
||
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr "Désolé, ce type n'est pas encore implémenté"
|
||
|
||
#: lazarusidestrconsts.lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "Croissant"
|
||
|
||
#: lazarusidestrconsts.lissortselcancel
|
||
msgctxt "lazarusidestrconsts.lissortselcancel"
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: lazarusidestrconsts.lissortselcasesensitive
|
||
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
||
msgid "&Case Sensitive"
|
||
msgstr "&Sensible à la casse"
|
||
|
||
#: lazarusidestrconsts.lissortseldescending
|
||
msgid "Descending"
|
||
msgstr "Décroissant"
|
||
|
||
#: lazarusidestrconsts.lissortseldomain
|
||
msgid "Domain"
|
||
msgstr "Domaine"
|
||
|
||
#: lazarusidestrconsts.lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr "Ignorer les espaces"
|
||
|
||
#: lazarusidestrconsts.lissortsellines
|
||
msgid "Lines"
|
||
msgstr "Lignes"
|
||
|
||
#: lazarusidestrconsts.lissortseloptions
|
||
msgctxt "lazarusidestrconsts.lissortseloptions"
|
||
msgid "Options"
|
||
msgstr "Options"
|
||
|
||
#: lazarusidestrconsts.lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr "Paragraphes"
|
||
|
||
#: lazarusidestrconsts.lissortselpreview
|
||
msgctxt "lazarusidestrconsts.lissortselpreview"
|
||
msgid "Preview"
|
||
msgstr "Aperçu"
|
||
|
||
#: lazarusidestrconsts.lissortselsort
|
||
msgid "Accept"
|
||
msgstr "Accepter"
|
||
|
||
#: lazarusidestrconsts.lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr "Trier la sélection"
|
||
|
||
#: lazarusidestrconsts.lissortselwords
|
||
msgctxt "lazarusidestrconsts.lissortselwords"
|
||
msgid "Words"
|
||
msgstr "Mots"
|
||
|
||
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr "La source et la destination sont identiques:%s%s"
|
||
|
||
#: lazarusidestrconsts.lissourcebreakpoint
|
||
#, fuzzy
|
||
#| msgid "&Source Breakpoint..."
|
||
msgid "&Source Breakpoint ..."
|
||
msgstr "Point d'arrêt &source"
|
||
|
||
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
||
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
||
msgstr "Le répertoire source %s%s%s%s et le répertoire de destination %s%s%s% sont les mêmes.%s%s Vous avez peut-être mal conpris cette fonctionnalité.%s Elle nettoie/recrée le répertoire de destination%s et y copie le paquet/projet."
|
||
|
||
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
||
msgid "Source directory %s%s%s does not exist."
|
||
msgstr "Le dossier source %s%s%s n'existe pas."
|
||
|
||
#: lazarusidestrconsts.lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr "Source modifié"
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
||
msgid "Source of page %s%s%s has changed. Save?"
|
||
msgstr "Le source de la page %s%s%s a changé. L'enregistrer ?"
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
|
||
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
|
||
msgstr "Les sources de plus d'une page ont changée. Enregistrer la page %s%s%s? (%d plus)"
|
||
|
||
#: lazarusidestrconsts.lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr "Chemins des sources"
|
||
|
||
#: lazarusidestrconsts.lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr "Espacement régulier"
|
||
|
||
#: lazarusidestrconsts.lissrcos
|
||
msgid "Src OS"
|
||
msgstr "OS source"
|
||
|
||
#: lazarusidestrconsts.lisssearching
|
||
msgid "Searching"
|
||
msgstr "Recherche"
|
||
|
||
#: lazarusidestrconsts.lisssearchtext
|
||
msgid "Search text"
|
||
msgstr "Texte à rechercher"
|
||
|
||
#: lazarusidestrconsts.lisstartconversion
|
||
msgid "Start Conversion"
|
||
msgstr "Démarre la conversion"
|
||
|
||
#: lazarusidestrconsts.lisstartide
|
||
msgid "Start IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr "Démarrer avec un nouveau projet"
|
||
|
||
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr "Arrêter le débogage courant et recréer le projet ?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr "Arrêt du déboguage ?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr "Arrêter le débogage ?"
|
||
|
||
#: lazarusidestrconsts.lisstoponexception
|
||
msgid "Stop on exception"
|
||
msgstr "Arrêt sur exception"
|
||
|
||
#: lazarusidestrconsts.lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr "Arrêt du déboguage ?"
|
||
|
||
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
||
msgid "Store path delimiters \\ and / as"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstrangelpifile
|
||
msgid "Strange lpi file"
|
||
msgstr "Fichier .lpi étrange"
|
||
|
||
#: lazarusidestrconsts.lisstreamerror
|
||
msgid "Stream Error"
|
||
msgstr "Erreur de Stream"
|
||
|
||
#: lazarusidestrconsts.lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr "Erreur de flux"
|
||
|
||
#: lazarusidestrconsts.lisstring
|
||
msgid "String"
|
||
msgstr "Chaîne"
|
||
|
||
#: lazarusidestrconsts.lisstyle
|
||
msgctxt "lazarusidestrconsts.lisstyle"
|
||
msgid "Style"
|
||
msgstr "Style"
|
||
|
||
#: lazarusidestrconsts.lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr "Sous-procédure"
|
||
|
||
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr "Sous-procédure de même niveau"
|
||
|
||
#: lazarusidestrconsts.lissuccess
|
||
msgid "Success"
|
||
msgstr "Succès"
|
||
|
||
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
||
msgid "Suggest default name of new file in lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissuspiciousincludepath
|
||
msgid "Suspicious include path"
|
||
msgstr "chemin include suspect"
|
||
|
||
#: lazarusidestrconsts.lissuspiciousunitpath
|
||
msgid "Suspicious unit path"
|
||
msgstr "chemin unit suspect"
|
||
|
||
#: lazarusidestrconsts.lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr "Révision SVN:"
|
||
|
||
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr "Nom de variable non valide"
|
||
|
||
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
||
msgid "%s%s%s is not a valid identifier."
|
||
msgstr "%s%s%s n'est pas un identificateur valide."
|
||
|
||
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr "Surcharger une variable système"
|
||
|
||
#: lazarusidestrconsts.lissyntaxmode
|
||
msgid "Syntax mode"
|
||
msgstr "Mode syntaxe"
|
||
|
||
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
||
msgid "system.ppu not found. Check your fpc.cfg."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listab
|
||
msgid "Tab"
|
||
msgstr "Tab"
|
||
|
||
#: lazarusidestrconsts.listaborderconfirmsort
|
||
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderdownhint
|
||
msgid "Move the selected control down in tab order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderof
|
||
#, fuzzy
|
||
#| msgid "Tab Order of"
|
||
msgid "Tab Order of %s"
|
||
msgstr "Odre de tabulation de"
|
||
|
||
#: lazarusidestrconsts.listabordersorthint
|
||
msgid "Calculate the tab order of controls by their X- and Y- positions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listaborderuphint
|
||
msgid "Move the selected control up in tab order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listakesnapshot
|
||
msgid "Take a Snapshot"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr "CPU de destination"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
||
msgid "Target file name: (-o, empty = use unit output directory)"
|
||
msgstr "Nom de fichier cible: (-o, vide = utilise le répertoire de sortie de l'unité)"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameo
|
||
msgid "Target file name (-o):"
|
||
msgstr "Nom de fichier cible (-o):"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr "Fichier de destination du projet"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr "Nom du fichier de destination + paramètres"
|
||
|
||
#: lazarusidestrconsts.listargetos
|
||
msgctxt "lazarusidestrconsts.listargetos"
|
||
msgid "Target OS"
|
||
msgstr "OS de destination"
|
||
|
||
#: lazarusidestrconsts.listcompilerinternalerror
|
||
msgid "Internal compiler error! (%d)"
|
||
msgstr "Erreur interne du compilateur ! (%d)"
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcell
|
||
msgid "Editable Cell"
|
||
msgstr ":"
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
||
msgid ""
|
||
"Inserts an editable Cell, with a default value\n"
|
||
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
|
||
"\"default\",Sync, to Sync with a previous cell of equal default\n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listestdirectory
|
||
msgid "Test directory"
|
||
msgstr "Répertoire de test"
|
||
|
||
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
||
msgid "The Application Bundle was created for \"%s\""
|
||
msgstr "Le paquetage de l'application a été créé pour \"%s\""
|
||
|
||
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
||
msgstr "La classe %s%s%s est un TControl et ne peut pas être collée ailleurs que dans un contrôle.%sCollage imposible."
|
||
|
||
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
||
msgid "The codetools found an error:%s%s%s"
|
||
msgstr "L'outil de code a décelé une erreur:% s% s% s"
|
||
|
||
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
||
msgid "The command after %s%s%s is not executable."
|
||
msgstr "La commande suivant %s%s%s n'est pas exécutable."
|
||
|
||
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s%s%s%s"
|
||
msgstr "La commande après publication est non valide:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
||
msgid "The component %s can not be deleted, because it is not owned by %s."
|
||
msgstr "Le composant %s ne peut être supprimé, car il n'est pas détenu par %s."
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
||
msgstr "L'éditeur de composants de la classe %s%s%s a provoqué l'erreur:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
||
msgstr "L'éditeur de composants de la classe %s%s%s%sappelé avec le verbe #%s %s%s%s%s a provoqué l'erreur:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
||
msgstr "Le composant %s est hérité de%s.%sPour supprimer un composant hérité ouvrir l'ancêtre et supprimez-le."
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
||
msgstr "Le composant %s est hérité de%s.%sPour renommer un composant hérité ouvrir l'ancêtre et renommez le là."
|
||
|
||
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
||
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
||
msgid "The %s contains a not existing directory:%s%s"
|
||
msgstr "Le %s contient un répertoire non existant:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
||
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
|
||
#, fuzzy
|
||
#| msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
|
||
msgstr "Le nom de fichier courant du compilateur %s%s%s%sn'est pas un exécutable valide. Choisissez OK pour revenir à la valeur par défaut %s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
|
||
#, fuzzy
|
||
#| msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Tools -> Options -> Files"
|
||
msgstr "Le nom de fichier courant du compilateur %s%s%s%sn'est pas un exécutable valide.%sVeuillez vérifier dans Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
||
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
||
msgstr "Le FPC en cours n'a pas de fichier de configuration. Il va probablement manquer quelques unités. Vérifiez votre installation de fpc."
|
||
|
||
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
||
#, fuzzy
|
||
#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
|
||
msgstr "Le répertoire courant des sources Free Pascal %s%s%s%sne semble pas correct.%sChoisissez OK pour revenir à la valeur par défaut%s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers"
|
||
|
||
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
||
#, fuzzy
|
||
#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Tools -> Options -> Files"
|
||
msgstr "Le répertoire courant de Free Pascal %s%s%s%sne semble pas correct.%sVérifiez Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
||
#, fuzzy
|
||
#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
|
||
msgstr "Le répertoire courant de Lazarus %s%s%s%sne semble pas correct.%Sans lui, vous ne pourrez pas créer d'applications LCL.%sChoisissez OK pour revenir à la valeur par défaut %s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
||
#, fuzzy
|
||
#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Tools -> Options -> Files"
|
||
msgstr "Le répertoire courant de Lazarus %s%s%s%sne semble pas correct.%Sans lui, vous ne pourrez pas créer d'applications LCL.%sVérifiez Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
#, fuzzy
|
||
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
||
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
|
||
msgstr "Le débogueur %s%s%sn'existe pas ou n'est pas exécutable. %s%sVoir Environnement -> Options du Débogueur"
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s%s%s%s does not exist."
|
||
msgstr "Le répertoire de destination %s%s%s%s n'existe pas."
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
||
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
||
msgstr "Le répertoire de destination %s%s%s n'existe pas.%sVeuillez vérifier le nom de fichier du projet Menu>Projet>Options du projet."
|
||
|
||
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
||
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
||
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
||
msgstr "Le répertoire %s%s%s n'est plus requis dans le chemin d'unité. %sL'enlever ?"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
||
msgid "The directory %s%s%s is not writable."
|
||
msgstr "Le répertoire %s%s%s n'est pas accessible en écriture."
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
||
msgstr "Le répertoire %s%s%s n'est pas encore dans le chemin d'unité .%sL'ajouter ?"
|
||
|
||
#: lazarusidestrconsts.listhedirectorywasnotfound
|
||
msgid "The directory %s was not found."
|
||
msgstr "Répertoire %s non trouvé"
|
||
|
||
#: lazarusidestrconsts.listhefile
|
||
msgid "The file %s%s%s"
|
||
msgstr "Le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
||
msgid "The file %s does not look like a lpi file."
|
||
msgstr "Le fichier %s ne resemble pas à un fichier lpi"
|
||
|
||
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
||
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
||
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
||
msgstr "Le fichier %s%s%s est un lien symbolique.%s%sOuvrir %s%s%s à la place ?"
|
||
|
||
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
||
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
|
||
msgstr "Le fichier%s%s%s n'est pas un projet Lazarus.%sCreer un nouveau projet pour ce %s?"
|
||
|
||
#: lazarusidestrconsts.listhefilemaskisinvalid
|
||
msgid "The file mask \"%s\" is invalid."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
||
msgid "The file mask \"%s\" is not a valid regular expression."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr "Le fichier %s%s%s%ssemble être un programme. Fermer le projet en cours et créer un nouveau projet Lazarus pour ce programme?%s'Non' chargera le fichier comme un fichier source normal."
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
||
msgstr "Le fichier %s semble être le fichier programme d'un projet Lazarus existant."
|
||
|
||
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
||
msgstr "Le fichier %s%s%s%s a été trouvé dans l'un des répertoires source du paquet %s et ressemble à une unité compiler. les unités compilées doive être dans le répertoire de sortie du paquet, sinon d'autres paquets peuvent avoir des difficultés à utiliser ce paquet.%s%s Supprimer le fichier ambigu ?"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
||
msgstr "Le fichier %s%s%s%s n'a pas été trouvé.%sSouhaitez-vous le rechercher manuellement ?%s"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr "Le fichier %s%s%s%s est introuvable.%sIgnorer continuera à charger le projet;%sAbandonner arrêtera le chargement."
|
||
|
||
#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
|
||
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
|
||
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
|
||
msgstr "Le premier mode de création est le mode par défaut et doit être stockés dans le projet, pas dans la session."
|
||
|
||
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
||
msgstr "Les méthodes suivantes employées par %s ne sont pas dans la source %s%s%s%s%s%sEnlever les références pendantes ?"
|
||
|
||
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
||
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
||
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
||
msgstr "The compilateur Free Pascal (nom de fichier: %s) est introuvable.%sIl est recommandé que vous installiez FPC."
|
||
|
||
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
||
#, fuzzy
|
||
#| msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
||
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sTools -> Options -> Files"
|
||
msgstr "The répertoire source Free Pascal est introuvable.%sQuelques fonctions de code ne fonctionneront pas.%sIl est recommandé que vous l'installiez et définissiez le chemin%Configuration->Options d'environnement->Fichiers"
|
||
|
||
#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
|
||
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
||
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
||
msgstr "L'identificateur est une unité. S'il vous plaît utilisez la commande Fichier - Enregistrer afin de renommer une unité."
|
||
|
||
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
||
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
|
||
msgstr "La touche %s%s est déjà attribué à %s.%s%s Retirez l'ancienne affectation et affecter la touche à la nouvelle fonction %s%s ?"
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
||
msgstr "Le Bundle Application %s%s nécessaire à l'exécution n'existe pas ou n'est pas exécutable.%s Voulez-vous en créer un ? %s%s Voir Project->Options du Project...->Paramètres de l'application."
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
||
msgstr "L'application à démarrer %s%s%s%sn'existe pas ou n'est pas exécutable.%s%sVoir Exécuter -> Paramètres d'exécution -> Local"
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
||
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
||
#, fuzzy
|
||
#| msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
||
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Tools -> Options -> Files"
|
||
msgstr "Le répertoire de Lazarus est introuvable.%sVous ne pourrez pas créer d'application LCL.%sVeuillez vérifier l'environnement dans Configuration->Options d'environnement->Fichiers"
|
||
|
||
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
||
msgstr "Le fichier LFM (Lazarus form) contient des propriétés invalides. Cela veut dire qu'il contient des propriétés/classes qui n'existent pas dans la LCL actuelle. L'action recommandée est de retirer ces propriétés du LFM et de corriger le code Pascal manuellement."
|
||
|
||
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
||
msgid "The macro \"%s\" does not begin with \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
|
||
msgid "The name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Le nom %s%s%s n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
||
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgstr "La nouvelle unité n'est pas encore dans le chemin recherche des unités. %s Ajouter le répertoire %s ?"
|
||
|
||
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
||
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
||
msgid "The output directory %s%s%s is missing."
|
||
msgstr "Le répertoire de sortie %s%s%s est absent."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
||
msgid "The output directory of %s is listed in the include search path of %s."
|
||
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche inclusion de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
||
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
||
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche d'inclusion hérité de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
||
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
||
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche d'unité héritée de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
||
msgid "The output directory of %s is listed in the unit search path of %s."
|
||
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche unité de %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
||
msgid " The output directory should be a separate directory and not contain any source files."
|
||
msgstr " Le répertoire de sortie devrait être un répertoire séparé et ne contenir aucun fichier source."
|
||
|
||
#: lazarusidestrconsts.listheownerclasshasthisname
|
||
msgid "The owner class has this name"
|
||
msgstr "La classe propriétaire a ce nom"
|
||
|
||
#: lazarusidestrconsts.listheownerhasthisname
|
||
msgid "The owner has this name"
|
||
msgstr "Le propriétaire a ce nom"
|
||
|
||
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
||
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
||
msgstr "Le paquet %s ajoute le chemin \"%s\" au chemin include de l'IDE.%sC'est probablement une mauvaise configuration du paquet"
|
||
|
||
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
||
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
||
msgstr "Le paquet %s ajoute le chemin \"%s\" au chemin unit de l'IDE.%sC'est probablement une mauvaise configuration du paquet"
|
||
|
||
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr "Le paquet contient déjà une unité avec ce nom."
|
||
|
||
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
||
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
|
||
msgstr "Le paquet %s ne peut pas être désinstallé, car il est nécessaire pour l'IDE lui-même."
|
||
|
||
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
||
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
||
msgstr "Le paquet %s n'a aucune procédure \"Register\" , ce qui signifie typiquement, il ne fournit aucun addon à l' IDE. L'installer va probablement augmenter la taille de l'IDE et pourrait même le rendre instable.%s%sAstuce: Si vous voulez utiliser un paquet dans votre projet, utilisez l'item du menu intitulé \"Add to project\"."
|
||
|
||
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
||
msgstr "Le programme %smake%s est introuvable.%sCet outil est nécessaire pour créer Lazarus.%s"
|
||
|
||
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
||
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
||
msgstr "Le option de compilation du projet et les directives de la source principale diffèrent. Pour la nouvelle unité le mode et le type de chaine de carractère des options du projet sont utilisées:"
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
||
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
|
||
msgstr "Le projet n'utilise pas les interfaces de l'unité LCL, mais il semble qu'il en a besoin.%sVous obtiendrez des erreurs étranges avec l'éditeur de liens si vous utilisez les fiches LCL sans interfaces"
|
||
|
||
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
||
msgid "The project has no main source file."
|
||
msgstr "Le projet n'a pas de fichier source principal"
|
||
|
||
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
||
msgstr "Le fichier d'information projet %s%s%s%sest identique au fichier principal du source!"
|
||
|
||
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
||
msgid "The project information file %s%s%s%shas changed on disk."
|
||
msgstr "Le fichier d'information du projet %s%s%s%a changé sur le disque."
|
||
|
||
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
#, fuzzy
|
||
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr "Le projet doit être enregistré avant d'être construit%sSi vous définissez un répertoire de test dans les options d'environnement,%svous pourrez créer de nouveaux projets et les créer aussitôt.%sEnregistrer le projet ?"
|
||
|
||
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
||
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
||
msgstr "Le projet utilise l'OS cible=%s et le CPU=%s.%sLe fichier system.ppu pour cette cible n'a pas été trouvé dans les répertoires des executables FPC. %sAssurez-vous que FPC est correctement installé pour cette cible et que le fichier fpc.cfg contient les bons répertoires."
|
||
|
||
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
|
||
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
|
||
msgstr "Le projet utilise les nouvelles ressources de FPC, ce qui nécessite au moins la version 2.4 de FPC"
|
||
|
||
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr "D'autres fichiers dans le répertoire portant le même nom,%sne différent que par la casse:%s%s%sLes effacer ?"
|
||
|
||
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
||
msgstr "Un fichier porte le même nom et une extension similaire%sFichier: %s%sFichier litigieux: %s%s%sEffacer le fichier litigieux ?"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
||
msgid "There is already a component with this name"
|
||
msgstr "Il y a déjà un composant avec ce nom"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name %s%s%s"
|
||
msgstr "Il y a déjà une fiche avec le nom %s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
||
msgid "There is already a macro with the name %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
||
msgid "There is already an IDE macro with the name \"%s\""
|
||
msgstr "Il y a déjà une macro de l'IDE avec le nom \"%s\""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "Une autre unité porte déjà le nom %s%s%s. Les identificateurs Pascal doivent être uniques."
|
||
|
||
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
||
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
||
msgstr "Une unité du projet porte déjà le nom %s%s%s.%sVeuillez choisir un nom différent."
|
||
|
||
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
||
msgid "There must be at least one build mode."
|
||
msgstr "Il doit y avoir au moins un mode de création"
|
||
|
||
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
||
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
||
msgstr "La classe de ressource %s%s%s descend de %s%s%s. C'est probablement une typo pour TForm."
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr "Il y a eu une erreur lors de l'écriture du composant sélectionné %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr "Il y a eu une erreur lors de la conversion du flux binaire du composant sélectionné %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr "Il y a eu une erreur lors de la copie du flux du composant vers le presse-papiers:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
||
msgid "The root component can not be deleted."
|
||
msgstr "Le composant racine ne peut être supprimé."
|
||
|
||
#: lazarusidestrconsts.listhesefileswillbedeleted
|
||
msgid "These files will be deleted"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
||
msgid "These settings are stored with the project."
|
||
msgstr "Ces paramètres sont enregistrés avec le projet."
|
||
|
||
#: lazarusidestrconsts.listheseunitswerenotfound
|
||
msgid "These units were not found:"
|
||
msgstr "Ces unités n'ont pas été trouvés:"
|
||
|
||
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
||
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
||
msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
|
||
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
||
msgstr "L'unité %s%s%s existe déjà %sIgnorer forcera un changement de nom;%sAnnuler annulera l'enregistrement de ce source et%sArrêter interrompra toute l'opération de sauvegarde."
|
||
|
||
#: lazarusidestrconsts.listheunitbelongstopackage
|
||
msgid "The unit belongs to package %s."
|
||
msgstr "L'unité appartient au paquet %s."
|
||
|
||
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr "L'unité %s existe deux fois dans le chemin des unités %s :"
|
||
|
||
#: lazarusidestrconsts.listheunithasthisname
|
||
msgid "The unit has this name"
|
||
msgstr "L'unité a ce nom"
|
||
|
||
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
||
#, fuzzy
|
||
#| msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
|
||
msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
|
||
msgstr "Le nom de l'unité %s%s%s n'est pas en minuscules.%sLe compilateur FreePascal ne recherche pas dans tous les cas. Il est recommandé d'utiliser un nom de fichier en minuscules.%s%s Renommer le fichier en minuscules ?"
|
||
|
||
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
||
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
||
msgstr "L'unité %s est utilisé par d'autres fichiers.%sMettre à jour les références automatiquement?"
|
||
|
||
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "L'unité a déjà le nom %s%s%s. Les identificateurs Pascal doivent être uniques."
|
||
|
||
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
||
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
||
msgstr "Le chemin de recherche d'unité %s%s%s contient le répertoire des sources %s%s%s du paquet %s"
|
||
|
||
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
||
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
||
msgstr "Le répertoire de travail %s%s%s n'existe pas.%sVeuillez vérifier le répertoire de travail dans le Menu>Exécuter>Configurer construire."
|
||
|
||
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
||
msgid "This function needs an open .lfm file in the source editor."
|
||
msgstr "Cette fonction nécessite une ouverture du fichier. lfm dans l'éditeur de source."
|
||
|
||
#: lazarusidestrconsts.listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr "ce message d'aide"
|
||
|
||
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr "Ceci ressemble à un fichier Pascal.%sIl est recommandé d'employer des noms de fichier en minuscules, pour éviter divers problèmes sur certains systèmes de fichiers et différents compilateurs.%sRenommer en lettres minuscules?"
|
||
|
||
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
||
msgid "This project has no main source file"
|
||
msgstr "Le projet na pas de fichier source principal"
|
||
|
||
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
||
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
||
msgstr "Le jeux des options pour construire Lazarus n'est pas supporté par cette installation.%sLe répertoire %s%s%s n'est pas inscriptible.%sVoir le site Lazarus pour d'autres façons d'installer Lazarus."
|
||
|
||
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr "Cette sélection ne peut pas être extraite.%sVeuillez sélectionner du code pour en extraire une nouvelle procédure/méthode."
|
||
|
||
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
||
msgid "This will create a circular dependency."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhreads
|
||
msgctxt "lazarusidestrconsts.listhreads"
|
||
msgid "Threads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhreadscurrent
|
||
msgctxt "lazarusidestrconsts.listhreadscurrent"
|
||
msgid "Current"
|
||
msgstr "Courant"
|
||
|
||
#: lazarusidestrconsts.listhreadsfunc
|
||
msgctxt "lazarusidestrconsts.listhreadsfunc"
|
||
msgid "Function"
|
||
msgstr "Fonction"
|
||
|
||
#: lazarusidestrconsts.listhreadsgoto
|
||
msgid "Goto"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhreadsid
|
||
msgid "Id"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhreadsline
|
||
msgctxt "lazarusidestrconsts.listhreadsline"
|
||
msgid "Line"
|
||
msgstr "Ligne"
|
||
|
||
#: lazarusidestrconsts.listhreadsname
|
||
msgctxt "lazarusidestrconsts.listhreadsname"
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: lazarusidestrconsts.listhreadsnotevaluated
|
||
msgid "Threads not evaluated"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhreadssrc
|
||
msgctxt "lazarusidestrconsts.listhreadssrc"
|
||
msgid "Source"
|
||
msgstr "Source"
|
||
|
||
#: lazarusidestrconsts.listhreadsstate
|
||
msgctxt "lazarusidestrconsts.listhreadsstate"
|
||
msgid "State"
|
||
msgstr "Etat"
|
||
|
||
#: lazarusidestrconsts.listinfobuildautocloseonsuccess
|
||
msgid "&Automatically close on success"
|
||
msgstr "&Fermer automatiquement en cas de succès"
|
||
|
||
#: lazarusidestrconsts.listinfobuildcompiling
|
||
msgid "Compiling:"
|
||
msgstr "Compilation:"
|
||
|
||
#: lazarusidestrconsts.listitle
|
||
msgid "&Title"
|
||
msgstr "&Titre"
|
||
|
||
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
||
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
||
msgstr "Le titre de la barre des tâches montre par exemple: project1.lpi - Lazarus"
|
||
|
||
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
||
msgid "Title (leave empty for default)"
|
||
msgstr "Titre (laissez vide pour le défaut)"
|
||
|
||
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr "Fonction : ajouter un délimiteur de chemin"
|
||
|
||
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
||
msgid "Function: chomp path delimiter"
|
||
msgstr "Fonction : enlever un délimiteur de chemin"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr "Fonction : extraire l'extension du fichier"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr "Fonction : extraire le nom et l'extension du fichier"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr "Fonction : extraire le nom de fichier seul."
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr "Fonction : extraire le chemin du fichier"
|
||
|
||
#: lazarusidestrconsts.listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(macro inconnue: %s)"
|
||
|
||
#: lazarusidestrconsts.listofpcpath
|
||
msgid "Path:"
|
||
msgstr "Chemin :"
|
||
|
||
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
||
msgid "Toggle showing filenames with full path or with relative path"
|
||
msgstr "Commuter affichages les noms de fichiers avec chemins absolus ou relatifs"
|
||
|
||
#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
|
||
msgid "To install you must compile and restart the IDE"
|
||
msgstr "Pour l'installation vous devez compiler et redémarrer l'IDE"
|
||
|
||
#: lazarusidestrconsts.listop
|
||
msgctxt "lazarusidestrconsts.listop"
|
||
msgid "Top"
|
||
msgstr "Haut"
|
||
|
||
#: lazarusidestrconsts.listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr "Ancrage en haut"
|
||
|
||
#: lazarusidestrconsts.listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr "L'espace de frontière supérieur. Cette valeur est ajoutée à la base de l'espace de frontière et utilisée pour l'espace au-dessus de la commande."
|
||
|
||
#: lazarusidestrconsts.listops
|
||
msgid "Tops"
|
||
msgstr "Hauts"
|
||
|
||
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
||
msgstr "C'est le contrôle à laquelle le côté supérieur est ancré. Laisser vide pour le parent."
|
||
|
||
#: lazarusidestrconsts.listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr "Espacement égal en haut"
|
||
|
||
#: lazarusidestrconsts.listreeneedsrefresh
|
||
msgid "Tree needs refresh"
|
||
msgstr "L'arborescence a besoin d'un rafraichissement"
|
||
|
||
#: lazarusidestrconsts.listurbopascal
|
||
msgid "Turbo Pascal"
|
||
msgstr "Turbo Pascal"
|
||
|
||
#: lazarusidestrconsts.listypes
|
||
msgid "Types (not removed if no replacement)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr "Ne plus montrer ce message."
|
||
|
||
#: lazarusidestrconsts.lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr "Erreur dans l'expression régulière"
|
||
|
||
#: lazarusidestrconsts.lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr "Police sans UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisuegotoline
|
||
#| msgid "Goto line :"
|
||
msgid "Goto line:"
|
||
msgstr "Aller à la ligne:"
|
||
|
||
#: lazarusidestrconsts.lisuemodeseparator
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: lazarusidestrconsts.lisuenotfound
|
||
msgid "Not found"
|
||
msgstr "Non trouvé"
|
||
|
||
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
||
msgstr "Remplacer cette occurence de %s%s%s%s par %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts.lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr "Recherche de: %s"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr "Chaîne recherchée '%s' non trouvée !"
|
||
|
||
#: lazarusidestrconsts.lisuethecurre
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
||
msgstr "La police courante de l'éditeur ne supporte pas UTF-8, mais votre système semble l'employer. %sCela signifie que des caractères non ASCII seront probablement montrés incorrectement. %sVous pouvez choisir une autre police dans les options de l'éditeur."
|
||
|
||
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr "Effacer le cache inclure"
|
||
|
||
#: lazarusidestrconsts.lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "%s octets"
|
||
|
||
#: lazarusidestrconsts.lisuidclear
|
||
msgid "Clear"
|
||
msgstr "Nettoyer"
|
||
|
||
#: lazarusidestrconsts.lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr "Inclus par :"
|
||
|
||
#: lazarusidestrconsts.lisuidinproject
|
||
msgid "in Project:"
|
||
msgstr "dans projet:"
|
||
|
||
#: lazarusidestrconsts.lisuidlines
|
||
msgctxt "lazarusidestrconsts.lisuidlines"
|
||
msgid "Lines:"
|
||
msgstr "Lignes :"
|
||
|
||
#: lazarusidestrconsts.lisuidname
|
||
msgctxt "lazarusidestrconsts.lisuidname"
|
||
msgid "Name:"
|
||
msgstr "Nom :"
|
||
|
||
#: lazarusidestrconsts.lisuidno
|
||
msgid "no"
|
||
msgstr "non"
|
||
|
||
#: lazarusidestrconsts.lisuidok
|
||
msgctxt "lazarusidestrconsts.lisuidok"
|
||
msgid "Ok"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts.lisuidpathsreadonly
|
||
msgid "Paths (Read Only)"
|
||
msgstr "Chemins (lecture seule)"
|
||
|
||
#: lazarusidestrconsts.lisuidsize
|
||
msgid "Size:"
|
||
msgstr "Taille :"
|
||
|
||
#: lazarusidestrconsts.lisuidsrc
|
||
msgid "Src"
|
||
msgstr "Src"
|
||
|
||
#: lazarusidestrconsts.lisuidtype
|
||
msgid "Type:"
|
||
msgstr "Type:"
|
||
|
||
#: lazarusidestrconsts.lisuidunit
|
||
msgctxt "lazarusidestrconsts.lisuidunit"
|
||
msgid "Unit"
|
||
msgstr "Unité"
|
||
|
||
#: lazarusidestrconsts.lisuidyes
|
||
msgid "yes"
|
||
msgstr "Oui"
|
||
|
||
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr "Afficher les valeurs des Outils de code"
|
||
|
||
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr "Impossible de convertir le flux binaire en texte"
|
||
|
||
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr "Impossible de copier les composants vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Impossible d'ajouter le commentaire d'en-tête de la ressource au fichier ressource %s%s%s%s.%sProbablement une erreur de syntaxe."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Impossible d'ajouter la ressource T%s:FORMDATA au fichier ressource %s%s%s%s.%sProbablement une erreur de syntaxe."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddsetting
|
||
msgid "Unable to add setting"
|
||
msgstr "Impossible d'ajouter des paramètres"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
||
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread2
|
||
msgid "Unable to add the dependency %s, because the package %s has already a dependency to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
||
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr "Impossible d'ajouter %s au projet, car ce dernier contient déjà une unité portant le même nom."
|
||
|
||
#: lazarusidestrconsts.lisunabletobackupfileto
|
||
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
||
msgstr "Impossible de faire une copie de sauvegarde du fichier %s%s%s vers %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr "%s%sImpossible de changer la classe de %s à %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
||
msgid "Unable to change project title in source.%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr "Impossible de nettoyer le répertoire de destination"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
||
msgstr "Impossible de nettoyer %s%s%s.Veuillez vérifier les permissions."
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr "Impossible de convertir le composant texte en format binaire:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
||
msgid "Unable to convert file %s%s%s%sError: %s"
|
||
msgstr "Impossible de convertir le fichier %s%s%s%sErreur : %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
|
||
msgid "Unable to convert lfm to lrs and write lrs file."
|
||
msgstr "Impossible de convertir le fichier lfm en lrs et d'écrire le fichier lrs."
|
||
|
||
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
||
msgstr "Impossible de convertir les données texte de la fiche du fichier %s%s%s%s%sen flux binaire. (%s)"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr "Impossible de copier le fichier"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
||
msgstr "Impossible de copier le fichier %s%s%s%s vers %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto2
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
||
msgstr "Impossible de copier le fichier %s%s%s%svers %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory %s%s%s."
|
||
msgstr "Impossible de créer le répertoire de sauvegarde %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory
|
||
msgid "Unable to create directory %s%s%s."
|
||
msgstr "Impossible de créer le répertoire %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory2
|
||
msgid "Unable to create directory %s%s%s"
|
||
msgstr "Impossible de créer le répertoire %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr "Impossible de créer le fichier"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile2
|
||
msgid "Unable to create file %s%s%s"
|
||
msgstr "Impossible de créer le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile3
|
||
msgid "Unable to create file%s%s%s%s"
|
||
msgstr "Impossible de créer le fichier %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefilename
|
||
msgid "Unable to create file %s%s%s."
|
||
msgstr "Impossible de créer le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
||
msgid "Unable to create link %s%s%s with target %s%s%s"
|
||
msgstr "Impossible de créer le lien %s%s%s vers la cible %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
||
msgid "Unable to create new file, because there is already a directory with this name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
||
msgid "Unable to create new method."
|
||
msgstr "Impossible de créer la nouvelle méthode."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr "Impossible de créer tampon temporaire lfm."
|
||
|
||
#: lazarusidestrconsts.lisunabletodelete
|
||
msgid "Unable to delete"
|
||
msgstr "Impossible à supprimer"
|
||
|
||
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file %s%s%s"
|
||
msgstr "Impossible de supprimer le fichier litigieux %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr "Impossible de trouver la section ResourceString dans cette unité ou toute autre utilisée."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in %s%s%s"
|
||
msgstr "Impossible de trouver un nom de classe valide dans %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfile
|
||
msgid "Unable to find file %s%s%s."
|
||
msgstr "Impossible de trouver le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
#, fuzzy
|
||
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
||
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
||
msgstr "Impossible de trouver le fichier %s%s%s.%sS'il appartient à votre projet, vérifiez le chemin de recherche dans%sProjet->Options du compilateur...->Chemins->Autres fichiers unité. Si ce fichier appartient à un paquet, vérifier les options de compilation appropriées du package. Si ce fichier appartient à Lazarus, assurez-vous que la compilation est propre. Si le fichier appartient à FPC vérifier fpc.cfg. En cas de doute, vérifiez Projet->Options du compilateur...->Test."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr "Impossible de trouver %s dans le flux LFM."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindmethod
|
||
msgid "Unable to find method."
|
||
msgstr "Incapable de trouver la méthode."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
||
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
|
||
msgstr "Incapable de trouver l'unité en pascal (.pas,.pp) du fichier .lfm %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
|
||
msgid "Unable to find the unit of component class %s%s%s."
|
||
msgstr "Impossible de trouver l'unité de la classe composante %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr "Impossible de recueillir les changements de l'éditeur."
|
||
|
||
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr "Impossible d'obtenir le source pour le concepteur."
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadfile
|
||
msgid "Unable to load file:%s%s"
|
||
msgstr "Incapable de télécharger le fichier:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadfile2
|
||
msgid "unable to load file %s: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
|
||
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
||
msgstr "Impossible de charger l'ancien fichier ressource.%sLe fichier ressource est le premier fichier inclus dans%sla section initialization.%sPar exemple {$I %s.lrs}.%sProbablement une erreur de syntaxe."
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadpackage
|
||
msgid "Unable to load package %s%s%s"
|
||
msgstr "Impossible de charger le paquet %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
||
msgstr "Impossible de charger le composant de classe %s%s%s, parce qu'il dépend de lui-même."
|
||
|
||
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
||
msgid "Unable to open ancestor component"
|
||
msgstr "Impossible d'ouvrir le composant ancêtre"
|
||
|
||
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr "Impossible d'ouvrir le concepteur .%sLa classe %s ne descend pas d'une classe designable comme TForm ou TDataModule."
|
||
|
||
#: lazarusidestrconsts.lisunabletoread
|
||
msgid "Unable to read %s"
|
||
msgstr "Impossible de lire %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr "Impossible de lire le fichier."
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile2
|
||
msgid "Unable to read file %s%s%s!"
|
||
msgstr "Impossible de lire le fichier %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfileerror
|
||
msgid "Unable to read file %s%s%s%sError: %s"
|
||
msgstr "Impossible de lire le fichier %s%s%s%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfilename
|
||
msgid "Unable to read file %s%s%s."
|
||
msgstr "Impossible de lire le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadlpi
|
||
msgid "Unable to read lpi"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
||
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
||
msgid "Unable to read the project info file%s%s%s%s."
|
||
msgstr "Impossible de lire le fichier d'information du projet %s%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
|
||
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
|
||
msgid "Unable to read the project info file%s%s%s%s."
|
||
msgstr "Impossible de lire le fichier d'information du projet %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file %s%s%s!"
|
||
msgstr "Impossible de supprimer l'ancienne copie de sauvegarde %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
||
msgid "Unable to remove project title from source.%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
||
msgstr "Impossible de renommer le fichier litigieux %s%s%s%sen %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr "Impossible de renommer le fichier"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto
|
||
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
||
msgstr "Impossible de renommer le fichier %s%s%s en %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto2
|
||
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
||
msgstr "Impossible de renommer le fichier %s%s%s%sen %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr "Impossible de renommer la fiche dans le source."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr "Impossible de renommer la méthode. Veuillez corriger l'erreur affichée dans la fenêtre de messages."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr "Impossible de renommer la variable dans le source."
|
||
|
||
#: lazarusidestrconsts.lisunabletorun
|
||
msgid "Unable to run"
|
||
msgstr "Impossible d'exécuter"
|
||
|
||
#: lazarusidestrconsts.lisunabletosavefile
|
||
msgid "Unable to save file %s%s%s"
|
||
msgstr "Impossible d'enregistrer le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr "Impossible de placer le Contrôle d'ancrage latéral"
|
||
|
||
#: lazarusidestrconsts.lisunabletoshowmethod
|
||
msgid "Unable to show method."
|
||
msgstr "Incapable de montrer la méthode."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr "Impossible de créer un flux pour les composants sélectionnés."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr "Impossible de créer un flux pour les composants sélectionnés."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr "Impossible de créer le flux %s:T%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr "Impossible de transformer le flux binaire du composant %s:T%s en texte."
|
||
|
||
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr "Impossible de mettre à jour la déclaration CreateForm dans le source du projet."
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite
|
||
msgid "Unable to write %s%s%s%s%s."
|
||
msgstr "Impossible d'écrire %s%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite2
|
||
msgid "Unable to write %s%s%s"
|
||
msgstr "Impossible d'écrire %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr "Impossible d'écrire le fichier"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefileerror
|
||
msgid "Unable to write file %s%s%s%sError: %s"
|
||
msgstr "Impossible d'écrire le fichier %s%s%s%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
||
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
|
||
msgstr "Impossible d'écrire le fichier d'information du projet %s%s%s%s.%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
||
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile
|
||
#| msgid "Unable to write to file %s%s%s!"
|
||
msgid "Unable to write to file %s%s%s."
|
||
msgstr "Impossible d'écrire dans le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile2
|
||
msgid "Unable to write to file \"%s\"."
|
||
msgstr "Incapable d'écrire dans le fichier \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr "Impossible d'écrire le flux xml vers %s%sErreur : %s"
|
||
|
||
#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
|
||
msgid "Unexpected result:%sThe debugger will terminate"
|
||
msgstr "Résultat inattendu:%sLe débogueur va s'arrêter"
|
||
|
||
#: lazarusidestrconsts.lisuninstallimpossible
|
||
msgid "Uninstall impossible"
|
||
msgstr "Désinstallation impossible"
|
||
|
||
#: lazarusidestrconsts.lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr "Désinstaller la sélection"
|
||
|
||
#: lazarusidestrconsts.lisunithaschangedsave
|
||
msgid "Unit %s%s%s has changed. Save?"
|
||
msgstr "L'unité %s%s%s a été modifiée. L'enregistrer?"
|
||
|
||
#: lazarusidestrconsts.lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr "L'identifiateur de l'unité existe"
|
||
|
||
#: lazarusidestrconsts.lisunitinpackage
|
||
msgid "%s unit %s in package %s%s"
|
||
msgstr "%s unité %s dans le paquet %s%s"
|
||
|
||
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr "Nom d'unité déjà existant dans le projet"
|
||
|
||
#: lazarusidestrconsts.lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr "Le nom d'unité commence par..."
|
||
|
||
#: lazarusidestrconsts.lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr "Nom d'unité contient ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnotfoundinproject
|
||
msgid "A unit not found in project %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr "Répertoire de sortie de l'unité"
|
||
|
||
#: lazarusidestrconsts.lisunitpath
|
||
msgid "unit path"
|
||
msgstr "Chemin des unités"
|
||
|
||
#: lazarusidestrconsts.lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr "Chemin des unités"
|
||
|
||
#: lazarusidestrconsts.lisunitsnotfoundinproject
|
||
msgid "Units not found in project %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunsigned
|
||
msgid "Unsigned"
|
||
msgstr "Non signé"
|
||
|
||
#: lazarusidestrconsts.lisunusedunits
|
||
msgid "Unused units"
|
||
msgstr "Unités non utilisées"
|
||
|
||
#: lazarusidestrconsts.lisupdatereferences
|
||
msgid "Update references?"
|
||
msgstr "Mise à jour des références ?"
|
||
|
||
#: lazarusidestrconsts.lisuppercasestring
|
||
msgid "uppercase string"
|
||
msgstr "chaîne en majuscule"
|
||
|
||
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
||
msgid "Uppercase string given as parameter"
|
||
msgstr "chaîne de caractère en majuscules donnée en paramètre"
|
||
|
||
#: lazarusidestrconsts.lisusagemessagehoption
|
||
msgid "Usage message (-h option)"
|
||
msgstr "Utiliser message (option -h)"
|
||
|
||
#: lazarusidestrconsts.lisuse
|
||
msgid "Use >>"
|
||
msgstr "Utilise >>"
|
||
|
||
#: lazarusidestrconsts.lisuseansistrings
|
||
msgid "Use Ansistrings"
|
||
msgstr "Utilise les Ansistrings"
|
||
|
||
#: lazarusidestrconsts.lisusedesigntimepackages
|
||
msgid "Use design time packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseexcludefilter
|
||
#, fuzzy
|
||
#| msgid "Use Exclude Filter"
|
||
msgid "Use exclude filter"
|
||
msgstr "Utiliser le Filtre d'exclusion"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifier
|
||
msgid "Use identifier"
|
||
msgstr "Utilisez l'identificateur"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifierinat
|
||
msgid "Use identifier %s in %s at %s"
|
||
msgstr "Utilise l'identificateur %s dans %s à %s"
|
||
|
||
#: lazarusidestrconsts.lisuseincludefilter
|
||
#, fuzzy
|
||
#| msgid "Use Include Filter"
|
||
msgid "Use include filter"
|
||
msgstr "Utiliser le filtre d'inclusion"
|
||
|
||
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr "Lancer l'application"
|
||
|
||
#: lazarusidestrconsts.lisusemessagefile
|
||
msgid "Use message file:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage
|
||
msgid "Use package %s in package %s"
|
||
msgstr " Employez le paquet %s dans le paquet %s"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage2
|
||
msgid "Use package in package"
|
||
msgstr " Employez le paquet dans le paquet"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject
|
||
msgid "Use package %s in project"
|
||
msgstr "Utilise la paquet %s dans le projet"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject2
|
||
msgid "Use package in project"
|
||
msgstr "Utilise la paquet dans le projet"
|
||
|
||
#: lazarusidestrconsts.lisusershomedirectory
|
||
msgid "User's home directory"
|
||
msgstr "Répertoire Home de l'utilisateur"
|
||
|
||
#: lazarusidestrconsts.lisuseunit
|
||
#, fuzzy
|
||
#| msgid "Add unit to uses section"
|
||
msgctxt "lazarusidestrconsts.lisuseunit"
|
||
msgid "Add Unit to Uses Section"
|
||
msgstr "Ajoute une unité à la section uses"
|
||
|
||
#: lazarusidestrconsts.lisuseunitinunit
|
||
msgid "Use unit %s in unit %s"
|
||
msgstr " Employez l'unité %s dans l'unité %s"
|
||
|
||
#: lazarusidestrconsts.lisutf8withbom
|
||
msgid "UTF-8 with BOM"
|
||
msgstr "UTF-8 avec BOM"
|
||
|
||
#: lazarusidestrconsts.lisvalue
|
||
msgid "Value:"
|
||
msgstr "Valeur :"
|
||
|
||
#: lazarusidestrconsts.lisvalue2
|
||
msgid "Value%s"
|
||
msgstr "Valeur%s"
|
||
|
||
#: lazarusidestrconsts.lisvalue3
|
||
msgid "Value: "
|
||
msgstr "Valeur:"
|
||
|
||
#: lazarusidestrconsts.lisvalues
|
||
msgid "Values"
|
||
msgstr "Valeurs"
|
||
|
||
#: lazarusidestrconsts.lisverifymethodcalls
|
||
msgid "Verify method calls"
|
||
msgstr "Vérifiez les appels de méthodes"
|
||
|
||
#: lazarusidestrconsts.lisversion
|
||
msgid "Version"
|
||
msgstr "Version"
|
||
|
||
#: lazarusidestrconsts.lisversionmismatch
|
||
msgid "Version mismatch"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvertical
|
||
msgid "Vertical"
|
||
msgstr "Vertical"
|
||
|
||
#: lazarusidestrconsts.lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr "Copier les informations de version dans le presse-papier"
|
||
|
||
#: lazarusidestrconsts.lisviewbreakpointproperties
|
||
#, fuzzy
|
||
#| msgid "Breakpoint Properties..."
|
||
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
|
||
msgid "Breakpoint Properties ..."
|
||
msgstr "Afficher les propriétés du point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.lisviewprojectunits
|
||
msgctxt "lazarusidestrconsts.lisviewprojectunits"
|
||
msgid "View Project Units"
|
||
msgstr "Afficher les Unités du Projet"
|
||
|
||
#: lazarusidestrconsts.lisviewsource
|
||
msgid "View Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisviewsourcedisass
|
||
msgid "View Assembler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr "Afficher le Source (.lfm)"
|
||
|
||
#: lazarusidestrconsts.lisvsrforwardsearch
|
||
msgid "Forward Search"
|
||
msgstr "Recherche vers l'avant"
|
||
|
||
#: lazarusidestrconsts.lisvsrresetresultlist
|
||
msgid "Reset Result List"
|
||
msgstr "Réinitialiser la liste des résultats"
|
||
|
||
#: lazarusidestrconsts.liswarning
|
||
msgid "Warning: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
||
msgstr "Avertissement: fichier litigieux trouvé: %s%s%s. Le fichier source est: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
||
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatch
|
||
#, fuzzy
|
||
msgid "&Watch"
|
||
msgstr "Ajouter un suivi"
|
||
|
||
#: lazarusidestrconsts.liswatchdata
|
||
msgid "Watch:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchkind
|
||
msgid "Watch action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchkindread
|
||
msgid "Read"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchkindreadwrite
|
||
msgid "Read/Write"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchkindwrite
|
||
msgid "Write"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchpoint
|
||
msgid "&Data/Watch Breakpoint ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchpointbreakpoint
|
||
msgid "&Data/watch Breakpoint ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchpropert
|
||
msgid "Watch Properties"
|
||
msgstr "Propriétés des points de suivi"
|
||
|
||
#: lazarusidestrconsts.liswatchscope
|
||
msgid "Watch scope"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchscopeglobal
|
||
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
|
||
msgid "Global"
|
||
msgstr "Global"
|
||
|
||
#: lazarusidestrconsts.liswatchscopelocal
|
||
msgid "Declaration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchtowatchpoint
|
||
msgid "Create &Data/Watch Breakpoint ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswelcometolazaruside
|
||
msgid "Welcome to Lazarus IDE %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
||
#, fuzzy
|
||
#| msgid "When a unit is renamed, update references ..."
|
||
msgid "When a unit is renamed, update references"
|
||
msgstr "Mettre à jour les références si une unité est renommée ..."
|
||
|
||
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
||
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
||
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithincludes
|
||
msgid "%s, with includes %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithincludes2
|
||
msgid ", with includes "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
||
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
||
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
||
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr "Avec les paquets requis "
|
||
|
||
#: lazarusidestrconsts.liswladd
|
||
msgid "&Add"
|
||
msgstr "&Ajouter"
|
||
|
||
#: lazarusidestrconsts.liswldelete
|
||
msgid "&Delete"
|
||
msgstr "&Supprimer"
|
||
|
||
#: lazarusidestrconsts.liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr "&Supprimer tout"
|
||
|
||
#: lazarusidestrconsts.liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr "&Désactiver tout"
|
||
|
||
#: lazarusidestrconsts.liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr "&Activer tout"
|
||
|
||
#: lazarusidestrconsts.liswlenabled
|
||
msgid "&Enabled"
|
||
msgstr "&Activé"
|
||
|
||
#: lazarusidestrconsts.liswlexpression
|
||
msgid "Expression"
|
||
msgstr "Expression"
|
||
|
||
#: lazarusidestrconsts.liswlproperties
|
||
msgid "&Properties"
|
||
msgstr "&Propriétés"
|
||
|
||
#: lazarusidestrconsts.liswlwatchlist
|
||
#, fuzzy
|
||
#| msgid "Watch list"
|
||
msgid "Watch List"
|
||
msgstr "Liste de suivi"
|
||
|
||
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr "Mot sous le curseur dans l'éditeur courant"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr "Répertoire pour construire"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr "Répertoire pour éxécuter"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectorynotfound
|
||
msgid "Working directory %s not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswriteerror
|
||
msgid "Write Error"
|
||
msgstr "Erreur d'écriture"
|
||
|
||
#: lazarusidestrconsts.liswriteerrorfile
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr "Erreur d'écriture : %s%s Fichier : %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liswrongversionin
|
||
msgid "wrong version in %s: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr "Erreur XML"
|
||
|
||
#: lazarusidestrconsts.lisxmlfiles
|
||
msgid "XML files"
|
||
msgstr "Fichiers XML"
|
||
|
||
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr "Erreur de l'analyseur XML dans le fichier% s% sErreur :% s"
|
||
|
||
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
||
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You can not build lazarus while debugging or compiling."
|
||
msgstr "Vous ne pouvez pas construire Lazarus pendant que vous déboguez ou compilez."
|
||
|
||
#: lazarusidestrconsts.locwndsrceditor
|
||
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
||
msgid "Source Editor"
|
||
msgstr "Editeur de source"
|
||
|
||
#: lazarusidestrconsts.podaddpackageunittousessection
|
||
msgid "Add package unit to uses section"
|
||
msgstr "Ajouter l'unité du paquet à la section Uses"
|
||
|
||
#: lazarusidestrconsts.regdlgbinary
|
||
msgctxt "lazarusidestrconsts.regdlgbinary"
|
||
msgid "Binary"
|
||
msgstr "Binaire"
|
||
|
||
#: lazarusidestrconsts.regdlgdecimal
|
||
msgctxt "lazarusidestrconsts.regdlgdecimal"
|
||
msgid "Decimal"
|
||
msgstr "Décimale"
|
||
|
||
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
|
||
msgid "Display type for selected Registers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.regdlghex
|
||
msgid "Hex"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.regdlgoctal
|
||
msgid "Octal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.regdlgraw
|
||
msgid "Raw"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr "Ajouter inverse"
|
||
|
||
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr "Incrémenter automatiquement le numéro de construction"
|
||
|
||
#: lazarusidestrconsts.rsavailablescanners
|
||
msgid "Available scanners"
|
||
msgstr "Scanners disponible"
|
||
|
||
#: lazarusidestrconsts.rsbuild
|
||
#| msgid "Build:"
|
||
msgid "&Build:"
|
||
msgstr "&Construire:"
|
||
|
||
#: lazarusidestrconsts.rscharacterset
|
||
msgid "Character set:"
|
||
msgstr "Jeu de caractères :"
|
||
|
||
#: lazarusidestrconsts.rsclosecurrentpage
|
||
msgid "Close current page"
|
||
msgstr "Fermer la page en cours"
|
||
|
||
#: lazarusidestrconsts.rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr "Définitions conditionnelles"
|
||
|
||
#: lazarusidestrconsts.rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr "Créer une nouvelle définition"
|
||
|
||
#: lazarusidestrconsts.rscreatingdirfailed
|
||
msgid "Creating directory \"%s\" failed!"
|
||
msgstr "erreur pendant la création du répertoire \"%s\" !"
|
||
|
||
#: lazarusidestrconsts.rscreatingsymlinkfailed
|
||
msgid "Creating symbolic link \"%s\" failed!"
|
||
msgstr "erreur pendant la création du lien symbolique \"%s\" !"
|
||
|
||
#: lazarusidestrconsts.rscreatingsymlinknotsupported
|
||
msgid "Creating symbolic link is not supported on this platform!"
|
||
msgstr "La création de liens symboliques n'est pas supportée sur cette plateforme!"
|
||
|
||
#: lazarusidestrconsts.rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr "Activer i18n"
|
||
|
||
#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
|
||
#| msgid "Enter one or more phrases that you want to Search or Filter in the list, seperated by space, or comma"
|
||
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
|
||
msgstr "Entrez une ou plusieurs phrases que vous voulez rechercher ou un filtre dans la liste, séparées par un espace, ou une virgule"
|
||
|
||
#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
|
||
msgid "Filter the list with the current filter expression"
|
||
msgstr "Filtrer la liste avec l'expression de filtre actuelle "
|
||
|
||
#: lazarusidestrconsts.rsformdatafiledfm
|
||
msgid "Form data file (*.dfm)|*.dfm"
|
||
msgstr "Fichier de données Fiche (*.dfm)|*.dfm"
|
||
|
||
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
||
msgid "Found, but not listed here: "
|
||
msgstr "Trouvé, mais ne figurent pas ici :"
|
||
|
||
#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
|
||
msgid "Go to the next item in the search list"
|
||
msgstr "Aller à l'index suivant dans la liste de recherche"
|
||
|
||
#: lazarusidestrconsts.rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr "Options i18n"
|
||
|
||
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
||
#, fuzzy
|
||
#| msgid "Include Version Info in executable"
|
||
msgid "Include version info in executable"
|
||
msgstr "Inclure Version Info dans l'exécutable"
|
||
|
||
#: lazarusidestrconsts.rsiwpcustomposition
|
||
msgid "Custom position"
|
||
msgstr "Position personnalisée"
|
||
|
||
#: lazarusidestrconsts.rsiwpdefault
|
||
msgctxt "lazarusidestrconsts.rsiwpdefault"
|
||
msgid "Default"
|
||
msgstr "Valeur par défaut"
|
||
|
||
#: lazarusidestrconsts.rsiwpdocked
|
||
msgid "Docked"
|
||
msgstr "Attaché"
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Restaurer la géométrie de la fenêtre"
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowsize
|
||
msgid "Restore window size"
|
||
msgstr "Restaurer la taille de la fenêtre"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplittercustomposition
|
||
msgid "Custom Size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterdefault
|
||
msgid "Default Size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
|
||
msgid "Restore with window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
|
||
msgid "Restore Size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
|
||
msgid "Use windowmanager setting"
|
||
msgstr "Utiliser le gestionnaire de fenêtres"
|
||
|
||
#: lazarusidestrconsts.rskey
|
||
msgctxt "lazarusidestrconsts.rskey"
|
||
msgid "Key"
|
||
msgstr "Touche"
|
||
|
||
#: lazarusidestrconsts.rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr "Afrique"
|
||
|
||
#: lazarusidestrconsts.rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr "Arabe"
|
||
|
||
#: lazarusidestrconsts.rslanguageautomatic
|
||
msgid "Automatic (or english)"
|
||
msgstr "Automatique (ou anglais)"
|
||
|
||
#: lazarusidestrconsts.rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr "Catalan"
|
||
|
||
#: lazarusidestrconsts.rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "Chinois "
|
||
|
||
#: lazarusidestrconsts.rslanguageczech
|
||
msgid "Czech"
|
||
msgstr "Tchèque"
|
||
|
||
#: lazarusidestrconsts.rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr "Hollandais"
|
||
|
||
#: lazarusidestrconsts.rslanguageenglish
|
||
msgid "English"
|
||
msgstr "Anglais"
|
||
|
||
#: lazarusidestrconsts.rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr "Finnois"
|
||
|
||
#: lazarusidestrconsts.rslanguagefrench
|
||
msgid "French"
|
||
msgstr "Français"
|
||
|
||
#: lazarusidestrconsts.rslanguagegerman
|
||
msgid "German"
|
||
msgstr "Allemand"
|
||
|
||
#: lazarusidestrconsts.rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "Hébreu"
|
||
|
||
#: lazarusidestrconsts.rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr "Indonésien"
|
||
|
||
#: lazarusidestrconsts.rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "Italien"
|
||
|
||
#: lazarusidestrconsts.rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr "Japonais"
|
||
|
||
#: lazarusidestrconsts.rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr "Lithuanian"
|
||
|
||
#: lazarusidestrconsts.rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr "Options de langue"
|
||
|
||
#: lazarusidestrconsts.rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "Polonais"
|
||
|
||
#: lazarusidestrconsts.rslanguageportuguese
|
||
msgid "Portuguese"
|
||
msgstr "Portuguais"
|
||
|
||
#: lazarusidestrconsts.rslanguageportuguesebr
|
||
msgid "Brazilian Portuguese"
|
||
msgstr "portugais brésilien"
|
||
|
||
#: lazarusidestrconsts.rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "Russe"
|
||
|
||
#: lazarusidestrconsts.rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr "Sélection de la langue:"
|
||
|
||
#: lazarusidestrconsts.rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr "Slovaque"
|
||
|
||
#: lazarusidestrconsts.rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr "Espagnol"
|
||
|
||
#: lazarusidestrconsts.rslanguageturkish
|
||
msgid "Turkish"
|
||
msgstr "Turque"
|
||
|
||
#: lazarusidestrconsts.rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr "Ukrainien "
|
||
|
||
#: lazarusidestrconsts.rsmajorversion
|
||
msgid "&Major version:"
|
||
msgstr "&Version majeure :"
|
||
|
||
#: lazarusidestrconsts.rsminorversion
|
||
msgid "Mi&nor version:"
|
||
msgstr "Version mi&neure"
|
||
|
||
#: lazarusidestrconsts.rsok
|
||
#, fuzzy
|
||
#| msgid "ok"
|
||
msgctxt "lazarusidestrconsts.rsok"
|
||
msgid "OK"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts.rsotherinfo
|
||
msgid "Other info"
|
||
msgstr "Autres informations"
|
||
|
||
#: lazarusidestrconsts.rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr "Répertoire de sortie PO"
|
||
|
||
#: lazarusidestrconsts.rsremove
|
||
msgid "&Remove"
|
||
msgstr "&Retirer"
|
||
|
||
#: lazarusidestrconsts.rsresetfilter
|
||
msgid "Reset filter"
|
||
msgstr "Réinitialiser le filtre"
|
||
|
||
#: lazarusidestrconsts.rsrevision
|
||
msgid "&Revision:"
|
||
msgstr "&Revision:"
|
||
|
||
#: lazarusidestrconsts.rsscanners
|
||
msgid "Scanners"
|
||
msgstr "Scanners"
|
||
|
||
#: lazarusidestrconsts.rsselectaninheritedentry
|
||
msgid "Select an inherited entry"
|
||
msgstr "Sélectionnez une entrée hérité"
|
||
|
||
#: lazarusidestrconsts.rsstartanewsearch
|
||
msgid "Start a new search"
|
||
msgstr "Démarrer une nouvelle recherche"
|
||
|
||
#: lazarusidestrconsts.rsvalue
|
||
msgctxt "lazarusidestrconsts.rsvalue"
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: lazarusidestrconsts.rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr "Numérotation de version"
|
||
|
||
#: lazarusidestrconsts.srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr "Commandes du menu Aide"
|
||
|
||
#: lazarusidestrconsts.srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr "Commandes Défaire/Refaire"
|
||
|
||
#: lazarusidestrconsts.srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr "Commandes des outils de code"
|
||
|
||
#: lazarusidestrconsts.srkmcatcolselection
|
||
msgid "Text column selection commands"
|
||
msgstr "Commandes de sélection de la colonne du texte"
|
||
|
||
#: lazarusidestrconsts.srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr "Commandes de déplacement du curseur"
|
||
|
||
#: lazarusidestrconsts.srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr "Commandes d'édition de texte"
|
||
|
||
#: lazarusidestrconsts.srkmcatenvmenu
|
||
msgid "Environment menu commands"
|
||
msgstr "Commandes du menu Environnement"
|
||
|
||
#: lazarusidestrconsts.srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr "Commandes du menu Fichier"
|
||
|
||
#: lazarusidestrconsts.srkmcatfold
|
||
msgid "Text folding commands"
|
||
msgstr "Commandes pliage de texte"
|
||
|
||
#: lazarusidestrconsts.srkmcatmarker
|
||
msgid "Text marker commands"
|
||
msgstr "Commandes des signets"
|
||
|
||
#: lazarusidestrconsts.srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr "Commandes du menu Package"
|
||
|
||
#: lazarusidestrconsts.srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr "Commandes du menu Projet"
|
||
|
||
#: lazarusidestrconsts.srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr "Commandes du menu Exécuter"
|
||
|
||
#: lazarusidestrconsts.srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr "Commandes de recherche et remplacement"
|
||
|
||
#: lazarusidestrconsts.srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr "Commandes de sélection de texte"
|
||
|
||
#: lazarusidestrconsts.srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr "Commandes des onglets de sources"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroedit
|
||
msgid "Syncron Editing"
|
||
msgstr "Edition synchronisée"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
||
msgid "Syncron Editing (not in Cell)"
|
||
msgstr "Edition synchronisée(pas dans une cellule)"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
||
msgid "Syncron Editing (while selecting)"
|
||
msgstr "Edition synchronisée(pendant la sélection)"
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateedit
|
||
msgid "Template Editing"
|
||
msgstr "Editer le modèle"
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateeditoff
|
||
msgid "Template Editing (not in Cell)"
|
||
msgstr "nexEdition de modèle(pas dans une cellule)"
|
||
|
||
#: lazarusidestrconsts.srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr "Commandes du menu Outils"
|
||
|
||
#: lazarusidestrconsts.srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr "Commandes du menu Voir"
|
||
|
||
#: lazarusidestrconsts.srkmcommand
|
||
msgctxt "lazarusidestrconsts.srkmcommand"
|
||
msgid "Command:"
|
||
msgstr "Commande :"
|
||
|
||
#: lazarusidestrconsts.srkmcommand1
|
||
msgid " command1 \""
|
||
msgstr " commande 1 \""
|
||
|
||
#: lazarusidestrconsts.srkmcommand2
|
||
msgid " command2 \""
|
||
msgstr " commande 2 \""
|
||
|
||
#: lazarusidestrconsts.srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Conflit"
|
||
|
||
#: lazarusidestrconsts.srkmconflicw
|
||
msgid " conflicts with "
|
||
msgstr " en conflit avec "
|
||
|
||
#: lazarusidestrconsts.srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr "Interrompre la construction"
|
||
|
||
#: lazarusidestrconsts.srkmecabstractmethods
|
||
msgid "Abstract Methods ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpaddress
|
||
msgid "add address breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpsource
|
||
msgid "add source breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
||
msgid "add data/watchpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecaddjumppoint
|
||
#, fuzzy
|
||
#| msgid "Add jump point"
|
||
msgid "Add Jump Point"
|
||
msgstr "Ajouter un point de saut"
|
||
|
||
#: lazarusidestrconsts.srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr "Ajouter un suivi"
|
||
|
||
#: lazarusidestrconsts.srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr "Modèle d'achèvement de code"
|
||
|
||
#: lazarusidestrconsts.srkmecblockcopy
|
||
msgid "Copy Block"
|
||
msgstr "Copier le bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblockdelete
|
||
msgid "Delete Block"
|
||
msgstr "Effacer le bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotobegin
|
||
msgid "Goto Block begin"
|
||
msgstr "Aller au début du bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotoend
|
||
msgid "Goto Block end"
|
||
msgstr "Aller à la fin du bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblockhide
|
||
msgid "Hide Block"
|
||
msgstr "Cacher le bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr "Indenter le bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblockmove
|
||
msgid "Move Block"
|
||
msgstr "Déplacer le bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetbegin
|
||
msgid "Set block begin"
|
||
msgstr "Debut de bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetend
|
||
msgid "Set block end"
|
||
msgstr "Fin de bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblockshow
|
||
msgid "Show Block"
|
||
msgstr "Afficher le bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblocktogglehide
|
||
msgid "Toggle block"
|
||
msgstr "Basculer le bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr "Désindenter le bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr "Construire le programme/projet"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr "Construire le fichier"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildlazarus
|
||
msgid "Build lazarus"
|
||
msgstr "Construire Lazarus"
|
||
|
||
#: lazarusidestrconsts.srkmecchar
|
||
msgid "Char"
|
||
msgstr "Caractère"
|
||
|
||
#: lazarusidestrconsts.srkmeccleanupcompiled
|
||
msgid "clean up build files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr "Supprimer tout le texte"
|
||
|
||
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
|
||
msgid "Codetools defines editor"
|
||
msgstr "Editeur des directives des outils de code ..."
|
||
|
||
#: lazarusidestrconsts.srkmeccolseldown
|
||
msgid "Column Select Down"
|
||
msgstr "Sélectionner de colonne en bas"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
||
msgid "Column Select to absolute end"
|
||
msgstr "Sélectiion de colonne à la fin absolue"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditortop
|
||
msgid "Column Select to absolute beginning"
|
||
msgstr "Sélection de colonne au début absolu"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselleft
|
||
msgid "Column Select Left"
|
||
msgstr "Sélection de colonne à gauche"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellineend
|
||
msgid "Column Select Line End"
|
||
msgstr "Sélection de colonne à la fin de la ligne"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinestart
|
||
msgid "Column Select Line Start"
|
||
msgstr "Sélection de colonne au début de la ligne"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
||
msgid "Column Select to text start in line"
|
||
msgstr "Sélectionne la colonne du début du texte dans la ligne"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagebottom
|
||
msgid "Column Select Page Bottom"
|
||
msgstr "Sélection de colonne au bas de la page"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagedown
|
||
msgid "Column Select Page Down"
|
||
msgstr "Sélection de colonne une page plus bas"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagetop
|
||
msgid "Column Select Page Top"
|
||
msgstr "Sélection de colonne en haut de la page"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpageup
|
||
msgid "Column Select Page Up"
|
||
msgstr "Sélection de colonne une page plus haut"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselright
|
||
msgid "Column Select Right"
|
||
msgstr "Sélection de colonne à droite"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselup
|
||
msgid "Column Select Up"
|
||
msgstr "Sélection de colonne au dessus"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordleft
|
||
msgid "Column Select Word Left"
|
||
msgstr "Sélection de colonne un mot à gauche"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordright
|
||
msgid "Column Select Word Right"
|
||
msgstr "Sélection de colonne un mot à droite"
|
||
|
||
#: lazarusidestrconsts.srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr "Mode de sélection en colonne"
|
||
|
||
#: lazarusidestrconsts.srkmeccompile
|
||
msgid "compile program/project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccompileroptions
|
||
msgid "compiler options"
|
||
msgstr "Options du compilateur"
|
||
|
||
#: lazarusidestrconsts.srkmeccompletecode
|
||
#, fuzzy
|
||
#| msgid "Complete code"
|
||
msgctxt "lazarusidestrconsts.srkmeccompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Compléter le code"
|
||
|
||
#: lazarusidestrconsts.srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr "Fichier de configuration de la construction"
|
||
|
||
#: lazarusidestrconsts.srkmeccopy
|
||
msgid "Copy selection to clipboard"
|
||
msgstr "Copier la sélection vers le presse-papier"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
||
msgid "Copy editor to new window"
|
||
msgstr "Copie l'éditeur vers une nouvelle fenêtre"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
||
msgid "Copy editor to next free window"
|
||
msgstr "Copie l'éditeur vers la fenêtre suivante libre"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
||
msgid "Copy editor to prior free window"
|
||
msgstr "Copie l'éditeur vers la précédente fenêtre libre"
|
||
|
||
#: lazarusidestrconsts.srkmeccut
|
||
msgid "Cut selection to clipboard"
|
||
msgstr "Couper la sélection vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr "Supprimer le début de la ligne"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr "Supprimer le caractère sous le curseur"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr "Supprimer la fin de la ligne"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr "Supprimer le dernier caractère"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr "Supprimer le début du mot"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr "Supprimer la ligne courante"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr "supprimer la fin du mot"
|
||
|
||
#: lazarusidestrconsts.srkmecdiff
|
||
msgctxt "lazarusidestrconsts.srkmecdiff"
|
||
msgid "Diff"
|
||
msgstr "Différences"
|
||
|
||
#: lazarusidestrconsts.srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr "Déplacer le curseur à la toute fin"
|
||
|
||
#: lazarusidestrconsts.srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr "Déplacer le curseur au tout début"
|
||
|
||
#: lazarusidestrconsts.srkmecemptymethods
|
||
msgid "Empty Methods ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecenvironmentoptions
|
||
#| msgid "General environment options"
|
||
msgid "IDE options"
|
||
msgstr "Options de l'IDE"
|
||
|
||
#: lazarusidestrconsts.srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr "Evaluer/Modifier"
|
||
|
||
#: lazarusidestrconsts.srkmecextractproc
|
||
#, fuzzy
|
||
#| msgid "Extract procedure"
|
||
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
||
msgid "Extract Procedure"
|
||
msgstr "Extraire procédure"
|
||
|
||
#: lazarusidestrconsts.srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr "Outil externe %d"
|
||
|
||
#: lazarusidestrconsts.srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr "Configurations des outils externes"
|
||
|
||
#: lazarusidestrconsts.srkmecfind
|
||
#, fuzzy
|
||
#| msgid "Find text"
|
||
msgid "Find Text"
|
||
msgstr "Chercher le texte"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr "Chercher la fin d'un bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr "Chercher le début d'un bloc"
|
||
|
||
#: lazarusidestrconsts.srkmecfinddeclaration
|
||
#, fuzzy
|
||
#| msgid "Find declaration"
|
||
msgid "Find Declaration"
|
||
msgstr "Chercher la déclaration"
|
||
|
||
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
||
#, fuzzy
|
||
#| msgid "Find identifier references"
|
||
msgid "Find Identifier References"
|
||
msgstr "Trouver les références de l'identificateur"
|
||
|
||
#: lazarusidestrconsts.srkmecfindinfiles
|
||
#, fuzzy
|
||
#| msgid "Find in files"
|
||
msgid "Find in Files"
|
||
msgstr "Chercher dans les fichiers"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnext
|
||
#, fuzzy
|
||
#| msgid "Find next"
|
||
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
||
msgid "Find Next"
|
||
msgstr "Trouver l'occurence suivante"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
||
#, fuzzy
|
||
#| msgid "Find next word occurrence"
|
||
msgid "Find Next Word Occurrence"
|
||
msgstr "Rechercher l'occurrence de mot suivante"
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloads
|
||
#, fuzzy
|
||
#| msgid "Find overloads"
|
||
msgid "Find Overloads"
|
||
msgstr "Trouver les surcharges"
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
||
msgid "Find Overloads ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevious
|
||
#, fuzzy
|
||
#| msgid "Find previous"
|
||
msgid "Find Previous"
|
||
msgstr "Chercher l'occurence précédente"
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
||
#, fuzzy
|
||
#| msgid "Find previous word occurrence"
|
||
msgid "Find Previous Word Occurrence"
|
||
msgstr "Rechercher l'occurrence de mot précédente"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
||
#, fuzzy
|
||
#| msgid "Find procedure definiton"
|
||
msgid "Find Procedure Definiton"
|
||
msgstr "Chercher la définition de procédure"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduremethod
|
||
#, fuzzy
|
||
#| msgid "Find procedure method"
|
||
msgid "Find Procedure Method"
|
||
msgstr "Chercher la méthode"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldcurrent
|
||
msgid "Fold at Cursor"
|
||
msgstr "Plier au curseur"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldlevel
|
||
msgid "Fold to Level %d"
|
||
msgstr "Pliez au niveau %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr "Aller à l'éditeur %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoincludedirective
|
||
#, fuzzy
|
||
#| msgid "Go to to include directive of current include file"
|
||
msgid "Go to include directive of current include file"
|
||
msgstr "Aller à la déclaration d'inclusion du fichier courant"
|
||
|
||
#: lazarusidestrconsts.srkmecgotolinenumber
|
||
#, fuzzy
|
||
#| msgid "Go to line number"
|
||
msgid "Go to Line Number"
|
||
msgstr "Aller à la ligne numéro"
|
||
|
||
#: lazarusidestrconsts.srkmecgotomarker
|
||
msgid "Go to Marker %d"
|
||
msgstr "Aller au signet %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr "Aller en XY"
|
||
|
||
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
||
#, fuzzy
|
||
#| msgid "Guess misplaced $IFDEF"
|
||
msgid "Guess Misplaced $IFDEF"
|
||
msgstr "Deviner les $IFDEF mal placés"
|
||
|
||
#: lazarusidestrconsts.srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr "Ime Str"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr "Ajouter une entrée au journal des modifications"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr "Insérer depuis la table des caractères"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr "Insérer le mot-clé CVS Author"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr "Insérer le mot-clé CVS Date"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr "Insérer le mot-clé CVS Header"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr "Insérer le mot-clé CVS ID"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr "Insérer le mot-clé CVS Log"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr "Insérer le mot-clé CVS Name"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr "Insérer le mot-clé CVS Revision"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr "Insérer le mot-clé CVS Source"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr "Insérer la date et l'heure courantes"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertfilename
|
||
msgid "Insert full Filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr "Insérer la notice GPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr "Insérer un GUID"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr "Insérer la notice LGPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "Couper la ligne sans bouger le curseur"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr "Mode insertion"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr "Insérer la notice modifié LGPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr "Insérer le nom d'utilisateur"
|
||
|
||
#: lazarusidestrconsts.srkmecinspect
|
||
msgid "inspect"
|
||
msgstr "inspecter"
|
||
|
||
#: lazarusidestrconsts.srkmecinvertassignment
|
||
#, fuzzy
|
||
#| msgid "Invert assignment"
|
||
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
||
msgid "Invert Assignment"
|
||
msgstr "Inverser l'affectation"
|
||
|
||
#: lazarusidestrconsts.srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "Couper la ligne et déplacer le curseur"
|
||
|
||
#: lazarusidestrconsts.srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr "Déplacer le curseur en fin de ligne"
|
||
|
||
#: lazarusidestrconsts.srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr "Mode sélection de ligne"
|
||
|
||
#: lazarusidestrconsts.srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr "Déplacer le curseur en début de ligne"
|
||
|
||
#: lazarusidestrconsts.srkmeclinetextstart
|
||
msgid "Move cursor to text start in line"
|
||
msgstr "Déplacer le curseur au début du texte de la ligne"
|
||
|
||
#: lazarusidestrconsts.srkmeclockeditor
|
||
msgid "Lock Editor"
|
||
msgstr "Vérouille l'éditeur"
|
||
|
||
#: lazarusidestrconsts.srkmecmakeresourcestring
|
||
#, fuzzy
|
||
#| msgid "Make resource string"
|
||
msgid "Make Resource String"
|
||
msgstr "Faire une chaîne ressource"
|
||
|
||
#: lazarusidestrconsts.srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr "Aller à la parenthèse assortie"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr "Déplacer l'éditeur vers la gauche"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr "Déplacer l'editeur tout à gauche"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
||
msgid "Move editor to new window"
|
||
msgstr "Déplace l'éditeur vers une nouvelle fenêtre"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
||
msgid "Move editor to next free window"
|
||
msgstr "Déplacer l'éditeur vers la fenêtre suivante libre"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
||
msgid "Move editor to prior free window"
|
||
msgstr "Déplace l'éditeur vers la première fenêtre libre"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr "Déplacer l'éditeur vers la droite"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr "Déplacer l'editeur tout à droite"
|
||
|
||
#: lazarusidestrconsts.srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr "Prochain signet"
|
||
|
||
#: lazarusidestrconsts.srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr "Aller à l'éditeur suivant"
|
||
|
||
#: lazarusidestrconsts.srkmecnextsharededitor
|
||
msgid "Go to next editor with same Source"
|
||
msgstr "Aller vers l'éditeur suivant avec la même source"
|
||
|
||
#: lazarusidestrconsts.srkmecnextwindow
|
||
msgid "Go to next window"
|
||
msgstr "Aller à la fenêtre suivante"
|
||
|
||
#: lazarusidestrconsts.srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr "Mode de sélection normal"
|
||
|
||
#: lazarusidestrconsts.srkmecopenfileatcursor
|
||
#, fuzzy
|
||
#| msgid "Open file at cursor"
|
||
msgid "Open File at Cursor"
|
||
msgstr "Ouvrir le fichier sous le curseur"
|
||
|
||
#: lazarusidestrconsts.srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr "Mode recouvrement"
|
||
|
||
#: lazarusidestrconsts.srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr "Déplacer le curseur au bas de la page"
|
||
|
||
#: lazarusidestrconsts.srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr "Déplacer le curseur d'une page vers le bas"
|
||
|
||
#: lazarusidestrconsts.srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr "Déplacer le curseur d'une page à gauche"
|
||
|
||
#: lazarusidestrconsts.srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr "Déplacer le curseur d'une page à droite"
|
||
|
||
#: lazarusidestrconsts.srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr "Déplacer le curseur en haut de la page"
|
||
|
||
#: lazarusidestrconsts.srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr "Déplacer le curseur d'une page vers le haut"
|
||
|
||
#: lazarusidestrconsts.srkmecpaste
|
||
msgid "Paste clipboard to current position"
|
||
msgstr "Coller le contenu du presse-papiers à la position courante"
|
||
|
||
#: lazarusidestrconsts.srkmecpause
|
||
msgid "pause program"
|
||
msgstr "suspendre le programme"
|
||
|
||
#: lazarusidestrconsts.srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr "Signet Précédent"
|
||
|
||
#: lazarusidestrconsts.srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr "Aller à l'éditeur précédent"
|
||
|
||
#: lazarusidestrconsts.srkmecprevsharededitor
|
||
msgid "Go to prior editor with same Source"
|
||
msgstr "Aller au précédent éditeur avec la même source"
|
||
|
||
#: lazarusidestrconsts.srkmecprevwindow
|
||
msgid "Go to prior window"
|
||
msgstr "Aller à la fenêtre précédente"
|
||
|
||
#: lazarusidestrconsts.srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr "compiler vite, aucun lien"
|
||
|
||
#: lazarusidestrconsts.srkmecquit
|
||
msgid "Quit"
|
||
msgstr "Quitter"
|
||
|
||
#: lazarusidestrconsts.srkmecremovebreakpoint
|
||
msgid "remove break point"
|
||
msgstr "Enlever le point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveemptymethods
|
||
#, fuzzy
|
||
#| msgid "Remove empty methods"
|
||
msgid "Remove Empty Methods"
|
||
msgstr "Supprimer les méthodes vides"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveunusedunits
|
||
#, fuzzy
|
||
#| msgid "Remove unused units"
|
||
msgid "Remove Unused Units"
|
||
msgstr "Enlever les unités non utilisées"
|
||
|
||
#: lazarusidestrconsts.srkmecrenameidentifier
|
||
#, fuzzy
|
||
#| msgid "Rename identifier"
|
||
msgid "Rename Identifier"
|
||
msgstr "Renommer l'identificateur"
|
||
|
||
#: lazarusidestrconsts.srkmecreplace
|
||
#, fuzzy
|
||
#| msgid "Replace text"
|
||
msgid "Replace Text"
|
||
msgstr "Texte à remplacer"
|
||
|
||
#: lazarusidestrconsts.srkmecreportingbug
|
||
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
||
msgid "Reporting a bug"
|
||
msgstr "Signaler un bogue"
|
||
|
||
#: lazarusidestrconsts.srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr "Réinitialiser le débogueur"
|
||
|
||
#: lazarusidestrconsts.srkmecrun
|
||
msgid "run program"
|
||
msgstr "Exécuter le programme"
|
||
|
||
#: lazarusidestrconsts.srkmecrunfile
|
||
msgid "run file"
|
||
msgstr "Exécuter le fichier"
|
||
|
||
#: lazarusidestrconsts.srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr "Paramètres d'exécution"
|
||
|
||
#: lazarusidestrconsts.srkmecsave
|
||
msgctxt "lazarusidestrconsts.srkmecsave"
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: lazarusidestrconsts.srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr "Défilement d'une ligne vers le bas"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr "Défilement d'un caractère vers la gauche"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr "Défilement d'un caractère vers la droite"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr "Défilement d'une ligne vers le haut"
|
||
|
||
#: lazarusidestrconsts.srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr "Sélectionner Bas"
|
||
|
||
#: lazarusidestrconsts.srkmecselectall
|
||
msgctxt "lazarusidestrconsts.srkmecselectall"
|
||
msgid "Select All"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr "Convertir les tabulations de la sélection en espaces"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr "Sélectionner jusqu'à la toute fin"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr "Sélectionner jusqu'au tout début"
|
||
|
||
#: lazarusidestrconsts.srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr "Sélectionner Aller en XY"
|
||
|
||
#: lazarusidestrconsts.srkmecselleft
|
||
msgid "SelLeft"
|
||
msgstr "Sélection gauche"
|
||
|
||
#: lazarusidestrconsts.srkmecsellineend
|
||
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
||
msgid "Select Line End"
|
||
msgstr "Sélectionner Fin de Ligne"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinestart
|
||
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
||
msgid "Select Line Start"
|
||
msgstr "Sélectionner Début de Ligne"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinetextstart
|
||
msgid "Select to text start in line"
|
||
msgstr "Sélectionner le début du texte dans la ligne"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagebottom
|
||
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
||
msgid "Select Page Bottom"
|
||
msgstr "Sélectionner Bas de Page"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr "Sélectionner Page vers le Bas"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr "Sélectioner Page vers la Gauche"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr "Sélectioner page vers la Droite"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagetop
|
||
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
||
msgid "Select Page Top"
|
||
msgstr "Sélectionner Haut de Page"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr "Sélectionner Haut de Page"
|
||
|
||
#: lazarusidestrconsts.srkmecselright
|
||
msgid "SelRight"
|
||
msgstr "Sélection droite"
|
||
|
||
#: lazarusidestrconsts.srkmecselup
|
||
msgid "Select Up"
|
||
msgstr "Sélectionner Haut"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordleft
|
||
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
||
msgid "Select Word Left"
|
||
msgstr "Sélectionner Mot de gauche"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordright
|
||
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
||
msgid "Select Word Right"
|
||
msgstr "Sélectionner mot de droite"
|
||
|
||
#: lazarusidestrconsts.srkmecsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Mettre un signet libre"
|
||
|
||
#: lazarusidestrconsts.srkmecsetmarker
|
||
msgid "Set Marker %d"
|
||
msgstr "Définir le marqueur %d"
|
||
|
||
#: lazarusidestrconsts.srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr "Shift Tab"
|
||
|
||
#: lazarusidestrconsts.srkmecshowabstractmethods
|
||
#, fuzzy
|
||
#| msgid "Show abstract methods"
|
||
msgid "Show Abstract Methods"
|
||
msgstr "Afficher les méthodes abstraites"
|
||
|
||
#: lazarusidestrconsts.srkmecshowcodecontext
|
||
#, fuzzy
|
||
#| msgid "Show code context"
|
||
msgid "Show Code Context"
|
||
msgstr "Afficher le contexte de code"
|
||
|
||
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
||
msgid "show execution point"
|
||
msgstr "montrez le point d'exécution"
|
||
|
||
#: lazarusidestrconsts.srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr "Arrêter le programme"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr "Aller à la dernière position dans la cellule"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr "Aller à la première position dans la cellule"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
||
msgid "Select Cell"
|
||
msgstr "Sélectionne la cellule"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
||
msgid "Escape"
|
||
msgstr "Echap"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
||
msgid "Next Cell"
|
||
msgstr "Cellule suivante"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr "Cellule suivante(toutes sélectionnées)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr "Cellule précédente"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr "Cellule précédente(toutes sélectionnées)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
||
msgid "Start Syncro edit"
|
||
msgstr "Démarrer l'édition synchronisée"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr "Aller à la dernière position dans la cellule"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr "Aller à la première position dans la cellule"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
||
msgid "Select cell"
|
||
msgstr "Cellule sélectionnée"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
||
msgid "Escape"
|
||
msgstr "Échap"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
||
msgid "Finish"
|
||
msgstr "Achever"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
||
msgid "Next Cell"
|
||
msgstr "Cellule suivante"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
||
msgid "Next Cell (rotate)"
|
||
msgstr "Cellule suivante(rotation)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr "Cellule suivante(toutes sélectionnées)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
||
msgid "Next Cell (rotate / all selected)"
|
||
msgstr "Cellule suivante(rotation / toutes sélectionnées)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr "Cellule précédente"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr "Cellule précédente(toutes sélectionnées)"
|
||
|
||
#: lazarusidestrconsts.srkmecsyntaxcheck
|
||
#, fuzzy
|
||
#| msgid "Syntax check"
|
||
msgid "Syntax Check"
|
||
msgstr "Vérification de la syntaxe"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleassembler
|
||
msgid "View assembler"
|
||
msgstr "Voir assembleur"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoint
|
||
msgid "toggle break point"
|
||
msgstr "Basculer point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr "Afficher les points d'arrêt"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr "Afficher la pile d'appel"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr "Afficher le navigateur de code"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr "Afficher l'explorateur de code"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr "Afficher la palette de composant"
|
||
|
||
#: lazarusidestrconsts.srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr "Afficher la sortie du débogueur"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr "Basculer entre Fiche et Unité"
|
||
|
||
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr "Afficher l'éditeur de documentation"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
||
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
||
msgid "View IDE speed buttons"
|
||
msgstr "Afficher les boutons rapides de l'EDI"
|
||
|
||
#: lazarusidestrconsts.srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr "Afficher les variables locales"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarker
|
||
msgid "Toggle Marker %d"
|
||
msgstr "Définir le signet %d"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarkupword
|
||
msgid "Toggle Current-Word highlight"
|
||
msgstr "Basculer le surlignage du mot en cours"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr "Afficher les messages"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr "Commuter le mode"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr "Afficher l'Inspecteur d'Pbjets"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleregisters
|
||
msgid "View registers"
|
||
msgstr "Afficher les registres"
|
||
|
||
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr "Afficher l'explorateur de restrictions"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr "Afficher les Résultats de Recherche"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "Afficher l'Editeur de Source"
|
||
|
||
#: lazarusidestrconsts.srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr "Afficher les points de suivi"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldall
|
||
msgid "Unfold all"
|
||
msgstr "Déplier tous"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldcurrent
|
||
msgid "Unfold at Cursor"
|
||
msgstr "Déplier au curseur"
|
||
|
||
#: lazarusidestrconsts.srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr "Commande d'édition inconnue"
|
||
|
||
#: lazarusidestrconsts.srkmecunusedunits
|
||
msgid "Unused Units ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecuserfirst
|
||
msgid "User First"
|
||
msgstr "Utilisateur d'abord"
|
||
|
||
#: lazarusidestrconsts.srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr "Afficher l'éditeur d'ancres"
|
||
|
||
#: lazarusidestrconsts.srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr "Afficher les composants"
|
||
|
||
#: lazarusidestrconsts.srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr "Afficher les fiches"
|
||
|
||
#: lazarusidestrconsts.srkmecviewhistory
|
||
msgid "View History"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
||
msgid "View Terminal Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewtaborder
|
||
msgid "View Tab Order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewthreads
|
||
msgid "View Threads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr "Afficher les dépendances de l'unité"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr "Afficher les informations de l'unité"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunits
|
||
msgid "View units"
|
||
msgstr "Afficher les unités"
|
||
|
||
#: lazarusidestrconsts.srkmecwordcompletion
|
||
#, fuzzy
|
||
#| msgid "Word completion"
|
||
msgid "Word Completion"
|
||
msgstr "Compléter le mot"
|
||
|
||
#: lazarusidestrconsts.srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr "Déplacer le curseur d'un mot à gauche"
|
||
|
||
#: lazarusidestrconsts.srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr "Déplacer le curseur d'un mot à droite"
|
||
|
||
#: lazarusidestrconsts.srkmeditforcmd
|
||
msgid "Edit keys of command"
|
||
msgstr "Éditer les touches de la commande"
|
||
|
||
#: lazarusidestrconsts.srkmeditkeys
|
||
msgid "Edit Keys"
|
||
msgstr "Editer les touches"
|
||
|
||
#: lazarusidestrconsts.synffoldcommentsinselection
|
||
msgid "Fold comments in selection"
|
||
msgstr "Plier les commentaires de la sélection"
|
||
|
||
#: lazarusidestrconsts.synfhidecommentsinselection
|
||
msgid "Hide comments in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.synfunfoldallinselection
|
||
#, fuzzy
|
||
#| msgid "Unfold all in Selection"
|
||
msgid "Unfold all in selection"
|
||
msgstr "Déplier tout dans la sélection"
|
||
|
||
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
||
#, fuzzy
|
||
#| msgid "Unfold comments in Selection"
|
||
msgid "Unfold comments in selection"
|
||
msgstr "Déplier les commentaires dans la sélection"
|
||
|
||
#: lazarusidestrconsts.uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr "Fichier en lecture seule"
|
||
|
||
#: lazarusidestrconsts.uefilerotext1
|
||
msgid "The file \""
|
||
msgstr "Le fichier \""
|
||
|
||
#: lazarusidestrconsts.uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr "\" est protégé en écriture."
|
||
|
||
#: lazarusidestrconsts.uelocked
|
||
msgid "Locked"
|
||
msgstr "Vérouillé"
|
||
|
||
#: lazarusidestrconsts.uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "Ajouter &suivi sous curseur"
|
||
|
||
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
||
msgid "Add Watch&Point At Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "Aller au signet"
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpages
|
||
msgid "Close All &Other Pages"
|
||
msgstr "Fermer t&outes les autres pages"
|
||
|
||
#: lazarusidestrconsts.uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "&Fermer la page"
|
||
|
||
#: lazarusidestrconsts.uemcopy
|
||
msgctxt "lazarusidestrconsts.uemcopy"
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: lazarusidestrconsts.uemcopyfilename
|
||
#| msgid "Copy filename"
|
||
msgid "Copy Filename"
|
||
msgstr "Copier Nom de fichier"
|
||
|
||
#: lazarusidestrconsts.uemcopytonewwindow
|
||
#, fuzzy
|
||
#| msgid "Clone to new Window"
|
||
msgid "Clone to New Window"
|
||
msgstr "Cloner vers une nouvelle fenêtre"
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindow
|
||
#, fuzzy
|
||
#| msgid "Clone to other Window"
|
||
msgid "Clone to Other Window"
|
||
msgstr "Cloner vers une autre fenêtre"
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
||
msgid "New Window"
|
||
msgstr "Nouvelle fenêtre"
|
||
|
||
#: lazarusidestrconsts.uemcut
|
||
msgctxt "lazarusidestrconsts.uemcut"
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: lazarusidestrconsts.uemdebugword
|
||
msgid "Debug"
|
||
msgstr "Déboguer"
|
||
|
||
#: lazarusidestrconsts.uemeditorproperties
|
||
#, fuzzy
|
||
#| msgid "Editor properties"
|
||
msgid "Editor Properties"
|
||
msgstr "Propriétés de l'éditeur"
|
||
|
||
#: lazarusidestrconsts.uemencoding
|
||
msgid "Encoding"
|
||
msgstr "Encodage"
|
||
|
||
#: lazarusidestrconsts.uemevaluatemodify
|
||
#, fuzzy
|
||
#| msgid "&Evaluate/Modify..."
|
||
msgid "&Evaluate/Modify ..."
|
||
msgstr "&Evaluer/Modifier"
|
||
|
||
#: lazarusidestrconsts.uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "&Chercher la déclaration"
|
||
|
||
#: lazarusidestrconsts.uemfindinotherwindow
|
||
msgid "Find in other Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "&Aller au signet"
|
||
|
||
#: lazarusidestrconsts.uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr "Surligneur"
|
||
|
||
#: lazarusidestrconsts.ueminspect
|
||
#, fuzzy
|
||
#| msgid "&Inspect..."
|
||
msgctxt "lazarusidestrconsts.ueminspect"
|
||
msgid "&Inspect ..."
|
||
msgstr "&Inspecter.."
|
||
|
||
#: lazarusidestrconsts.ueminvertassignment
|
||
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
||
msgid "Invert Assignment"
|
||
msgstr "Inverser l'affectation"
|
||
|
||
#: lazarusidestrconsts.uemlineending
|
||
#, fuzzy
|
||
#| msgid "Line ending"
|
||
msgid "Line Ending"
|
||
msgstr "Fin de la ligne"
|
||
|
||
#: lazarusidestrconsts.uemlockpage
|
||
msgid "&Lock Page"
|
||
msgstr "&Bloque la Page"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleft
|
||
#, fuzzy
|
||
#| msgid "Move page left"
|
||
msgid "Move Page Left"
|
||
msgstr "Déplacer la page à gauche"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleftmost
|
||
#, fuzzy
|
||
#| msgid "Move page leftmost"
|
||
msgid "Move Page Leftmost"
|
||
msgstr "Déplacer la page le plus à gauche"
|
||
|
||
#: lazarusidestrconsts.uemmovepageright
|
||
#, fuzzy
|
||
#| msgid "Move page right"
|
||
msgid "Move Page Right"
|
||
msgstr "Déplacer la page à droite"
|
||
|
||
#: lazarusidestrconsts.uemmovepagerightmost
|
||
#, fuzzy
|
||
#| msgid "Move page rightmost"
|
||
msgid "Move Page Rightmost"
|
||
msgstr "Déplacer la page le plus à droite"
|
||
|
||
#: lazarusidestrconsts.uemmovetonewwindow
|
||
#, fuzzy
|
||
#| msgid "Move to new Window"
|
||
msgid "Move to New Window"
|
||
msgstr "Déplacement vers une nouvelle fenêtre"
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindow
|
||
#, fuzzy
|
||
#| msgid "Move to other Window"
|
||
msgid "Move to Other Window"
|
||
msgstr "Déplacement vers une autre fenêtre"
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
||
msgid "New Window"
|
||
msgstr "Nouvelle Fenêtre"
|
||
|
||
#: lazarusidestrconsts.uemnextbookmark
|
||
#, fuzzy
|
||
#| msgid "Goto next Bookmark"
|
||
msgid "Goto Next Bookmark"
|
||
msgstr "Aller au signet suivant"
|
||
|
||
#: lazarusidestrconsts.uemodified
|
||
msgid "Modified"
|
||
msgstr "Modifié"
|
||
|
||
#: lazarusidestrconsts.uemopenfileatcursor
|
||
#, fuzzy
|
||
#| msgid "&Open file at cursor"
|
||
msgid "&Open File at Cursor"
|
||
msgstr "&Ouvrir le fichier sous le curseur"
|
||
|
||
#: lazarusidestrconsts.uempaste
|
||
msgctxt "lazarusidestrconsts.uempaste"
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: lazarusidestrconsts.uemprevbookmark
|
||
#, fuzzy
|
||
#| msgid "Goto previous Bookmark"
|
||
msgid "Goto Previous Bookmark"
|
||
msgstr "Aller au signet précédent"
|
||
|
||
#: lazarusidestrconsts.uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr "Aller à la procédure"
|
||
|
||
#: lazarusidestrconsts.uemreadonly
|
||
msgctxt "lazarusidestrconsts.uemreadonly"
|
||
msgid "Read Only"
|
||
msgstr "Lecture seule"
|
||
|
||
#: lazarusidestrconsts.uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr "Retravailler"
|
||
|
||
#: lazarusidestrconsts.uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "&Exécuter jusqu'au curseur"
|
||
|
||
#: lazarusidestrconsts.uemsetbookmark
|
||
msgid "&Set Bookmark"
|
||
msgstr "&Ajouter un signet"
|
||
|
||
#: lazarusidestrconsts.uemsetfreebookmark
|
||
#, fuzzy
|
||
#| msgid "Set a free Bookmark"
|
||
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
||
msgid "Set a Free Bookmark"
|
||
msgstr "Mettre un signet libre"
|
||
|
||
#: lazarusidestrconsts.uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr "Afficher les numéros de ligne"
|
||
|
||
#: lazarusidestrconsts.uemsource
|
||
msgctxt "lazarusidestrconsts.uemsource"
|
||
msgid "Source"
|
||
msgstr "Source"
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmark
|
||
msgid "&Toggle Bookmark"
|
||
msgstr "Me&ttre le signet"
|
||
|
||
#: lazarusidestrconsts.uemtogglebreakpoint
|
||
#, fuzzy
|
||
#| msgid "&Toggle Breakpoint"
|
||
msgid "Toggle &Breakpoint"
|
||
msgstr "&Basculer point d'arrêt"
|
||
|
||
#: lazarusidestrconsts.uemviewcallstack
|
||
msgid "View Call Stack"
|
||
msgstr "Afficher la pile d'appels"
|
||
|
||
#: lazarusidestrconsts.uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr "Non implémenté à ce jour"
|
||
|
||
#: lazarusidestrconsts.uenotimplcapagain
|
||
msgid "I told You: Not implemented yet"
|
||
msgstr "Je vous l'ai dit : pas encore implémenté"
|
||
|
||
#: lazarusidestrconsts.uenotimpltext
|
||
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
||
msgstr "Si VOUS souhaitez aider à implémenter cette fonctionnalité, envoyez un courriel à lazarus@miraclec.com"
|
||
|
||
#: lazarusidestrconsts.uepins
|
||
msgid "INS"
|
||
msgstr "INS"
|
||
|
||
#: lazarusidestrconsts.uepovr
|
||
msgid "OVR"
|
||
msgstr "REC"
|
||
|
||
#: lazarusidestrconsts.uepreadonly
|
||
msgid "Readonly"
|
||
msgstr "Lecture seule"
|
||
|
||
#: lazarusidestrconsts.versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr "Informations sur la version"
|
||
|