mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-11-02 04:19:28 +01:00
9184 lines
218 KiB
Plaintext
9184 lines
218 KiB
Plaintext
msgid ""
|
||
msgstr ""
|
||
"Last-Translator: Ido Kanner <ik_5@hotmail.com>\n"
|
||
"PO-Revision-Date: 2004-06-13 16:07\n"
|
||
"Project-Id-Version: lazaruside.he\n"
|
||
"Language-Team: Hebrew <C@li.org>\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Generator: KBabel 1.3.1\n"
|
||
"MIME-Version: 1.0\n"
|
||
|
||
#: lazarusidestrconsts:srkmcommand1
|
||
msgid " command1 \""
|
||
msgstr "\" פקודה1 "
|
||
|
||
#: lazarusidestrconsts:srkmcommand2
|
||
msgid " command2 \""
|
||
msgstr "\" פקודה2 "
|
||
|
||
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
|
||
msgid " A token %s%s%s already exists! "
|
||
msgstr "!כבר קיים %s%s%s הסימן "
|
||
|
||
#: lazarusidestrconsts:srkmalreadyconnected
|
||
msgid " The key \"%s\" is already connected to \"%s\"."
|
||
msgstr ".\"%s\" כבר מחובר ל \"%s\" המפתח "
|
||
|
||
#: lazarusidestrconsts:srkmconflicw
|
||
msgid " conflicts with "
|
||
msgstr " מתנגש עם "
|
||
|
||
#: lazarusidestrconsts:liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "(... מהדר) %s"
|
||
|
||
#: lazarusidestrconsts:lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "(... מנפה) %s"
|
||
|
||
#: lazarusidestrconsts:liscovarious
|
||
msgid "%s (various)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewproject
|
||
msgid "%s - (new project)"
|
||
msgstr "(מיזם חדש) - %s"
|
||
|
||
#: lazarusidestrconsts:lislazarusversionstring
|
||
msgid "%s beta"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "בתים %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "ספרייה %s"
|
||
|
||
#: lazarusidestrconsts:lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "כבר חלק מהמיזם. %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "ספריית המיזם %s"
|
||
|
||
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "(למשל) בבקשה בחר בשם אחר project1.lpi%s.שם המיזם אינו תקים %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lissvuoisnotavalididentifier
|
||
msgid "%s%s%s is not a valid identifier."
|
||
msgstr ".הוא לא מזהה תקין %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2pisnotavalidunitname
|
||
msgid "%s%s%s is not a valid unit name."
|
||
msgstr ".הוא לא שם יחידה תקין %s%s%s"
|
||
|
||
#: lazarusidestrconsts:liscoclickokifaresuretodothat
|
||
msgid "%s%sClick OK if you are sure to do that."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysfilename
|
||
msgid "%s%sFile Name: %s%s%s"
|
||
msgstr "%s%s%s :שם קובץ%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitname
|
||
msgid "%s%sUnit Name: %s%s%s"
|
||
msgstr "%s%s%s :שם יחידה%s%s"
|
||
|
||
#: lazarusidestrconsts:lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s :דף ,%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "נוצר אוטומטית ,%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
|
||
msgid "%s, project specific"
|
||
msgstr "מיזם ספציפי ,%s"
|
||
|
||
#: lazarusidestrconsts:lisuereadonly
|
||
msgid "%s/ReadOnly"
|
||
msgstr "קריאה בלבד/%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr ".זאת אומרת, שחבילה אחת משתמשת בחבילה שנייה, או שני החבילות בשימוש בחבילה שלישית. שני החבילות מחוברות%s"
|
||
|
||
#: lazarusidestrconsts:lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%s :הסבר%s"
|
||
|
||
#: lazarusidestrconsts:lisa2pexistingfile
|
||
msgid "%sExisting file: %s%s%s"
|
||
msgstr "%s%s%s :קובץ קיים%s"
|
||
|
||
#: lazarusidestrconsts:lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr " :מצב%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "לא נמצא lpk חבילה זו הותקנה, אבל קובץ ה%s"
|
||
|
||
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
|
||
msgid "%sThis package was automatically created"
|
||
msgstr "%חבילה זו נוצרה אוטומטיתs"
|
||
|
||
#: lazarusidestrconsts:liswladd
|
||
msgid "&Add"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemaddbreakpoint
|
||
msgid "&Add Breakpoint"
|
||
msgstr "הוסף מיפסק&"
|
||
|
||
#: lazarusidestrconsts:lisclose
|
||
msgid "&Close"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "סגור דף&"
|
||
|
||
#: lazarusidestrconsts:lismenucomponents
|
||
msgid "&Components"
|
||
msgstr "רכיב&"
|
||
|
||
#: lazarusidestrconsts:liswldelete
|
||
msgid "&Delete"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "עריכה&"
|
||
|
||
#: lazarusidestrconsts:liswlenabled
|
||
msgid "&Enabled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufile
|
||
msgid "&File"
|
||
msgstr "קובץ&"
|
||
|
||
#: lazarusidestrconsts:uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "מצא הכרזות&"
|
||
|
||
#: lazarusidestrconsts:uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "גש לסמנייה"
|
||
|
||
#: lazarusidestrconsts:lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "עזרה&"
|
||
|
||
#: lazarusidestrconsts:lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisok
|
||
msgid "&Ok"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemopenfileatcursor
|
||
msgid "&Open file at cursor"
|
||
msgstr "פתח קובץ במיקום סמן&"
|
||
|
||
#: lazarusidestrconsts:lismenuproject
|
||
msgid "&Project"
|
||
msgstr "מיזם&"
|
||
|
||
#: lazarusidestrconsts:liswlproperties
|
||
msgid "&Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgreplacewith
|
||
msgid "&Replace With"
|
||
msgstr "החלף עם&"
|
||
|
||
#: lazarusidestrconsts:lismenurun
|
||
msgid "&Run"
|
||
msgstr "הפעל&"
|
||
|
||
#: lazarusidestrconsts:uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "הפעל עד למיקום סמן&"
|
||
|
||
#: lazarusidestrconsts:lismenusearch
|
||
msgid "&Search"
|
||
msgstr "חפש&"
|
||
|
||
#: lazarusidestrconsts:uemsetbookmark
|
||
msgid "&Set Bookmark"
|
||
msgstr "קבע סמנייה&"
|
||
|
||
#: lazarusidestrconsts:dlgtexttofing
|
||
msgid "&Text to Find"
|
||
msgstr "טקסט למצוא&"
|
||
|
||
#: lazarusidestrconsts:lismenutools
|
||
msgid "&Tools"
|
||
msgstr "כלים&"
|
||
|
||
#: lazarusidestrconsts:lismenuview
|
||
msgid "&View"
|
||
msgstr "תצוגה&"
|
||
|
||
#: lazarusidestrconsts:lismenuwindows
|
||
msgid "&Windows"
|
||
msgstr "חלונות&"
|
||
|
||
#: lazarusidestrconsts:liscefilter
|
||
msgid "(Filter)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(%s :מקרו לא מוכר)"
|
||
|
||
#: lazarusidestrconsts:lisplistall
|
||
msgid "<All>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistnone
|
||
msgid "<None>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pchooseanexistingfile
|
||
msgid "<choose an existing file>"
|
||
msgstr "<בחר קובץ קיים>"
|
||
|
||
#: lazarusidestrconsts:lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<לא נחבר משתנה>"
|
||
|
||
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
|
||
msgid "A file %s%s%s already exists.%sReplace it?"
|
||
msgstr "?האם להחליפו%s.כבר קיים %s%s%s הקובץ"
|
||
|
||
#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr ".pas או .pp יחידת פסקל חייבת להיות עם סיומת של"
|
||
|
||
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
|
||
msgid "A required packages was not found. See package graph."
|
||
msgstr ".חבילה הכרחית לא נמצאה. הבט בתרשים החבילה"
|
||
|
||
#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
||
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr ".כלי תקף צריך לפחות כותרת ושם קובץ"
|
||
|
||
#: lazarusidestrconsts:lispdabort
|
||
msgid "Abort"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "בטל בנייה"
|
||
|
||
#: lazarusidestrconsts:lisabortall
|
||
msgid "Abort all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplateabout
|
||
msgid "About"
|
||
msgstr "אודות"
|
||
|
||
#: lazarusidestrconsts:lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "אודות לזרוס"
|
||
|
||
#: lazarusidestrconsts:srvk_accept
|
||
msgid "Accept"
|
||
msgstr "קבל"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "%s :פעולה"
|
||
|
||
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetempladd
|
||
msgid "Add"
|
||
msgstr "הוסף"
|
||
|
||
#: lazarusidestrconsts:lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "?למיזם %s להוסיף"
|
||
|
||
#: lazarusidestrconsts:uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "הוסף השגחה במיקום סמן"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfile
|
||
msgid "Add File"
|
||
msgstr "הוסף קובץ"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "הוסף קבצים"
|
||
|
||
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
|
||
msgid "Add LFM, LRS files, if they exist"
|
||
msgstr "במידה והם קיימים ,LFM, LRS הוסף קבצי"
|
||
|
||
#: lazarusidestrconsts:lisa2paddunit
|
||
msgid "Add Unit"
|
||
msgstr "הוסף יחידה"
|
||
|
||
#: lazarusidestrconsts:lismenuaddcurunittopkg
|
||
msgid "Add active unit to a package"
|
||
msgstr "הוסף יחידה פעילה לחבילה"
|
||
|
||
#: lazarusidestrconsts:lispckeditaddanitem
|
||
msgid "Add an item"
|
||
msgstr "הוסף פריט"
|
||
|
||
#: lazarusidestrconsts:lismenuaddbreakpoint
|
||
msgid "Add breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "הוסף תבנית קוד"
|
||
|
||
#: lazarusidestrconsts:lismenuaddtoproject
|
||
msgid "Add editor file to Project"
|
||
msgstr "הוסף קובץ עורך למיזם"
|
||
|
||
#: lazarusidestrconsts:lisprojaddeditorfile
|
||
msgid "Add editor files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2paddfiletoapackage
|
||
msgid "Add file to a package"
|
||
msgstr "הוסף קובץ לחבילה"
|
||
|
||
#: lazarusidestrconsts:lisprojaddaddfiletoproject
|
||
msgid "Add file to project:"
|
||
msgstr ":הוסף קובץ למיזם"
|
||
|
||
#: lazarusidestrconsts:lisprojaddfiles
|
||
msgid "Add files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2paddfilestopackage
|
||
msgid "Add files to package"
|
||
msgstr "הוסף קבצים לחבילה"
|
||
|
||
#: lazarusidestrconsts:srkmecaddjumppoint
|
||
msgid "Add jump point"
|
||
msgstr "הוסף נקודת קפיצה"
|
||
|
||
#: lazarusidestrconsts:lismenuaddjumppointtohistory
|
||
msgid "Add jump point to history"
|
||
msgstr "הוסף נקודת קפיצה לארכיב"
|
||
|
||
#: lazarusidestrconsts:lislazdocaddlinkbutton
|
||
msgid "Add link"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "הוסף אפשרויות לחבילות למיזמים וחבילות"
|
||
|
||
#: lazarusidestrconsts:lislazdocaddpathbutton
|
||
msgid "Add path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "תלויים הוסף נתיב ל מיזם/חבילה"
|
||
|
||
#: lazarusidestrconsts:dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
|
||
msgid "Add to favourite properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "הוסף לחבילה"
|
||
|
||
#: lazarusidestrconsts:lisprojaddtoproject
|
||
msgid "Add to project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuaddwatch
|
||
msgid "Add watch ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedadd
|
||
msgid "Add..."
|
||
msgstr "...הוסף"
|
||
|
||
#: lazarusidestrconsts:dlgadditionalsrcpath
|
||
msgid "Additional Source search path for all projects (.pp;.pas)"
|
||
msgstr "(.pp;.pas) נתיב חיפוש נוסף לכל המיזמים"
|
||
|
||
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
|
||
msgid "Additional compiler options inherited from packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "התאם שורה ראשונה בהתאם להערה מלפנים"
|
||
|
||
#: lazarusidestrconsts:rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmalignword
|
||
msgid "Align"
|
||
msgstr "יישר"
|
||
|
||
#: lazarusidestrconsts:lisalignment
|
||
msgid "Alignment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisallfiles
|
||
msgid "All Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisallblockslooksok
|
||
msgid "All blocks looks ok."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgallfiles
|
||
msgid "All files"
|
||
msgstr "כל הקבצים"
|
||
|
||
#: lazarusidestrconsts:lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "כל החבילות"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "GOTO ו LABEL הרשה"
|
||
|
||
#: lazarusidestrconsts:lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "בסדר הא\"ב"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolalt
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts:dlgaltsetclmode
|
||
msgid "Alt-Key sets column mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmalternkey
|
||
msgid "Alternative key (or 2 keys combination)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgalwaysvisiblecaret
|
||
msgid "Always visible caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisambiguousunitfound
|
||
msgid "Ambiguous Unit found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "סוג האב"
|
||
|
||
#: lazarusidestrconsts:lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
|
||
msgid "Anchor to bottom side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
|
||
msgid "Anchor to left side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
|
||
msgid "Anchor to right side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
|
||
msgid "Anchor to top side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "צרף לקטע"
|
||
|
||
#: lazarusidestrconsts:dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "יישום"
|
||
|
||
#: lazarusidestrconsts:dlgapplicationsettings
|
||
msgid "Application Settings"
|
||
msgstr "הגדרות היישום"
|
||
|
||
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
|
||
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbutapply
|
||
msgid "Apply"
|
||
msgstr "החל"
|
||
|
||
#: lazarusidestrconsts:lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "החל שינויים"
|
||
|
||
#: lazarusidestrconsts:rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoasis
|
||
msgid "As-Is"
|
||
msgstr "As-Is"
|
||
|
||
#: lazarusidestrconsts:lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "עולה"
|
||
|
||
#: lazarusidestrconsts:dlgenvask
|
||
msgid "Ask"
|
||
msgstr "שאל"
|
||
|
||
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "ב"
|
||
|
||
#: lazarusidestrconsts:lispckoptsauthor
|
||
msgid "Author:"
|
||
msgstr ":מחבר"
|
||
|
||
#: lazarusidestrconsts:dlgautoform
|
||
msgid "Auto create form when opening unit"
|
||
msgstr "צור אוטומטית טופס כאשר יחידה נפתחת"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
|
||
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
||
msgstr ".וגם גם אינם יכולים ליצור ילדים שלא נוצרו אוטומטית%s,לא ניתן לערוך צומת שנוצאה אוטומטית"
|
||
|
||
#: lazarusidestrconsts:dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "מחק קובץ אוטומטית"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes can not be edited."
|
||
msgstr "אין אפשרות לערוך צמתים שנוצרו אוטמטית"
|
||
|
||
#: lazarusidestrconsts:dlgautoident
|
||
msgid "Auto indent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "בנה אוטמטית כאשר בונים הכול"
|
||
|
||
#: lazarusidestrconsts:dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgautosave
|
||
msgid "Auto save"
|
||
msgstr "שמור אוטומטית"
|
||
|
||
#: lazarusidestrconsts:dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr ":צור טופס אוטומטית"
|
||
|
||
#: lazarusidestrconsts:lispckexplautocreated
|
||
msgid "AutoCreated"
|
||
msgstr "נוצר אוטומטית"
|
||
|
||
#: lazarusidestrconsts:rslanguageautomatic
|
||
msgid "Automatic (or english)"
|
||
msgstr "(או אנגלית) אוטומטי"
|
||
|
||
#: lazarusidestrconsts:lisautomaticfeatures
|
||
msgid "Automatic features"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
|
||
msgid "Automatically increment version on build"
|
||
msgstr "הגדל מספר גרסה אוטמטית בעת בנייה"
|
||
|
||
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "בנה אוטומטית לפי הצורך"
|
||
|
||
#: lazarusidestrconsts:dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr ":טפסים זמינים"
|
||
|
||
#: lazarusidestrconsts:lisavailablepackages
|
||
msgid "Available packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedback
|
||
msgid "Back"
|
||
msgstr "חזור"
|
||
|
||
#: lazarusidestrconsts:fdmorderbackone
|
||
msgid "Back one"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbackcolor
|
||
msgid "Background"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_back
|
||
msgid "Backspace"
|
||
msgstr "תו נסיגה"
|
||
|
||
#: lazarusidestrconsts:dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "גיבוי"
|
||
|
||
#: lazarusidestrconsts:lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "קובץ הגיבוי נכשל"
|
||
|
||
#: lazarusidestrconsts:lisfrbackwardsearch
|
||
msgid "Backward search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypebinary
|
||
msgid "Binary"
|
||
msgstr "בינרי"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "גוש"
|
||
|
||
#: lazarusidestrconsts:dlgblockindent
|
||
msgid "Block indent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedbold
|
||
msgid "Bold"
|
||
msgstr "הדגש"
|
||
|
||
#: lazarusidestrconsts:uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "סמנייה"
|
||
|
||
#: lazarusidestrconsts:lisborderspace
|
||
msgid "BorderSpace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbrachighlight
|
||
msgid "Bracket highlighting"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubeaklinesinselection
|
||
msgid "Break Lines in selection"
|
||
msgstr "שבור שורות בבחירה"
|
||
|
||
#: lazarusidestrconsts:srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "שבור שורה והזז סמן"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "שבור שורה, השאר סמן"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
|
||
msgid "Break on Lazarus Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "נקודת מפסק"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditbrowse
|
||
msgid "Browse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbrowseforcompiler
|
||
msgid "Browse for Compiler (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubuild
|
||
msgid "Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildcodetools
|
||
msgid "Build CodeTools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildcomponent
|
||
msgid "Build Component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
|
||
msgid "Build Components (SynEdit, CodeTools)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildexamples
|
||
msgid "Build Examples"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildide
|
||
msgid "Build IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildideintf
|
||
msgid "Build IDE Interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildjitform
|
||
msgid "Build JIT Form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildjitform
|
||
msgid "Build JITForm"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildlcl
|
||
msgid "Build LCL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubuildlazarus
|
||
msgid "Build Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildnumber
|
||
msgid "Build Number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildpkgreg
|
||
msgid "Build Package Registration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildstarter
|
||
msgid "Build Starter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildsynedit
|
||
msgid "Build SynEdit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubuildall
|
||
msgid "Build all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecbuildlazarus
|
||
msgid "Build lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcmacro
|
||
msgid "C Style Macros (global)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcocops
|
||
msgid "C Style Operators (*=, +=, /= and -=)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcppinline
|
||
msgid "C++ Styled INLINE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinsertcvskeyword
|
||
msgid "CVS keyword"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscocallon
|
||
msgid "Call on:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
|
||
msgid "Can not copy top level component."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscannotcreatefile
|
||
msgid "Can not create file %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Can not register components without unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcancel
|
||
msgid "Cancel"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscannotfindlazarusstarter
|
||
msgid "Cannot find lazarus starter:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_capital
|
||
msgid "Capital"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcaretskipsselection
|
||
msgid "Caret skips selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcasesensitive
|
||
msgid "Case Sensitive"
|
||
msgstr "Distingir entre majúscules i minúscules"
|
||
|
||
#: lazarusidestrconsts:lisfindfilecasesensitive
|
||
msgid "Case sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcentercursorline
|
||
msgid "Center Cursor Line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscenters
|
||
msgid "Centers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetemplchange
|
||
msgid "Change"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischangeclass
|
||
msgid "Change Class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinsertchangelogentry
|
||
msgid "ChangeLog entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffchangedfiles
|
||
msgid "Changed files:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecchar
|
||
msgid "Char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischaractermap
|
||
msgid "Character Map"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuchecklfm
|
||
msgid "Check LFM file in editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischeckchangesondiskwithloading
|
||
msgid "Check changes on disk with loading"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcheckconsistency
|
||
msgid "Check consistency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcochecks
|
||
msgid "Checks:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedoptschoosescheme
|
||
msgid "Choose Scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
|
||
msgid "Choose a base class for the favourite property %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosecompilerpath
|
||
msgid "Choose compiler filename (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosedebuggerpath
|
||
msgid "Choose debugger filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosemakepath
|
||
msgid "Choose make path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
|
||
msgid "Circle in package dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoifclassnotfound
|
||
msgid "Class %s%s%s not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgclassinsertpolicy
|
||
msgid "Class part insert policy"
|
||
msgstr "Política d'inserir parts de classes"
|
||
|
||
#: lazarusidestrconsts:liskmclassic
|
||
msgid "Classic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildcleanall
|
||
msgid "Clean all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucleandirectory
|
||
msgid "Clean directory ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildcleanbuild
|
||
msgid "Clean+Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_clear
|
||
msgid "Clear"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
|
||
msgid "Clear dependency filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuiclearincludedbyreference
|
||
msgid "Clear included by reference"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuclose
|
||
msgid "Close"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucloseall
|
||
msgid "Close all editor files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissrclosepage
|
||
msgid "Close page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcodegeneration
|
||
msgid "Code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewcodeexplorer
|
||
msgid "Code Explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:dlgcodetoolstab
|
||
msgid "Code Tools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgusecodefolding
|
||
msgid "Code folding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedcodeparams
|
||
msgid "Code parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedcodetempl
|
||
msgid "Code templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceocodeexplorer
|
||
msgid "CodeExplorer Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
||
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
|
||
msgid "CodeTools Defines Preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcodetoolsopts
|
||
msgid "CodeTools Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucodetoolsoptions
|
||
msgid "CodeTools Options ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
|
||
msgid "CodeTools defines editor ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
|
||
msgid "Codetools defines editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccodetoolsoptions
|
||
msgid "Codetools options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucollectpofil
|
||
msgid "Collect .po files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedcolor
|
||
msgid "Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvcolors
|
||
msgid "Colors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscommandafter
|
||
msgid "Command after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscocommand
|
||
msgid "Command:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucommentselection
|
||
msgid "Comment selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcocompilation
|
||
msgid "Compilation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscocalloncompile
|
||
msgid "Compile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompileidewithoutlinking
|
||
msgid "Compile IDE (without linking)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompiler
|
||
msgid "Compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcompileroptions
|
||
msgid "Compiler Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucompileroptions
|
||
msgid "Compiler Options ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompileroptionsforproject
|
||
msgid "Compiler Options for Project: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompilererror
|
||
msgid "Compiler error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfpcpath
|
||
msgid "Compiler path (e.g. %s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucompletecode
|
||
msgid "Complete Code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccompletecode
|
||
msgid "Complete code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class %s%s%s already defined"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscomponentnameiskeyword
|
||
msgid "Component name %s%s%s is keyword"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
|
||
msgid "Component name %s%s%s is not a valid identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfpcomponents
|
||
msgid "Components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatcomponentsmenu
|
||
msgid "Components menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgconfigfiles
|
||
msgid "Config Files:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisconfigurebuildlazarus
|
||
msgid "Configure %sBuild Lazarus%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuconfigurehelp
|
||
msgid "Configure Help ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuconfigcustomcomps
|
||
msgid "Configure custom components ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenusettings
|
||
msgid "Configure custom tools ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditinstallpkgs
|
||
msgid "Configure installed packages ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lislazbuildconfirmbuild
|
||
msgid "Confirm Before ReBuild Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Conflicte"
|
||
|
||
#: lazarusidestrconsts:lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscontinue
|
||
msgid "Continue"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscontributors
|
||
msgid "Contributors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_control
|
||
msgid "Control"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_convert
|
||
msgid "Convert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdfmtolfm
|
||
msgid "Convert DFM file to LFM ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphipackage
|
||
msgid "Convert Delphi package to Lazarus package ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphiproject
|
||
msgid "Convert Delphi project to Lazarus project ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphiunit
|
||
msgid "Convert Delphi unit to Lazarus unit ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucopy
|
||
msgid "Copy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
|
||
msgid "Copy all and hidden messages to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscopyallmessagestoclipboard
|
||
msgid "Copy all messages to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemcopyfilename
|
||
msgid "Copy filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
|
||
msgid "Copy selected messages to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccopy
|
||
msgid "Copy selection to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisgplnotice
|
||
msgid "Copyright (C) <year> <name of author> %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislgplnotice
|
||
msgid "Copyright (C) <year> <name of author>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "Copyright (C) <year> <name of author>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts:dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnpcreate
|
||
msgid "Create"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucreatepofile
|
||
msgid "Create .po files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
|
||
msgid "Create Defines for Lazarus Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditcreatemakefile
|
||
msgid "Create Makefile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditorcreatesubmenu
|
||
msgid "Create Submenu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
||
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
|
||
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
|
||
msgid "Create a new pascal unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
|
||
msgid "Create a new program."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
|
||
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pcreatenewfile
|
||
msgid "Create new file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgruberbandcreationcolor
|
||
msgid "Creation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolctrl
|
||
msgid "Ctrl"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
|
||
msgid "Current Project Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinsertdatetime
|
||
msgid "Current date and time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinsertusername
|
||
msgid "Current username"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
|
||
msgid "Custom Program%sA freepascal program."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsiwpcustomposition
|
||
msgid "Custom position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccustomtool
|
||
msgid "Custom tool %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucut
|
||
msgid "Cut"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccut
|
||
msgid "Cut selection to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdate
|
||
msgid "Date"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemdebugword
|
||
msgid "Debug"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewdebugoutput
|
||
msgid "Debug output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenudebugwindows
|
||
msgid "Debug windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismendebuggeroptions
|
||
msgid "Debugger Options ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisdebuggererror
|
||
msgid "Debugger error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcodebugging
|
||
msgid "Debugging:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsiwpdefault
|
||
msgid "Default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpasext
|
||
msgid "Default pascal extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdefvaluecolor
|
||
msgid "Default value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgeddelay
|
||
msgid "Delay"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgeddelete
|
||
msgid "Delete"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditordeletefromtemplate
|
||
msgid "Delete From Template..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditordeleteitem
|
||
msgid "Delete Item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocdeletelinkbutton
|
||
msgid "Delete link"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteoldfile
|
||
msgid "Delete old file %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmdeleteselection
|
||
msgid "Delete selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeletingoffilefailed
|
||
msgid "Deleting of file %s%s%s failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdelphi2ext
|
||
msgid "Delphi 2 Extensions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdeplhicomp
|
||
msgid "Delphi Compatible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdelphiproject
|
||
msgid "Delphi project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortseldescending
|
||
msgid "Descending"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listodoldescription
|
||
msgid "Description"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsdescriptionabstract
|
||
msgid "Description/Abstract"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipdescription
|
||
msgid "Description: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
|
||
msgid "Designtime and Runtime"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsdesigntimeonly
|
||
msgid "Designtime only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdesktop
|
||
msgid "Desktop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdesktopfiles
|
||
msgid "Desktop files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pdestinationpackage
|
||
msgid "Destination Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
|
||
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenudiff
|
||
msgid "Diff"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdirection
|
||
msgid "Direction"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdirectorydoesnotexist
|
||
msgid "Directory does not exist"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfiledirectoryoptions
|
||
msgid "Directory options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgeddisplay
|
||
msgid "Display"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglnumsbct
|
||
msgid "Display Line Numbers in Run-time Error Backtraces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcfdividerdrawlevel
|
||
msgid "Divider Draw Level"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdonotclosetheide
|
||
msgid "Do not close the IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgnotsplitlinefront
|
||
msgid "Do not split line In front of:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgnotsplitlineafter
|
||
msgid "Do not split line after:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisconfirmlazarusrebuild
|
||
msgid "Do you want to rebuild Lazarus?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsiwpdocked
|
||
msgid "Docked"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdocumentationeditor
|
||
msgid "Documentation Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocnodocumentation
|
||
msgid "Documentation entry does not exist"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortseldomain
|
||
msgid "Domain"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdoubleclickline
|
||
msgid "Double click line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
||
msgid "Double click on messages jumps (otherwise: single click)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdownword
|
||
msgid "Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdragdroped
|
||
msgid "Drag Drop editing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdropfiles
|
||
msgid "Drop files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuenvironent
|
||
msgid "E&nvironment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsedit
|
||
msgid "Edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckediteditgeneraloptions
|
||
msgid "Edit General Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeditkeys
|
||
msgid "Edit Keys"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
|
||
msgid "Edit Options to compile package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeditforcmd
|
||
msgid "Edit keys for command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgededit
|
||
msgid "Edit..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedfiles
|
||
msgid "Editor files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgeditorfont
|
||
msgid "Editor font"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgeditorfontheight
|
||
msgid "Editor font height"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditoroptions
|
||
msgid "Editor options ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:uemeditorproperties
|
||
msgid "Editor properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedelement
|
||
msgid "Element"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenabled
|
||
msgid "Enabled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenclose
|
||
msgid "Enclose"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemencloseselection
|
||
msgid "Enclose Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuencloseselection
|
||
msgid "Enclose selection ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:srvk_end
|
||
msgid "End"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageenglish
|
||
msgid "English"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisentertransla
|
||
msgid "Enter translation language"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgentirescope
|
||
msgid "Entire Scope"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrunoenvironment
|
||
msgid "Environment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatenvmenu
|
||
msgid "Environment menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenugeneraloptions
|
||
msgid "Environment options ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:liscodetemplerror
|
||
msgid "Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoerroraccessingxml
|
||
msgid "Error accessing xml"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
|
||
msgid "Error accessing xml file %s%s%s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorcreatinglrs
|
||
msgid "Error creating lrs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorin
|
||
msgid "Error in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorinitializingprogramserrors
|
||
msgid "Error initializing program%s%s%s%s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoerrorloadingxml
|
||
msgid "Error loading xml"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
|
||
msgid "Error loading xml file %s%s%s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorreading
|
||
msgid "Error reading %s%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
|
||
msgid "Error reading project info file %s%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
|
||
msgid "Error while writing %s%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
|
||
msgid "Error while writing project info file %s%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorwritingfile
|
||
msgid "Error writing file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserror
|
||
msgid "Error: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrors
|
||
msgid "Errors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_escape
|
||
msgid "Escape"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuevaluate
|
||
msgid "Evaluate/Modify ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
|
||
msgid "Event Log"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocexampletag
|
||
msgid "Example"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexcludefilter
|
||
msgid "Exclude Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_execute
|
||
msgid "Execute"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexecutionpaused
|
||
msgid "Execution paused"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexecutionpausedadress
|
||
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexecutionstoppedon
|
||
msgid "Execution stopped%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsexit
|
||
msgid "Exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexportlist
|
||
msgid "Export list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlexpression
|
||
msgid "Expression"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolexternaltools
|
||
msgid "External tools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisextract
|
||
msgid "Extract"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemextractproc
|
||
msgid "Extract Procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecextractproc
|
||
msgid "Extract procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuextractproc
|
||
msgid "Extract procedure ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
|
||
msgid "FPC Source Directory error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
|
||
msgid "FPC source directory \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolfailedtoruntool
|
||
msgid "Failed to run tool"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcofast
|
||
msgid "Faster Code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listodolfile
|
||
msgid "File"
|
||
msgstr "Fitxer"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
|
||
msgid "File %s%s%s already exists in the project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfilehaschangedsave
|
||
msgid "File %s%s%s has changed. Save?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfileisvirtual
|
||
msgid "File %s%s%s is virtual."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenotfound
|
||
msgid "File %s%s%s not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfilenotfound2
|
||
msgid "File %s%s%s not found.%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
|
||
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pfiletype
|
||
msgid "File Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
|
||
msgid "File already in package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilefilemaskbak
|
||
msgid "File mask (*;*.*;*.bak?)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pfilename
|
||
msgid "File name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfilenottext
|
||
msgid "File not text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispefilename
|
||
msgid "Filename:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvfiles
|
||
msgid "Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_final
|
||
msgid "Final"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufind
|
||
msgid "Find"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufindinfiles
|
||
msgid "Find &in files ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenufind2
|
||
msgid "Find ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenufinddeclarationatcursor
|
||
msgid "Find Declaration at cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemfindidentifierreferences
|
||
msgid "Find Identifier References"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenutemplatefindnext
|
||
msgid "Find Next"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufindcodeblockstart
|
||
msgid "Find code block start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscomppalfindcomponent
|
||
msgid "Find component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfinddeclaration
|
||
msgid "Find declaration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindidentifierrefs
|
||
msgid "Find identifier references"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindinfiles
|
||
msgid "Find in files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindnext
|
||
msgid "Find next"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindnextwordoccurrence
|
||
msgid "Find next word occurrence"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
|
||
msgid "Find other end of code block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfpfindpalettecomponent
|
||
msgid "Find palette component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindprevious
|
||
msgid "Find previous"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindprevwordoccurrence
|
||
msgid "Find previous word occurrence"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindproceduredefinition
|
||
msgid "Find procedure definiton"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindproceduremethod
|
||
msgid "Find procedure method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfind
|
||
msgid "Find text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecjumptoeditor
|
||
msgid "Focus to source editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgforecolor
|
||
msgid "Foreground color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsformdatafiledfm
|
||
msgid "Form data file (*.dfm)|*.dfm"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisformloaderror
|
||
msgid "Form load error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisformaterror
|
||
msgid "Format error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpofroms
|
||
msgid "Forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewforms
|
||
msgid "Forms..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmorderforwardone
|
||
msgid "Forward one"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfrforwardsearch
|
||
msgid "Forward search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascalcompilernotfound
|
||
msgid "Free Pascal Compiler not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
|
||
msgid "Free Pascal Sources not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcefile
|
||
msgid "FreePascal source file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcedirectory
|
||
msgid "Freepascal source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagefrench
|
||
msgid "French"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfromcursor
|
||
msgid "From Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
|
||
msgid "Function: chomp path delimiter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggpccomp
|
||
msgid "GPC (GNU Pascal Compiler) Compatible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinsertgplnotice
|
||
msgid "GPL notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinsertgeneral
|
||
msgid "General"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditgeneraloptions
|
||
msgid "General Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecenvironmentoptions
|
||
msgid "General environment options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcodbx
|
||
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcogdb
|
||
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcogenerate
|
||
msgid "Generate:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagegerman
|
||
msgid "German"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggetposition
|
||
msgid "Get position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgglobal
|
||
msgid "Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
|
||
msgid "Global Source Path addition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecgotomarker
|
||
msgid "Go to Marker %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecgotolinenumber
|
||
msgid "Go to line number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecgotoincludedirective
|
||
msgid "Go to to include directive of current include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenugotoincludedirective
|
||
msgid "Goto include directive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenugotoline
|
||
msgid "Goto line ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisuegotoline
|
||
msgid "Goto line :"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemnextbookmark
|
||
msgid "Goto next Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemprevbookmark
|
||
msgid "Goto previous Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listodolistgotoline
|
||
msgid "Goto selected source line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmgrabkey
|
||
msgid "Grab key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmgrabsecondkey
|
||
msgid "Grab second key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggridx
|
||
msgid "Grid size X"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecguessmisplacedifdef
|
||
msgid "Guess misplaced $IFDEF"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuguessmisplacedifdef
|
||
msgid "Guess misplaced IFDEF/ENDIF"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuguessunclosedblock
|
||
msgid "Guess unclosed block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgguttercolor
|
||
msgid "Gutter color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggutterwidth
|
||
msgid "Gutter width"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditorhandleonclickevent
|
||
msgid "Handle OnClick Event"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_hanja
|
||
msgid "Hanja"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2phasregisterprocedure
|
||
msgid "Has Register procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgheapsize
|
||
msgid "Heap Size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "עברית"
|
||
|
||
#: lazarusidestrconsts:dlgheightpos
|
||
msgid "Height:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_help
|
||
msgid "Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
|
||
msgid "Help for FreePascal Compiler message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedhintcommand
|
||
msgid "Hint: click on the command you want to edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
|
||
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_home
|
||
msgid "Home"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghostapplication
|
||
msgid "Host application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uenotimplcapagain
|
||
msgid "I told You: Not implemented yet"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmid
|
||
msgid "ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uepins
|
||
msgid "INS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsidentifier
|
||
msgid "Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedidcomlet
|
||
msgid "Identifier completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uenotimpltext
|
||
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsifdef
|
||
msgid "IfDef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgignoreverb
|
||
msgid "Ignore"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
|
||
msgid "Ignore and save package now"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
|
||
msgid "Ignore disk changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisignoremissingfile
|
||
msgid "Ignore missing file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisimportlist
|
||
msgid "Import list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgassertcode
|
||
msgid "Include Assertion Code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoincfiles
|
||
msgid "Include Files (-Fi):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisincludefilter
|
||
msgid "Include Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfileincludesubdirectories
|
||
msgid "Include sub directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgindentcodeto
|
||
msgid "Indent code to"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuindentselection
|
||
msgid "Indent selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoinherited
|
||
msgid "Inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_insert
|
||
msgid "Insert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuconditionalselection
|
||
msgid "Insert $IFDEF..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Inserir plantilla del projecte Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
|
||
msgid "Insert From Template..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
|
||
msgid "Insert Lazarus Directory Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctinsertmacro
|
||
msgid "Insert Macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
|
||
msgid "Insert New Item (after)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
|
||
msgid "Insert New Item (before)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdochintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdochintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinsertcharacter
|
||
msgid "Insert from Character Map"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdochintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdochintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinserttext
|
||
msgid "Insert text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdochintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdochintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinspect
|
||
msgid "Inspect ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditinstall
|
||
msgid "Install"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditinstallpackageintheide
|
||
msgid "Install package in the IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckexplinstalled
|
||
msgid "Installed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinstalledpackages
|
||
msgid "Installed Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrminterface
|
||
msgid "Interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidcircle
|
||
msgid "Invalid Circle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidcompilerfilename
|
||
msgid "Invalid Compiler Filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
|
||
msgid "Invalid Exclude filter"
|
||
msgstr "Filtre Exclude no vàlid"
|
||
|
||
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
|
||
msgid "Invalid Free Pascal source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispublprojinvalidincludefilter
|
||
msgid "Invalid Include filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
|
||
msgid "Invalid compiler filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvaliddestinationdirectory
|
||
msgid "Invalid destination directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
|
||
msgid "Invalid make filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidpackagename
|
||
msgid "Invalid packagename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
|
||
msgid "Invalid pascal unit name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:ueminvertassignment
|
||
msgid "Invert Assignment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinvertassignment
|
||
msgid "Invert assignment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_irregular
|
||
msgid "Irregular "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "איטלקית"
|
||
|
||
#: lazarusidestrconsts:dlgedital
|
||
msgid "Italic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgoiitemheight
|
||
msgid "Item height"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenujumpback
|
||
msgid "Jump back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenujumpforward
|
||
msgid "Jump forward"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenujumptonextbookmark
|
||
msgid "Jump to next bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenujumptonexterror
|
||
msgid "Jump to next error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenujumptoprevbookmark
|
||
msgid "Jump to previous bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenujumptopreverror
|
||
msgid "Jump to previous error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr ")"
|
||
|
||
#: lazarusidestrconsts:srvk_junja
|
||
msgid "Junja"
|
||
msgstr "Junja"
|
||
|
||
#: lazarusidestrconsts:srvk_kana
|
||
msgid "Kana"
|
||
msgstr "Kana"
|
||
|
||
#: lazarusidestrconsts:liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgkeepcaretx
|
||
msgid "Keep caret X position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcokeepvarsreg
|
||
msgid "Keep certain variables in registers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskeepname
|
||
msgid "Keep name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolkey
|
||
msgid "Key"
|
||
msgstr "Tecla"
|
||
|
||
#: lazarusidestrconsts:srkmkey
|
||
msgid "Key (or 2 keys combination)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgkeymappingscheme
|
||
msgid "Key Mapping Scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislclwidgettype
|
||
msgid "LCL Widget Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildlclinterface
|
||
msgid "LCL interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislclunitpathmissing
|
||
msgid "LCL unit path missing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislfmfile
|
||
msgid "LFM file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislfmfilenotfound
|
||
msgid "LFM file not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuinsertlgplnotice
|
||
msgid "LGPL notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvlanguage
|
||
msgid "Language"
|
||
msgstr "שפה"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtlast
|
||
msgid "Last"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdoc
|
||
msgid "LazDoc"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenulazdoc
|
||
msgid "LazDoc Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocmainformcaption
|
||
msgid "LazDoc editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocpathsgroupbox
|
||
msgid "LazDoc settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanglazarus
|
||
msgid "Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusdesktopsettings
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
|
||
msgid "Lazarus Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazaruseditorv
|
||
msgid "Lazarus Editor v%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusfile
|
||
msgid "Lazarus File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusprojectinfofile
|
||
msgid "Lazarus Project Info file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:locwndsrceditor
|
||
msgid "Lazarus Source Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
|
||
msgid "Lazarus directory \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusdirectorynotfound
|
||
msgid "Lazarus directory not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusform
|
||
msgid "Lazarus form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusinclude
|
||
msgid "Lazarus include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazaruspackage
|
||
msgid "Lazarus package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusproject
|
||
msgid "Lazarus project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusprojectsource
|
||
msgid "Lazarus project source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusunit
|
||
msgid "Lazarus unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleaveemptyfo
|
||
msgid "Leave empty for default .po file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_left
|
||
msgid "Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftsides
|
||
msgid "Left sides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgleftpos
|
||
msgid "Left:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglevelnoneopt
|
||
msgid "Level 0 (no extra Optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglevel1opt
|
||
msgid "Level 1 (Quick Optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglevel2opt
|
||
msgid "Level 2 (Level 1 + Slower Optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglevel3opt
|
||
msgid "Level 3 (Level 2 + Uncertain)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
|
||
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptslicense
|
||
msgid "License:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaboutlazarusmsg
|
||
msgid "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers."
|
||
msgstr "License: GPL/LGPL%sLazarus are the class libraries for Free Pascal that emulate Delphi. Free Pascal is a (L)GPL'ed compiler that runs on Linux, Win32, OS/2, 68K and more. Free Pascal is designed to be able to understand and compile Delphi syntax, which is of course OOP.%sLazarus is the missing part of the puzzle that will allow you to develop Delphi like programs in all of the above platforms. The IDE will eventually become a RAD tool like Delphi.%sAs Lazarus is growing we need more developers."
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
|
||
msgid "Limit linecount to"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listodolline
|
||
msgid "Line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortsellines
|
||
msgid "Lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidlines
|
||
msgid "Lines:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglinksmart
|
||
msgid "Link Smart"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglinklibraries
|
||
msgid "Link Style:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcolinking
|
||
msgid "Linking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgloaddfile
|
||
msgid "Load desktop settings from file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoloadsave
|
||
msgid "Load/Save"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckexplloadedpackages
|
||
msgid "Loaded Packages:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrunolocal
|
||
msgid "Local"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenulowercaseselection
|
||
msgid "Lowercase selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolmacros
|
||
msgid "Macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
|
||
msgid "Main Unit has Application.CreateForm statements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
|
||
msgid "Main Unit has Application.Title statements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
|
||
msgid "Main Unit has Uses Section containing all Units of project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismainunitispascalsource
|
||
msgid "Main Unit is Pascal Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmakepath
|
||
msgid "Make path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecmakeresourcestring
|
||
msgid "Make resource string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissmatches
|
||
msgid "Matches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_menu
|
||
msgid "Menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewmessages
|
||
msgid "Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmethodinspolicy
|
||
msgid "Method insert policy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgminimizeallonminimizemain
|
||
msgid "Minimize all on minimize main"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmmirrorhorizontal
|
||
msgid "Mirror horizontal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmmirrorvertical
|
||
msgid "Mirror vertical"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvmisc
|
||
msgid "Miscellaneous"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_modechange
|
||
msgid "Mode Change"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemodified
|
||
msgid "Modified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmmodule
|
||
msgid "Module"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditmore
|
||
msgid "More ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_lbutton
|
||
msgid "Mouse Button Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_mbutton
|
||
msgid "Mouse Button Middle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_rbutton
|
||
msgid "Mouse Button Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmouselinks
|
||
msgid "Mouse links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorleft
|
||
msgid "Move Editor Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorright
|
||
msgid "Move Editor Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditmovepathdown
|
||
msgid "Move path down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditmovepathup
|
||
msgid "Move path up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmordermovetoback
|
||
msgid "Move to back"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmordermovetofront
|
||
msgid "Move to front"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmultiline
|
||
msgid "Multiline"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilemultiline
|
||
msgid "Multiline pattern"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
|
||
msgid "NOTE: only absolute paths are supported now"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmname
|
||
msgid "Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsname
|
||
msgid "Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgnaming
|
||
msgid "Naming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplatenew
|
||
msgid "New"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenunewother
|
||
msgid "New ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisnewancestors
|
||
msgid "New Ancestors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewclass
|
||
msgid "New Class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pnewcomponent
|
||
msgid "New Component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenunewform
|
||
msgid "New Form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenunewprojectfromfile
|
||
msgid "New Project from file ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditornewtemplatedescription
|
||
msgid "New Template Description..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenunewunit
|
||
msgid "New Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_next
|
||
msgid "Next"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnochange
|
||
msgid "No change"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgednoerr
|
||
msgid "No errors in key mapping found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipnopackageselected
|
||
msgid "No package selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnoprogramfilesfound
|
||
msgid "No program file %s%s%s found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
|
||
msgid "Node and its children are only valid for this project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_nonconvert
|
||
msgid "Nonconvert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvnone
|
||
msgid "None"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgconormal
|
||
msgid "Normal Code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
|
||
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotadelphiproject
|
||
msgid "Not a Delphi project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotadelphiunit
|
||
msgid "Not a Delphi unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuenotfound
|
||
msgid "Not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotnow
|
||
msgid "Not now"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
|
||
msgid "Note: All keys will be set to the values of the choosen scheme."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_numlock
|
||
msgid "Numlock"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_numpad
|
||
msgid "Numpad %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisifdok
|
||
msgid "OK"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uepovr
|
||
msgid "OVR"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsobject
|
||
msgid "Object"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewobjectinspector
|
||
msgid "Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisokbtn
|
||
msgid "Ok"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoldancestors
|
||
msgid "Old Ancestors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoldclass
|
||
msgid "Old Class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceoonidle
|
||
msgid "On idle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
|
||
msgid "Online Help not yet implemented"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintopen
|
||
msgid "Open"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopen
|
||
msgid "Open ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
|
||
msgid "Open Diff in editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplateopenrecent
|
||
msgid "Open Recent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecent
|
||
msgid "Open Recent ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecentproject
|
||
msgid "Open Recent Project ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenfile
|
||
msgid "Open file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecopenfileatcursor
|
||
msgid "Open file at cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopenfilenameatcursor
|
||
msgid "Open filename at cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgqopenlastprj
|
||
msgid "Open last project at start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipopenloadedpackage
|
||
msgid "Open loaded package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackage
|
||
msgid "Open loaded package ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
|
||
msgid "Open or Load Compiler Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackagefile
|
||
msgid "Open package file (.lpk) ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackageofcurunit
|
||
msgid "Open package of current unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenproject2
|
||
msgid "Open project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoopenrecent
|
||
msgid "Open recent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecentpkg
|
||
msgid "Open recent package ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgoptimiz
|
||
msgid "Optimizations:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfropts
|
||
msgid "Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoopts
|
||
msgid "Options: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmorder
|
||
msgid "Order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoother
|
||
msgid "Other"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcosources
|
||
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgotherunitfiles
|
||
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvotherfiles
|
||
msgid "Other files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpooutputsettings
|
||
msgid "Output Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispackage
|
||
msgid "Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckexplpackagenotfound
|
||
msgid "Package %s not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagechangedsave
|
||
msgid "Package %s%s%s changed. Save?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
|
||
msgid "Package %s%s%s has changed.%sSave package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
|
||
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2ppackagenotfound
|
||
msgid "Package %s%s%s not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenupackagegraph
|
||
msgid "Package Graph ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lispackageinfo
|
||
msgid "Package Info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagefilemissing
|
||
msgid "Package file missing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
|
||
msgid "Package file not saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is no designtime package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptspackagetype
|
||
msgid "PackageType"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispackagestoinstallintheide
|
||
msgid "Packages to install in the IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscmparameter
|
||
msgid "Parameter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node can not contain child nodes."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispascalsourcefile
|
||
msgid "Pascal source file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispascalunit
|
||
msgid "Pascal unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpassoptslinker
|
||
msgid "Pass Options To The Linker (Delimiter is space)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenupaste
|
||
msgid "Paste"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpaste
|
||
msgid "Paste clipboard to current position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listofpcpath
|
||
msgid "Path:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidpathsreadonly
|
||
msgid "Paths (Read Only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenupause
|
||
msgid "Pause"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_pause
|
||
msgid "Pause key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpersistentcaret
|
||
msgid "Persistent caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplzcheckthecompilername
|
||
msgid "Please check the compiler name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory
|
||
msgid "Please check the freepascal source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring
|
||
msgid "Please choose a resourstring section from the list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmpresskey
|
||
msgid "Please press a key ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
|
||
msgid "Please save the package first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
|
||
msgid "Please select a package to open"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "פולנית"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolishwin
|
||
msgid "Polish(CP1250)"
|
||
msgstr "(CP1250) פולנית"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolishiso
|
||
msgid "Polish(ISO 8859-2)"
|
||
msgstr "(ISO 8859-2) פולנית"
|
||
|
||
#: lazarusidestrconsts:rslanguageportugues
|
||
msgid "Portuguese"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwrdpreview
|
||
msgid "Preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtpreview
|
||
msgid "Preview (Max line length = 1)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_print
|
||
msgid "Print"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listodolistprintlist
|
||
msgid "Print todo items"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_prior
|
||
msgid "Prior"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprocedure
|
||
msgid "Procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecprocedurelist
|
||
msgid "Procedure List ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprogram
|
||
msgid "Program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
|
||
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolprogramfilename
|
||
msgid "Programfilename:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispdprogress
|
||
msgid "Progress"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvproject
|
||
msgid "Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
|
||
msgid "Project %s%s%s successfully built. :)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectincpath
|
||
msgid "Project IncPath"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectinformation
|
||
msgid "Project Information"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectsrcpath
|
||
msgid "Project SrcPath"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectunitpath
|
||
msgid "Project UnitPath"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectdirectory
|
||
msgid "Project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgprojfiles
|
||
msgid "Project files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpromptonreplace
|
||
msgid "Prompt On Replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpropnamecolor
|
||
msgid "Property name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuquickcompile
|
||
msgid "Quick compile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuquicksyntaxcheck
|
||
msgid "Quick syntax check"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuquit
|
||
msgid "Quit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcorange
|
||
msgid "Range"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisreaderror
|
||
msgid "Read Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemreadonly
|
||
msgid "Read Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uepreadonly
|
||
msgid "Readonly"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompileallrequired
|
||
msgid "Recompile all required"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompileclean
|
||
msgid "Recompile clean"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuredo
|
||
msgid "Redo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgunitdeprefresh
|
||
msgid "Refresh"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listodolistrefresh
|
||
msgid "Refresh todo items"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysregistrationerror
|
||
msgid "Registration Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgregularexpressions
|
||
msgid "Regular Expressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfileregularexpressions
|
||
msgid "Regular expressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffrevertall
|
||
msgid "Reload from disk"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolremove
|
||
msgid "Remove"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefilefrompackage
|
||
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
|
||
msgid "Remove from favourite properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisremovefromproject
|
||
msgid "Remove from project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisremovethem
|
||
msgid "Remove them"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
||
msgid "Removed Files (these entries are not saved to the lpk file)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
|
||
msgid "Removed required packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
||
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfrirename
|
||
msgid "Rename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemrenameidentifier
|
||
msgid "Rename Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
|
||
msgid "Rename file in package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecrenameidentifier
|
||
msgid "Rename identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfrirenameto
|
||
msgid "Rename to"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenureplace
|
||
msgid "Replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenureplace2
|
||
msgid "Replace ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecreplace
|
||
msgid "Replace text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgreport
|
||
msgid "Report"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
|
||
msgid "Rescan FPC source directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuresetdebugger
|
||
msgid "Reset debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisresourceloaderror
|
||
msgid "Resource load error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenurestart
|
||
msgid "Restart"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildrestartafterbuild
|
||
msgid "Restart After Successfull Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Restaurar geometria de la finestra"
|
||
|
||
#: lazarusidestrconsts:rsiwprestorewindowsize
|
||
msgid "Restore window size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_return
|
||
msgid "Return"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenurevert
|
||
msgid "Revert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_right
|
||
msgid "Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrightclickselects
|
||
msgid "Right Click selects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
||
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrightmargincolor
|
||
msgid "Right margin color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrightmousemovescursor
|
||
msgid "Right mouse moves caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrightsides
|
||
msgid "Right sides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrubberbandgroup
|
||
msgid "Rubber band"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuprojectrun
|
||
msgid "Run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenurunfile
|
||
msgid "Run File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenurunparameters
|
||
msgid "Run Parameters ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrunparameters
|
||
msgid "Run parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuruntocursor
|
||
msgid "Run to cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsruntimeonly
|
||
msgid "Runtime only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "רוסית"
|
||
|
||
#: lazarusidestrconsts:lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenusave
|
||
msgid "Save"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissavespace
|
||
msgid "Save "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenusaveall
|
||
msgid "Save All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplatesaveas
|
||
msgid "Save As"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcharcasefileact
|
||
msgid "Save As - auto rename pascal files lower case"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenusaveas
|
||
msgid "Save As ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenueditorsaveastemplate
|
||
msgid "Save As Template..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditsavechanges
|
||
msgid "Save Changes?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackage
|
||
msgid "Save Package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissaveprojectlpi
|
||
msgid "Save Project %s (*.lpi)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintsaveall
|
||
msgid "Save all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissaveallmessagestofile
|
||
msgid "Save all messages to file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsavedfile
|
||
msgid "Save desktop settings to file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissavefilebeforeclosingform
|
||
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmsaveformasxml
|
||
msgid "Save form as xml"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisposaveinideconfigdirectory
|
||
msgid "Save in IDE config directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditsavepackage
|
||
msgid "Save package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackage2
|
||
msgid "Save package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildsavesettings
|
||
msgid "Save settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecosavetorecent
|
||
msgid "Save to recent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmscaleword
|
||
msgid "Scale"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
|
||
msgid "Scan Unit for Unit Name and Register procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for Free Pascal Compiler messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for make messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgscope
|
||
msgid "Scope"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_scroll
|
||
msgid "Scroll"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgscrollpastendline
|
||
msgid "Scroll past end of line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissearchfor
|
||
msgid "Search For "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissearchagain
|
||
msgid "Search again"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisssearchtext
|
||
msgid "Search text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfrisearchwhere
|
||
msgid "Search where"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisssearching
|
||
msgid "Searching"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsearchcaption
|
||
msgid "Searching..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocseealsotag
|
||
msgid "See also"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisseemessages
|
||
msgid "See messages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselleft
|
||
msgid "SelLeft"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselright
|
||
msgid "SelRight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuselect
|
||
msgid "Select"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselectall
|
||
msgid "Select All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecsellineend
|
||
msgid "Select Line End"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecsellinestart
|
||
msgid "Select Line Start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditorselectmenu
|
||
msgid "Select Menu:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselpagebottom
|
||
msgid "Select Page Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselpagetop
|
||
msgid "Select Page Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditorselecttemplate
|
||
msgid "Select Template:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselup
|
||
msgid "Select Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselwordleft
|
||
msgid "Select Word Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecselwordright
|
||
msgid "Select Word Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisselectanode
|
||
msgid "Select a node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnpselectaprojecttype
|
||
msgid "Select a project type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuselectall
|
||
msgid "Select all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuselectcodeblock
|
||
msgid "Select code block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditselectdirectory
|
||
msgid "Select directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
|
||
msgid "Select grand childs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuselectline
|
||
msgid "Select line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuselectparagraph
|
||
msgid "Select paragraph"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuselecttobrace
|
||
msgid "Select to brace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuselectword
|
||
msgid "Select word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgselectedtext
|
||
msgid "Selected Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckexplisrequiredby
|
||
msgid "Selected package is required by:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgruberbandselectioncolor
|
||
msgid "Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgposavesession
|
||
msgid "Session"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecsetmarker
|
||
msgid "Set Marker %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemsetfreebookmark
|
||
msgid "Set a free Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenusetfreebookmark
|
||
msgid "Set a free bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildsettobuildall
|
||
msgid "Set to %sBuild All%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_shift
|
||
msgid "Shift"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazdocshorttag
|
||
msgid "Short"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pshowall
|
||
msgid "Show All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoshowerr
|
||
msgid "Show Errors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowhint
|
||
msgid "Show Hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghintsparametersendernotused
|
||
msgid "Show Hints for parameter \"Sender\" not used"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghintsunused
|
||
msgid "Show Hints for unused units in main source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshownotes
|
||
msgid "Show Notes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoshowoptions
|
||
msgid "Show Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmshowoptions
|
||
msgid "Show Options for form editing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowwarnings
|
||
msgid "Show Warnings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pshowall
|
||
msgid "Show all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoshowallmessages
|
||
msgid "Show all messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowprocserror
|
||
msgid "Show all procs on error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecshowcodecontext
|
||
msgid "Show code context"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowcompileroptions
|
||
msgid "Show compiler options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowcaps
|
||
msgid "Show component captions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowdefinedmacros
|
||
msgid "Show defined macros"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowedrhints
|
||
msgid "Show editor hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisshowhintsinobjectinspector
|
||
msgid "Show hints in Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowlinenumbers
|
||
msgid "Show line numbers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshownothing
|
||
msgid "Show nothing (only errors)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisshowoldtaborder
|
||
msgid "Show old tab order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowscrollhint
|
||
msgid "Show scroll hint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissibling
|
||
msgid "Sibling"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissimplesyntax
|
||
msgid "Simple Syntax"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmsizeword
|
||
msgid "Size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidsize
|
||
msgid "Size:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoskipcallingcompiler
|
||
msgid "Skip calling Compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcosmaller
|
||
msgid "Smaller Code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcosmartlinkable
|
||
msgid "Smart Linkable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_snapshot
|
||
msgid "Snapshot"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissorrynotimplementedyet
|
||
msgid "Sorry, not implemented yet"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenusortselection
|
||
msgid "Sort selection ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenuviewsourceeditor
|
||
msgid "Source Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuaddbpsource
|
||
msgid "Source breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
|
||
msgid "Source directory %s%s%s does not exist."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissourceofpagehaschangedsave
|
||
msgid "Source of page %s%s%s has changed. Save?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgspacenotcosmos
|
||
msgid "Space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_space
|
||
msgid "Space key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidsrc
|
||
msgid "Src"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcostack
|
||
msgid "Stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipstate
|
||
msgid "State"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgstatickeyword
|
||
msgid "Static Keyword in Objects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintstepover
|
||
msgid "Step Over"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenustepinto
|
||
msgid "Step into"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenustepover
|
||
msgid "Step over"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenustop
|
||
msgid "Stop"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
|
||
msgid "Store dependency filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcostrip
|
||
msgid "Strip Symbols From Executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcostyle
|
||
msgid "Style:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsubpropkcolor
|
||
msgid "Subpropertes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissuccess
|
||
msgid "Success"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
|
||
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecsyntaxcheck
|
||
msgid "Syntax check"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbp7cptb
|
||
msgid "TP/BP 7.0 Compatible"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_tab
|
||
msgid "Tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listaborderof
|
||
msgid "Tab Order of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmtaborder
|
||
msgid "Tab order..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liseotabwidths
|
||
msgid "Tab widths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutabstospacesselection
|
||
msgid "Tabs to spaces in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetdirectory
|
||
msgid "Target Directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listargetos
|
||
msgid "Target OS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscotargetosspecificoptions
|
||
msgid "Target OS specific options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtargetplatform
|
||
msgid "Target Platform:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpotargetfilename
|
||
msgid "Target file name:"
|
||
msgstr "Nom del fitxer destinació:"
|
||
|
||
#: lazarusidestrconsts:listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtargetproc
|
||
msgid "Target i386"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditortemplatepreview
|
||
msgid "Template Preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtplfname
|
||
msgid "Template file name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscomptest
|
||
msgid "Test"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listestdirectory
|
||
msgid "Test directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypetext
|
||
msgid "Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtextattributes
|
||
msgid "Text attributes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatmarker
|
||
msgid "Text marker commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfiletexttofind
|
||
msgid "Text to find:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgtext1
|
||
msgid "Text1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgtext2
|
||
msgid "Text2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
|
||
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, fcl, packages, compiler, ... ."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
||
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
||
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
||
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
||
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
|
||
msgid "The Lazarus main directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
|
||
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
|
||
msgid "The class name %s%s%s is not a valid pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecommandafterisnotexecutable
|
||
msgid "The command after %s%s%s is not executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
|
||
msgid "The compiler file \"%s\" is not an executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class %s%s%shas created the error:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuethecurre
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
|
||
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
|
||
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s%s%s%s does not exist."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgthedirectory
|
||
msgid "The directory \""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefile
|
||
msgid "The file %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s is already in the package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
|
||
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefileisnotadelphiunit
|
||
msgid "The file %s%s%s is not a Delphi unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
|
||
msgid "The file %s%s%s is not a lazarus package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
|
||
msgid "The file %s%s%s%sof package %s is missing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
|
||
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
|
||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uefilerotext1
|
||
msgid "The file \""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
|
||
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application %s%s%s is not executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
|
||
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
|
||
msgid "The make file \"%s\" is not an executable."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
|
||
msgid "The name %s%s%s is not a valid pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
|
||
msgid "The name \"%s\" is not a valid pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
|
||
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
|
||
msgid "The package has already a dependency for the package %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
||
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
|
||
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name %s%s%s is too long (max 100 chars)."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrchooseanothername
|
||
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
|
||
msgid "The root component can not be deleted."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
|
||
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
|
||
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name %s%s%s does not correspond to the filename."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname %s%s%s already exists in this package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
|
||
msgid "There are more functions in the popupmenu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
|
||
msgid "There is a circle in the required packages. See package graph."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose
|
||
msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
|
||
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
|
||
msgid "There is already another component with the name %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
||
msgid "This file was automatically created by Lazarus. Do not edit!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisresourcefilecomment
|
||
msgid "This is an automatically generated lazarus resource file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
||
msgid "This source is only used to compile and install the package."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpotitle
|
||
msgid "Title:"
|
||
msgstr ": כותרת"
|
||
|
||
#: lazarusidestrconsts:listodolistcaption
|
||
msgid "ToDo List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listodolistoptions
|
||
msgid "ToDo options..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewtoggleformunit
|
||
msgid "Toggle form/unit view"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefstools
|
||
msgid "Tools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtooltipeval
|
||
msgid "Tooltip expression evaluation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtooltiptools
|
||
msgid "Tooltip symbol Tools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtoppos
|
||
msgid "Top:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listops
|
||
msgid "Tops"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvtype
|
||
msgid "Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidtype
|
||
msgid "Type:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletobackupfileto
|
||
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertfileerror
|
||
msgid "Unable to convert file %s%s%s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
|
||
msgid "Unable to convert lfm to lrs and write lrs file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfileto
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfileto2
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatedirectory2
|
||
msgid "Unable to create directory %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatedirectory
|
||
msgid "Unable to create directory %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile2
|
||
msgid "Unable to create file %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefilename
|
||
msgid "Unable to create file %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile3
|
||
msgid "Unable to create file%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin
|
||
msgid "Unable to create new method. Plz fix the error shown in the message window."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletofindfile
|
||
msgid "Unable to find file %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage
|
||
msgid "Unable to find method. Plz fix the error shown in the message window."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugunabletoloadfile2
|
||
msgid "Unable to load file %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
|
||
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfile2
|
||
msgid "Unable to read file %s%s%s!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfileerror
|
||
msgid "Unable to read file %s%s%s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfilename
|
||
msgid "Unable to read file %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file %s%s%s.%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file %s%s%s!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefileto
|
||
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefileto2
|
||
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Plz fix the error shown in the message window."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolunabletorunthetool
|
||
msgid "Unable to run the tool %s%s%s:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletosavefile
|
||
msgid "Unable to save file %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage
|
||
msgid "Unable to show method. Plz fix the error shown in the message window."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowrite
|
||
msgid "Unable to write %s%s%s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefile2
|
||
msgid "Unable to write file %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefileerror
|
||
msgid "Unable to write file %s%s%s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefilename
|
||
msgid "Unable to write file %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowritetofile2
|
||
msgid "Unable to write to file %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowritetofile
|
||
msgid "Unable to write to file %s%s%s!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlguncertopt
|
||
msgid "Uncertain Optimizations"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuuncommentselection
|
||
msgid "Uncomment selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedunder
|
||
msgid "Underline"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuundo
|
||
msgid "Undo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuunindentselection
|
||
msgid "Unindent selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeunit
|
||
msgid "Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunithaschangedsave
|
||
msgid "Unit %s%s%s has changed. Save?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
|
||
msgid "Unit %s%s%s was removed from package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemshowunitinfo
|
||
msgid "Unit Info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2punitname
|
||
msgid "Unit Name: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcounitstyle
|
||
msgid "Unit Style:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgunitdepcaption
|
||
msgid "Unit dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2punitfilename
|
||
msgid "Unit file name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunitnotfound
|
||
msgid "Unit not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitnotfound
|
||
msgid "Unit not found: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunitlfmfile
|
||
msgid "Unit: %s%sLFM file: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunitsnotfound2
|
||
msgid "Units not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewunits
|
||
msgid "Units..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_unknown
|
||
msgid "Unknown"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgupword
|
||
msgid "Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceoupdate
|
||
msgid "Update"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsupdaterebuild
|
||
msgid "Update/Rebuild"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuuppercaseselection
|
||
msgid "Uppercase selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoansistr
|
||
msgid "Use Ansi Strings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuseexcludefilter
|
||
msgid "Use Exclude Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoheaptrc
|
||
msgid "Use Heaptrc Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuseincludefilter
|
||
msgid "Use Include Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgusecustomconfig
|
||
msgid "Use addional Compiler Config File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedusedefcolor
|
||
msgid "Use default color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgusefpccfg
|
||
msgid "Use standard Compiler Config File (fpc.cfg)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
|
||
msgid "Use windowmanager setting"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecuserfirst
|
||
msgid "User First"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgvaluecolor
|
||
msgid "Value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrunovariable
|
||
msgid "Variable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisversion
|
||
msgid "Version"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisvertical
|
||
msgid "Vertical"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewanchoreditor
|
||
msgid "View Anchor Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemviewcallstack
|
||
msgid "View Call Stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewcomponentpalette
|
||
msgid "View Component Palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewidespeedbuttons
|
||
msgid "View IDE speed buttons"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewjumphistory
|
||
msgid "View Jump-History ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditviewpackgesource
|
||
msgid "View Package Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisviewprojectunits
|
||
msgid "View Project Units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewsource
|
||
msgid "View Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewprojecttodos
|
||
msgid "View ToDo List ..."
|
||
msgstr " ..."
|
||
|
||
#: lazarusidestrconsts:lismenuviewunitdependencies
|
||
msgid "View Unit Dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewunitinfo
|
||
msgid "View Unit Information"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintviewunits
|
||
msgid "View Units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmainviewforms
|
||
msgid "View project forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmainviewunits
|
||
msgid "View project units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewunits
|
||
msgid "View units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pisvirtualunit
|
||
msgid "Virtual unit (source is not in package)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlwatchlist
|
||
msgid "Watch list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgautocreatenewforms
|
||
msgid "When creating new forms, add them to auto-created forms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwholewordsonly
|
||
msgid "Whole Words Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilewholewordsonly
|
||
msgid "Whole words only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmwindow
|
||
msgid "Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwinpos
|
||
msgid "Window Positions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwindows
|
||
msgid "Windows"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildwithstaticpackages
|
||
msgid "With Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecwordcompletion
|
||
msgid "Word completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwordspolicies
|
||
msgid "Words"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswriteerror
|
||
msgid "Write Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwritefpclogo
|
||
msgid "Write an FPC logo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisxmlfiles
|
||
msgid "XML files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You can not build lazarus while debugging or compiling."
|
||
msgstr ".אינך יכול לבנות את לזרוס כאשר אתה מנפה או מהדר"
|
||
|
||
#: lazarusidestrconsts:dlgdoesnotexist
|
||
msgid "\" does not exist."
|
||
msgstr ".לא קיים \""
|
||
|
||
#: lazarusidestrconsts:uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr ".הוא לא לכתיבה \""
|
||
|
||
#: lazarusidestrconsts:srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecaddbreakpoint
|
||
msgid "add break point"
|
||
msgstr "הוסף נקודת מפסק"
|
||
|
||
#: lazarusidestrconsts:srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_apps
|
||
msgid "application key"
|
||
msgstr "מקש יישום"
|
||
|
||
#: lazarusidestrconsts:lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecbuildall
|
||
msgid "build all files of program/project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglefttopclr
|
||
msgid "color for left, top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgrightbottomclr
|
||
msgid "color for right, bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccompileroptions
|
||
msgid "compiler options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
|
||
msgid "compiler path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscustomoptions
|
||
msgid "custom options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodefault
|
||
msgid "default (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidinproject
|
||
msgid "in Project:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisincludepath
|
||
msgid "include path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinspect
|
||
msgid "inspect"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_lwin
|
||
msgid "left windows key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislibrarypath
|
||
msgid "library path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectmacrounitpath
|
||
msgid "macro ProjectUnitPath"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipmissing
|
||
msgid "missing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipmodified
|
||
msgid "modified"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidno
|
||
msgid "no"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgnoautomaticrenaming
|
||
msgid "no automatic renaming"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnoname
|
||
msgid "noname"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisobjectpath
|
||
msgid "object path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecpause
|
||
msgid "pause program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecremovebreakpoint
|
||
msgid "remove break point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srvk_rwin
|
||
msgid "right windows key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecrunfile
|
||
msgid "run file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecrun
|
||
msgid "run program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissaveallmodified
|
||
msgid "save all modified files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissavecurrenteditorfile
|
||
msgid "save current editor file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
|
||
msgid "search all files in project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
|
||
msgid "search all open files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchindirectories
|
||
msgid "search in directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtimesecondunit
|
||
msgid "sec"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunitpath
|
||
msgid "unit path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidyes
|
||
msgid "yes"
|
||
msgstr "כן"
|
||
|